[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA58208.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2oasA.bssp"
#ERROR : Can't open dsspfile "3eh7A.bssp"
#ERROR : Can't open dsspfile "3d3uA.bssp"
#ERROR : Can't open dsspfile "2g39B.bssp"
#ERROR : Can't open dsspfile "2g39A.bssp"
#ERROR : Can't open dsspfile "2nvvA.bssp"

## Summary of PDB Search
:728
    6e-11  36%  2oasA  [x.x.x] 4-HYDROXYBUTYRATE COENZYME A TRANSFERASE
    5e-08  32%  3eh7A  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    1e-06  33%  3d3uA  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    5e-05  39%  2g39B  [x.x.x] ACETYL-COA HYDROLASE
    5e-05  39%  2g39A  [x.x.x] ACETYL-COA HYDROLASE
    8e-05  36%  2nvvA  [x.x.x] ACETYL-COA HYDROLASE/TRANSFERASE FAMILY PROTEIN
:728

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2oasA           ----------------------------------------------------------------------
3eh7A           ----------------------------------------------------------------------
3d3uA           ----------------------------------------------------------------------
2g39B           ----------------------------------------------------------------------
2g39A           ----------------------------------------------------------------------
2nvvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2oasA           ----------------------------------------------------------------------
3eh7A           ----------------------------------------------------------------------
3d3uA           ----------------------------------------------------------------------
2g39B           ----------------------------------------------------------------------
2g39A           ----------------------------------------------------------------------
2nvvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILGQINPELPFMYGD
2oasA           -------------------------------------------------------IIAHINPQ-PRTHGD
3eh7A           -------------------------------------------------------VIGEINRQ-PYVHGD
3d3uA           ------------------------------------------------------------NKQMPFIGGE
2g39B           ----------------------------------------------------------------------
2g39A           ----------------------------------------------------------------------
2nvvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AQVPSENFDAIVDHPQYAFKLFGPPNMAINPSDYMIGLHASALIKDGGTIQLGIGSLSDAVTYLIKMRHQ
2oasA           GFIHIDRFAAVYEQPIHSFATGDAVSLAI-------GQHVAELVRDGDCLQ-GIGAIPDAVLSCL-TGHK
3eh7A           NLIHISKLDYIVDYPIYSLA-----KPKIGEVEEAIGRNCAELIEDGATLQLGIGAI-------------
3d3uA           NLIHISKLTHIIEVDEPIAEVLPGSDLELR-----IGQNCASLIKDGDTLQLGIGGIPDAVLRALE----
2g39B           ----------------------------------------------------------------------
2g39A           ----------------------------------------------------------------------
2nvvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YNAVYCALLSEANVLGKFEKMIHNVGGNEPFKEGLYATSEMFVDGFMQLYRSGILKRKVYPHETLQRLLN
2oasA           DLGVHTELFSD-GILQLVEKGVIN-NTKKRFYPGKLVTG--FALGSQKLY--------------------
3eh7A           ----------------------------------------------------------------------
3d3uA           ---------------GHKDLGIH---------------TEMFTDGVMRMIRKGIIKKTLHPEKVVTSLIF
2g39B           ----------------------------------------------------------------------
2g39A           ----------------------------------------------------------------------
2nvvA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ENKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2oasA           ----------------------------------------------------------------------
3eh7A           ----------------------------------------------------------------------
3d3uA           GSK-------------------------------------------------------------------
2g39B           ----------------------------------------------------------------------
2g39A           ----------------------------------------------------------------------
2nvvA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxFLGPQRFYNFLRGLKKEEREQFCMKRVAYVNQLYGSEELKRLQRKDARF
2oasA           ----------------------------------------------------------------------
3eh7A           ---------------------FLGSEDVYHFI-----DKNPDVELYPVDYVN------DPRVIAQNDNVS
3d3uA           ----------------------------------------------------------------------
2g39B           ----------------------------------------------------------------------
2g39A           ----------------------------------------------------------------------
2nvvA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LNSALMVTLNGAIISDKLEDGRTVSGVGGQYNFVAMAHALVDARSIIMLRSVREKHGEIHSNIIWNYGHT
2oasA           INSALQVDLTGQVCADSIGT-KIYSGVGGQ-DFIRGAGLSEGGRSVIALPSTAARISRIASVLSPGAGVV
3eh7A           INSCIEIDL-GQVVSECI-GSKQFSGTGGQVDYVRGAAWSKNGKSIAIPSTAKNGTASRIVPIIAEGAAV
3d3uA           -----MVSINSCLEMDLM-------GQAGQVDFLRGAKRSKGGISIMAFPSTAKKGTESRIVPILKTGRN
2g39B           INTALEFDIYGNVNSTHV--GGTKNGIGGSGDFARNAHL-----AIFVTKSIA-KGGNISSVVVSHVDHT
2g39A           INTALEFDIYGNVNSTHV--GGTKNGIGGSGDFARNAHL-----AIFVTKSIA-KGGNISSVVVSHVDHT
2nvvA           INTALEADIFGNINSTHVSGTR--NGIGGSGDFTRNSYV-----SIFTTPSVKD--GKISSFVVAHHDHS


                         .         .         .         *         .         .         .:630
query           TIPCHLRDMVVTEYGIANLRGKNDREIIIALLNITDSRFQDFLLREAQKxxxxxxxxxxxxxxxxxxxxx
2oasA           TTRAHVH-YIVTEYGAANLKGRSLRERAQALINIAHPDFREQLSRDA-----------------------
3eh7A           TTLRNEVDYVVTEYGIAQLKGKSLRQRAEALIAIAHPDFREELTKHLRK---------------------
3d3uA           EV-----DYVVTEYGVARLRGATLRQRAEALTAIAHPDFRPALEEEIRR---------------------
2g39B           E---HDVDILVTEQGLADLRGLAPRE--------------------------------------------
2g39A           E---HDVDILVTEQGLADLRGLAPRE--------------------------------------------
2nvvA           E---HSVKVIISEWGVADLRGKNPRE--------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2oasA           ----------------------------------------------------------------------
3eh7A           ----------------------------------------------------------------------
3d3uA           ----------------------------------------------------------------------
2g39B           ----------------------------------------------------------------------
2g39A           ----------------------------------------------------------------------
2nvvA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
2oasA           ----------------------------
3eh7A           ----------------------------
3d3uA           ----------------------------
2g39B           ----------------------------
2g39A           ----------------------------
2nvvA           ----------------------------