[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA58418.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1amuA.bssp"
#ERROR : Can't open dsspfile "1amuB.bssp"
#ERROR : Can't open dsspfile "2vsqA.bssp"
#ERROR : Can't open dsspfile "3fceA.bssp"
#ERROR : Can't open dsspfile "3e7wA.bssp"
#ERROR : Can't open dsspfile "3dhvA.bssp"
#ERROR : Can't open dsspfile "2d1tA.bssp"
#ERROR : Can't open dsspfile "2d1sA.bssp"
#ERROR : Can't open dsspfile "2d1rA.bssp"
#ERROR : Can't open dsspfile "3etcB.bssp"
#ERROR : Can't open dsspfile "3etcA.bssp"
#ERROR : Can't open dsspfile "3cw9A.bssp"
#ERROR : Can't open dsspfile "3dlpX.bssp"
#ERROR : Can't open dsspfile "2vzeA.bssp"
#ERROR : Can't open dsspfile "3c5eA.bssp"
#ERROR : Can't open dsspfile "3b7wA.bssp"
#ERROR : Can't open dsspfile "1ba3A.bssp"
#ERROR : Can't open dsspfile "3cw8X.bssp"
#ERROR : Can't open dsspfile "1t5dX.bssp"
#ERROR : Can't open dsspfile "3dayA.bssp"
#ERROR : Can't open dsspfile "2d1qA.bssp"
#ERROR : Can't open dsspfile "2qvxX.bssp"
#ERROR : Can't open dsspfile "3eynA.bssp"
#ERROR : Can't open dsspfile "1ultA.bssp"
#ERROR : Can't open dsspfile "3eynB.bssp"
#ERROR : Can't open dsspfile "2v7bA.bssp"
#ERROR : Can't open dsspfile "2qvyX.bssp"
#ERROR : Can't open dsspfile "1pg4B.bssp"
#ERROR : Can't open dsspfile "1pg4A.bssp"
#ERROR : Can't open dsspfile "1pg3A.bssp"
#ERROR : Can't open dsspfile "2qvzX.bssp"
#ERROR : Can't open dsspfile "2p2qB.bssp"
#ERROR : Can't open dsspfile "2p2qA.bssp"
#ERROR : Can't open dsspfile "2p20B.bssp"
#ERROR : Can't open dsspfile "2p20A.bssp"
#ERROR : Can't open dsspfile "2p2mB.bssp"
#ERROR : Can't open dsspfile "2p2mA.bssp"
#ERROR : Can't open dsspfile "2p2fB.bssp"
#ERROR : Can't open dsspfile "2p2fA.bssp"
#ERROR : Can't open dsspfile "2p2bB.bssp"
#ERROR : Can't open dsspfile "2p2bA.bssp"
#ERROR : Can't open dsspfile "2p2jB.bssp"
#ERROR : Can't open dsspfile "2p2jA.bssp"
#ERROR : Can't open dsspfile "1nnnB.bssp"
#ERROR : Can't open dsspfile "1nnnA.bssp"
#ERROR : Can't open dsspfile "3iplB.bssp"
#ERROR : Can't open dsspfile "3ivrB.bssp"
#ERROR : Can't open dsspfile "3ivrA.bssp"
#ERROR : Can't open dsspfile "3iplA.bssp"
#ERROR : Can't open dsspfile "1lciA.bssp"
#ERROR : Can't open dsspfile "1t5hX.bssp"
#ERROR : Can't open dsspfile "3iplC.bssp"
#ERROR : Can't open dsspfile "1mdbA.bssp"
#ERROR : Can't open dsspfile "1v26B.bssp"
#ERROR : Can't open dsspfile "1ultB.bssp"
#ERROR : Can't open dsspfile "1v25B.bssp"
#ERROR : Can't open dsspfile "1v26A.bssp"
#ERROR : Can't open dsspfile "1v25A.bssp"
#ERROR : Can't open dsspfile "1md9A.bssp"
#ERROR : Can't open dsspfile "1ry2A.bssp"
#ERROR : Can't open dsspfile "3g7sB.bssp"
#ERROR : Can't open dsspfile "3gqwB.bssp"
#ERROR : Can't open dsspfile "3gqwA.bssp"
#ERROR : Can't open dsspfile "3g7sA.bssp"

## Summary of PDB Search
:538
    2e-31  29%  1amuA  [e.23.1] GRAMICIDIN SYNTHETASE 1
    8e-31  29%  1amuB  [e.23.1] GRAMICIDIN SYNTHETASE 1
    3e-30  26%  2vsqA  [x.x.x] SURFACTIN SYNTHETASE SUBUNIT 3
    8e-29  24%  3fceA  [x.x.x] D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 1
    2e-28  28%  3e7wA  [x.x.x] D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 1
    5e-28  24%  3dhvA  [x.x.x] D-ALANINE-POLY(PHOSPHORIBITOL) LIGASE
    5e-26  31%  2d1tA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    5e-26  31%  2d1sA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    5e-26  31%  2d1rA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    8e-26  30%  3etcB  [x.x.x] AMP-BINDING PROTEIN
    5e-25  30%  3etcA  [x.x.x] AMP-BINDING PROTEIN
    9e-25  27%  3cw9A  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    6e-24  26%  3dlpX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE
    1e-23  26%  2vzeA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL
    1e-23  26%  3c5eA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL
    1e-23  26%  3b7wA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL
    2e-23  29%  1ba3A  [x.x.x] LUCIFERASE
    2e-23  27%  3cw8X  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    2e-22  27%  1t5dX  [e.23.1] 4-CHLOROBENZOYL COA LIGASE
    2e-22  26%  3dayA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL
    2e-22  28%  2d1qA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    7e-22  27%  2qvxX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE
    7e-22  26%  3eynA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A
    5e-21  26%  1ultA  [e.23.1] LONG CHAIN FATTY ACID-COA LIGASE
    5e-21  25%  3eynB  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A
    1e-20  29%  2v7bA  [x.x.x] BENZOATE-COENZYME A LIGASE
    4e-20  29%  2qvyX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE
    9e-20  26%  1pg4B  [e.23.1] ACETYL-COA SYNTHETASE
    9e-20  26%  1pg4A  [e.23.1] ACETYL-COA SYNTHETASE
    9e-20  26%  1pg3A  [e.23.1] ACETYL-COA SYNTHETASE
    1e-19  28%  2qvzX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE
    1e-19  26%  2p2qB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p2qA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p20B  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p20A  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p2mB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p2mA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p2fB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p2fA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p2bB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    1e-19  26%  2p2bA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    7e-19  25%  2p2jB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    7e-19  25%  2p2jA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    8e-18  26%  1nnnB  [x.x.x] ACETYL-COA SYNTHETASE
    8e-18  26%  1nnnA  [x.x.x] ACETYL-COA SYNTHETASE
    1e-17  30%  3iplB  [x.x.x] 2-SUCCINYLBENZOATE--COA LIGASE
    2e-17  27%  3ivrB  [x.x.x] PUTATIVE LONG-CHAIN-FATTY-ACID COA LIGASE
    2e-17  27%  3ivrA  [x.x.x] PUTATIVE LONG-CHAIN-FATTY-ACID COA LIGASE
    3e-17  30%  3iplA  [x.x.x] 2-SUCCINYLBENZOATE--COA LIGASE
    7e-17  33%  1lciA  [x.x.x] LUCIFERASE
    2e-15  27%  1t5hX  [e.23.1] 4-CHLOROBENZOYL COA LIGASE
    1e-14  32%  3iplC  [x.x.x] 2-SUCCINYLBENZOATE--COA LIGASE
    2e-14  25%  1mdbA  [e.23.1] 2,3-DIHYDROXYBENZOATE-AMP LIGASE
    5e-14  27%  1v26B  [e.23.1] LONG-CHAIN-FATTY-ACID-COA SYNTHETASE
    1e-13  27%  1ultB  [e.23.1] LONG CHAIN FATTY ACID-COA LIGASE
    2e-13  26%  1v25B  [e.23.1] LONG-CHAIN-FATTY-ACID-COA SYNTHETASE
    6e-13  26%  1v26A  [e.23.1] LONG-CHAIN-FATTY-ACID-COA SYNTHETASE
    6e-13  26%  1v25A  [e.23.1] LONG-CHAIN-FATTY-ACID-COA SYNTHETASE
    6e-13  26%  1md9A  [e.23.1] 2,3-DIHYDROXYBENZOATE-AMP LIGASE
    7e-09  30%  1ry2A  [e.23.1] ACETYL-COENZYME A SYNTHETASE 1
    1e-06  42%  3g7sB  [x.x.x] LONG-CHAIN-FATTY-ACID--COA LIGASE (FADD-1)
    2e-06  30%  3gqwB  [x.x.x] FATTY ACID AMP LIGASE
    2e-06  30%  3gqwA  [x.x.x] FATTY ACID AMP LIGASE
    2e-06  31%  3g7sA  [x.x.x] LONG-CHAIN-FATTY-ACID--COA LIGASE (FADD-1)
:538

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxVHSLVLDNALKGPDASALVHGDQTLTYASLGETVXXXXXXXXXXXXXXXXXVAIYLPKRP
1amuA           ----------IHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSI
1amuB           ----------IHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSI
2vsqA           ----------------------PDAPALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVVALYTKRSL
3fceA           ------------------AAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
3e7wA           ----------------------PQTDAFRSQGQSLTYQELWESDRAAAAIQKRISGEKKSPILVYGHMEP
3dhvA           ------------------AAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
2d1tA           ----------------------------------------------------------------------
2d1sA           ----------------------------------------------------------------------
2d1rA           ----------------------------------------------------------------------
3etcB           ----------------------------------------------------------------------
3etcA           ----------------------------------------------------------------------
3cw9A           -------------------------------------------------------------VAVVAPNSA
3dlpX           -------------------------------------------------------------VAVVAPNSA
2vzeA           -------------------------------------------------------------VAVVLPRVP
3c5eA           -------------------------------------------------------------VAVVLPRVP
3b7wA           -------------------------------------------------------------VAVVLPRVP
1ba3A           ----------------------------------------------------------------------
3cw8X           -------------------------------------------------------------VAVVAPNSA
1t5dX           -------------------------------------------------------------VAVVAPNSA
3dayA           -------------------------------------------------------------VAVVLPRVP
2d1qA           ----------------------------------------------------------------------
2qvxX           -------------------------------------------------------------VAVVAPNSA
3eynA           -------------------------------------------------------------VAVVLPRVP
1ultA           ----------------------------------------------------------------------
3eynB           -------------------------------------------------------------VAVVLPRVP
2v7bA           ----------------------------------------------------------------------
2qvyX           ----------------------------------------------------------------------
1pg4B           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
1pg4A           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
1pg3A           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2qvzX           ----------------------------------------------------------------------
2p2qB           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2qA           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p20B           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p20A           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2mB           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2mA           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2fB           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2fA           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2bB           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2bA           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2jB           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
2p2jA           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
1nnnB           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
1nnnA           -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
3iplB           ----------------------------------------------------------------------
3ivrB           ----------------------------------------------------------------------
3ivrA           ----------------------------------------------------------------------
3iplA           ----------------------------------------------------------------------
1lciA           ----------------------------------------------------------------------
1t5hX           ----------------------------------------------------------------------
3iplC           ----------------------------------------------------------------------
1mdbA           ----------------------------------------------------------------------
1v26B           ----------------------------------------------------------------------
1ultB           ----------------------------------------------------------------------
1v25B           ----------------------------------------------------------------------
1v26A           ----------------------------------------------------------------------
1v25A           ----------------------------------------------------------------------
1md9A           ----------------------------------------------------------------------
1ry2A           -----------------HALKTPNKKAIIEGDESITYKELLEEVCQVAQVLTYSMGVRKGDVAVYMPMVP
3g7sB           ----------------------------------------------------------------------
3gqwB           ----------------------------------------------------------------------
3gqwA           ----------------------------------------------------------------------
3g7sA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ETVVTLFXXXXXXXVFVPINPLLKPRQVAHILRDCNVRVLVTASNRIDFLQDALAECHDLRSLVIVDAPT
1amuA           DLFIGILAVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLI-------HNIQFNGQVEIFE
1amuB           DLFIGILAVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLIHNQFNG-----QVEIFEEDT
2vsqA           ELVIGILGVLKAGAAYLPVDPKLPEDRISYMLADSAAACLLTHQE----MKEQAAELPYTGTTLFIDDQT
3fceA           EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAT-----------------AVTVTDLPV
3e7wA           HMIVSFLGSVKAGHPYIPVDLSIPSERIAKIIESSGAELLIHAAG------------------LSIDAVG
3dhvA           EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAT-----------------AVTVTDLPV
2d1tA           ----------------------------------------------------------------------
2d1sA           ----------------------------------------------------------------------
2d1rA           ----------------------------------------------------------------------
3etcB           --------------IAVPATHMLKTRDIVYRIEKAGLKMIVCIAEDDEQVDEAHAECGDIKAKVGGDVLE
3etcA           --------------IAVPATHMLKTRDIVYRIEKAGLKMIVCIAEDDEQVDEAHAECGDIKAKVGGDVLE
3cw9A           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQ--VADAIFQSGSGARIIFLGDLV
3dlpX           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQ--VADAIFQSGSGARIIFLGDLV
2vzeA           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVS---
3c5eA           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVS---
3b7wA           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVS---
1ba3A           ----------------------------------------------------------------------
3cw8X           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQ--VADAIFQSGSGARIIFLGDLV
1t5dX           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQ--VADAIFQSGSGARIIFLGDLV
3dayA           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVS---
2d1qA           ----------------------------------------------------------------------
2qvxX           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQ--VADAIFQSGSGARIIFLGDLV
3eynA           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVS---
1ultA           -------------------NPRLSPKEIAYILNHAEDKVLLFDPNLLPLVEAIRGELKTVQHFVVMD---
3eynB           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVS---
2v7bA           ----------------VVANTLLTPADYVYMLTHSHARAVIASGALVQNVTQALES-----------AGC
2qvyX           ----------------------------------------------------------------------
1pg4B           EAAVAMLACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
1pg4A           EAAVAMLACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
1pg3A           EAAVAMLACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2qvzX           ----------------------------------------------------------------------
2p2qB           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2qA           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p20B           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p20A           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2mB           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2mA           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2fB           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2fA           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2bB           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2bA           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2jB           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
2p2jA           EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
1nnnB           EAAVAMLACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
1nnnA           EAAVAMLACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
3iplB           ----------------------------------------------------------------------
3ivrB           --------------ILLPVNYRLNADEIAFVLGDGAPSVVVAGTDYRDIVAGVLPSLGGVKKAYAISGPF
3ivrA           --------------ILLPVNYRLNADEIAFVLGDGAPSVVVAGTDYRDIVAGVLPSLGGVKKAYAISGPF
3iplA           ----------------------------------------------------------------------
1lciA           ----------------------------------------------------------------------
1t5hX           ----------------------------------------------------------------------
3iplC           ----------------------------------------------------------------------
1mdbA           ----------------------------------------------------------------------
1v26B           -------------------NPRLSPKEIAYILNHAEDKVLLFDPNLLPLVEAIRGELKTVQHFVVMD---
1ultB           -------------------NPRLSPKEIAYILNHAEDKVLLFDPNLLPLVEAIRGELKTVQHFVVMD---
1v25B           -------------------NPRLSPKEIAYILNHAEDKVLLFDPNLLPLVEAIRGELKTVQHFVVMD---
1v26A           -------------------NPRLSPKEIAYILNHAEDKVLLFDPNLLPLVEAIRGELKTVQHFVVMD---
1v25A           -------------------NPRLSPKEIAYILNHAEDKVLLFDPNLLPLVEAIRGELKTVQHFVVMD---
1md9A           ----------------------------------------------------------------------
1ry2A           EAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVITTSNRGGIVDDALRETPGVRHVLVYRKTN
3g7sB           ----------------------------------------------------------------------
3gqwB           ----------------------------------------------------------------------
3gqwA           ----------------------------------------------------------------------
3g7sA           ---VTIYALWRVAATPVPINPY-KSFELEHILNDSEATTLVVHSLYENFXXXXXXXXXXXNSLSEVDSGS


                         +         .         .         .         .         *         .:210
query           QTIEKLAQPMAISWERLLSLGTTQQSPGHRRIDSDMAAILYTSGSTGRPKGVVLSHRNLVAGAQSVAQYL
1amuA           EDTIKIRE------------GTNLHVPSK---STDLAYVIYTS-----PKGTMLEHK----GISNLKVFF
1amuB           IKIRE---------------GTNLHVPSK---STDLAYVIYTN-----PKGTMLEHK----GISNLKVFF
2vsqA           RFEEQASDP------------ATAIDP------NDPAYIMYTSGTTGKPKGNITTHAN-IQGLVKHVDYM
3fceA           RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSG----PKGVQITYNCLVSFTKWAVEDF
3e7wA           QQIQ------TVSAEELLENEGGSVSQDQWVKEHETFYIIYTSGSTGNPKGVQISAANLQSFTDWICADF
3dhvA           RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTS-----PKGVQITYNCLVSFTKWAVEDF
2d1tA           -----------------------------------VALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPI
2d1sA           -----------------------------------VALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPI
2d1rA           -----------------------------------VALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPI
3etcB           GWIDKELEESSPIFERPTGEVSTK--------NEDICLVYFSSGTAGFPK--MVEHDNTYPGHILTAKYW
3etcA           GWIDKELEESSPIFERPTGEVSTK--------NEDICLVYFSSGTAGFPK--MVEHDNTYPGHILTAKYW
3cw9A           RDGEPY------------SYGPPIEDP--QREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVMSTQVGL
3dlpX           RDGEPY------------SYGPPIEDP--QREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVMSTQVGL
2vzeA           ---EKSCDGW-LNFKKLLNEASTT----HHCVETEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
3c5eA           ---EKSCDGW-LNFKKLLNEASTT----HHCVETEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
3b7wA           ---EKSCDGW-LNFKKLLNEASTT----HHCVETEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
1ba3A           --------------------------------DRDKTIALIMNSSTGLPKGVALPHRTACVRFSHARDPI
3cw8X           RDGEPY------------SYGPPIEDP--QREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVMSTQVGL
1t5dX           RDGEPY------------SYGPPIEDP--QREPAQPAFIFYTS--TGLPKAAIIPQRAAESRVMSTQVGL
3dayA           ---EKSCDGW-LNFKKLLNEASTT----HHCVETEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
2d1qA           ------------------------QASSFKTVEVDRKEQVALIMNSSLPKGVQLTHENIVTRFSHARDPI
2qvxX           RDGEPY------------SYGPPIEDP--QREPAQPAFIFYTS--TGLPKAAIIPQRAAESRVMSTQVGL
3eynA           ---EKSCDGW-LNFKKLLNEASTT----HHCVETEASAIYFTSG--GLPKMAEHSYSSLGLKAKMDAGWT
1ultA           ---EKAPXXXXXXXXXXXXXXDPVRVP-----ERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXT
3eynB           ---EKSCDGW-LNFKKLLNEASTT----HHCVETEASAIYFTSGL---PKMAEHSYSSLGLKAKMDAGWT
2v7bA           QLI--VSQPLAPLFEELIDXXXXXXXXXXTGCD-DIAFWLYS-----KPKGTVHTHANLYWTAELYAKIL
2qvyX           -----------------------------QREPAQPAFIFYTS--TGLPKAAIIPQRAAESRVMSTQVGL
1pg4B           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
1pg4A           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
1pg3A           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2qvzX           -----------------------------QREPAQPAFIFYTSGL---PKAAIIPQRAAESRVMSTQVGL
2p2qB           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2qA           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p20B           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p20A           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2mB           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2mA           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2fB           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2fA           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2bB           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2bA           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2jB           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
2p2jA           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
1nnnB           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
1nnnA           SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
3iplB           --------PLELRGFQIVSLDDIEFSPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
3ivrB           APFKDLASDTPFSAPEFGA--------------ADGFVIIHTAA--GRPRGALISQGNLLIAQSSLVDAW
3ivrA           APFKDLASDTPFSAPEFGA--------------ADGFVIIHTAA--GRPRGALISQGNLLIAQSSLVDAW
3iplA           ----------------------------------DIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
1lciA           ------------------------------------------------PKGVALPHRTACVRFSHARDPI
1t5hX           -----------------------------QREPAQPAFIFYTSGL---PKAAIIPQRAAESRVLFSTQVG
3iplC           ----------------------------------DIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
1mdbA           ---------------------------------SDVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVC
1v26B           ---EKAPXXXXXXXXXXXXXXDPVRVP-----ERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXT
1ultB           ---EKAPXXXXXXXXXXXXXXDPVRVP-----ERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXT
1v25B           ---EKAPXXXXXXXXXXXXXXDPVRVP-----ERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXT
1v26A           ---EKAPXXXXXXXXXXXXXXDPVRVP-----ERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXT
1v25A           ---EKAPXXXXXXXXXXXXXXDPVRVP-----ERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXT
1md9A           ---------------------------------SDVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVC
1ry2A           NPSVAFHAPRDLDWEXXXXXXXXPCTP----VDSDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRY-
3g7sB           ----------------------------------------------------------------------
3gqwB           -----------------------------RPVPNDIAYLQYTSGSTRFPRGVIITHRE-VANLRAISDGI
3gqwA           -----------------------------RPVPNDIAYLQYTSGSTRFPRGVIITHRE-VANLRAISDGI
3g7sA           EDFENV-----------------KVNP-----EEDVALIPYTGGTTG-PKGV-LTHFXXXXXXXXXXXXT


                         .         .         .         +         .         .         .:280
query           ENNSNDRLLAVLPLSFDAGFSQLTTAFSVGASVVLMEYLLPKDVIKSITRHGITGITAVPPLWVQLASLA
1amuA           ENSLNDRIGQFASISFDASVWEMFMALLTGASL----YIILKDTINDINQKEITVITLPPTYVVHL----
1amuB           ENSLNDRIGQFASISFDASVWEMFMALLTGASL----YIILKDTINDINQKEITVITLPPTYVVHL----
2vsqA           AFSDQDTFLSVSNXXXXXXXXXXXXSMLNAARLIIADLLDTERLTDLILQENVNVMFATTALFNLLTDAG
3fceA           NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMPKDLFASLEQSDIQVWTSTPSFAEMLMEAS
3e7wA           PVSGGKIFLNQAPFSFDLSVMDLYPCLQSGGTVTKDAVNKPKVLFEELKKSGLNVWTSTPS-FVQMC-LM
3dhvA           NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMPKDLFASLEQSDIQVWTSTPSFAEMLMEAS
2d1tA           YGNQVSPGTAVLTVPFHHGFGMFTTLLICGFRVVMLTKFDEETFLKTLQDYKCTNVILVPTLFAILKSEL
2d1sA           YGNQVSPGTAVLTVPFHHGFGMFTTLLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILKSEL
2d1rA           YGNQVSPGTAVLTVPFHHGFGMFTTLLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILKSEL
3etcB           QNVEDDGLHYTVA---DSGWGKLYGQWIAGCAVFVYDYFEAKNMLEKASKYGVTTFCAPPTIYRFLIKED
3etcA           QNVEDDGLHYTVA---DSGWGKLYGQWIAGCAVFVYDYFEAKNMLEKASKYGVTTFCAPPTIYRFLIK--
3cw9A           RHGRHNVVLGLMPLHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXX
3dlpX           RHGRHNVVLGLMPLHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXX
2vzeA           GLQASDIMWTISDTGWILNICSLMEPWALGACTFV--HLLPKFILKTLSSYPIKSMMGAPIVYRMLLQQD
3c5eA           GLQASDIMWTISDTGWILNICSLMEPWALGACTFV--HLLPKFILKTLSSYPIKSMMGAPIVYRMLLQQD
3b7wA           GLQASDIMWTISDTGWILNICSLMEPWALGACTFV--HLLPKFILKTLSSYPIKSMMGAPIVYRMLLQQD
1ba3A           FGNQDTAILSVVP--FHHGFGMFTTLLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFASTL
3cw8X           RHGRHNVVLGLMPLHXXXXXXXXXXXXXXDGTYVVIEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXX
1t5dX           RHGRHNVVLGLMPLHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXX
3dayA           GLQASDIMWTISDTGWILNICSLMEPWALGACTFV--HLLPKFILKTLSSYPIKSMMGAPIVYRMLLQQD
2d1qA           YGNQVSPGTAVLTVPFHHGFGMFTTLLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILKSEL
2qvxX           RHGRHNVVLGLMPLHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXX
3eynA           GLQASDIMWTISDTGWILNICSLMEPWALGACTFV--HLLPKFILKTLSSYPIKSMMGAPIVYRMLLQQD
1ultA           ALSEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPGPRLPASLVELFDGEGVTFTAGVPTVWLALADLE
3eynB           GLQASDIMWTISDTGWILNICSLMEPWALGACTFV--HLLPKFILKTLSSYPIKSMMGAPIVYRMLLQQD
2v7bA           GIAENDVVFSAAKLFFAYGLGNLTFPLSVGATAILMAERPTADAIFALVEHRPTVFYGVPTLYANLVSPN
2qvyX           RHGRHNVVLGLMPLHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXX
1pg4B           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
1pg4A           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
1pg3A           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2qvzX           RHGRHNVVLGLMPLHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXX
2p2qB           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2qA           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p20B           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p20A           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2mB           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2mA           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2fB           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2fA           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2bB           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2bA           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2jB           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
2p2jA           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
1nnnB           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
1nnnA           DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
3iplB           GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
3ivrB           RLTEADVNLGMLPLFHVTGLGLMLTLQQAGGASVIAAKFDPAQAARDIEAHKVTVMAEFAPMLGNILDQA
3ivrA           RLTEADVNLGMLPLFHVTGLGLMLTLQQAGGASVIAAKFDPAQAARDIEAHKVTVMAEFAPMLGNILDQA
3iplA           GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
1lciA           FGNQDTAILSVVP--FHHGFGMFTTLLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFASTL
1t5hX           LRHGRHNVVLGLPLHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXX
3iplC           GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
1mdbA           WLDHSTVYLAALPMAHNYPLSSVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLAMVWMXXX
1v26B           ALSEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPPRLDPASLVELFDGEGVTFTAGVPTVWLALADLE
1ultB           ALSEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPPRLDPASLVELFDGEGVTFTAGVPTVWLALADLE
1v25B           ALSEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPPRLDPASLVELFDGEGVTFTAGVPTVWLALADLE
1v26A           ALSEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPPRLDPASLVELFDGEGVTFTAGVPTVWLALADLE
1v25A           ALSEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPPRLDPASLVELFDGEGVTFTAGVPTVWLALADLE
1md9A           WLDHSTVYLAALPANYPLSSPGVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLWXXXXXXX
1ry2A           ----------------------------------------------------------------------
3g7sB           ----------------------------------------------------------------------
3gqwB           KLRPGDRCVSWLPFYHDGLVGFLLTPVATQLSVDYLDFARPLQWLKLISKNRGT-VSVAPPFGYEL----
3gqwA           KLRPGDRCVSWLPFYHDGLVGFLLTPVATQLSVDYLDFARPLQWLKLISKNRGT-VSVAPPFGYEL----
3g7sA           -GLSHDTIVGCPFHSAEFGLVNLVT---VGNEYVVG---FNQELAENIEKYKGTFSWAVPPLNVLVNTLE


                         .         *         .         .         .         .         +:350
query           WPPEAADTLRYIANTGGRMPKAATTALRRSLPQTKVFLMYGLTEAFRSTYLPPEEVDKRPDSIGKAIPNV
1amuA           -DPERILSIQTLITAGSATSPSLVNKWKEKVTYINA---YGPTETTATTWVATKETIGHSVPIGAPIQNT
1amuB           -DPERILSIQTLITAGSATSPSLVNKWKEKVTYINA---YGPTETTATTWVATKETIGHSVPIGAPIQNT
2vsqA           --EDWMKGLRCILFGGERASVPHVRKALRIMGPGKLINCYGPTEG--TVFATAHVVHDLPDSIGKPISNA
3fceA           FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQYKSPVGYCKSDC
3e7wA           DPGFSQDLLPH-ADTGEVLPVSVAKALLERFPKAKIFNTYGPTEATVAVTSVENDVISRSESVGFAKPDM
3dhvA           FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQYKSPVGYCKSDC
2d1tA           LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK-PGASGKVVPLF
2d1sA           LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK-PGASGKVVPLF
2d1rA           LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK-PGASGKVVPLF
3etcB           LSHYNFSTLKYAVVAGEPLNPEV---FNRFLEFTGIKLMFGQTETVVTIATFPW-MEPKPGSIGKPTPGY
3etcA           -EDLNFSTLKYAVVAGEPLNPEV---FNRFLEFTGIKLMFGQTETVVTIATFPW-MEPKPGSIGKPTPGY
3cw9A           XXXGSSDSLRHVTFAGATMPDAVLETVHQHLPGEKVNI-YGTTEAMNSLYM------RQPKTGTEMAPGF
3dlpX           XXXGSSDSLRHVTFAGATMPDAVLETVHQHLPGEKVNI-YGTTEAMNSLYM------RQPKTGTEMAPGF
2vzeA           LSSYKFPHLQNCVTVGESL-LPETLENWRAQTGLDIRESYGQTET-GLTCMVSKTMKIKPGYMGTAASCY
3c5eA           LSSYKFPHLQNCVTVGESL-LPETLENWRAQTGLDIRESYGQTET-GLTCMVSKTMKIKPGYMGTAASCY
3b7wA           LSSYKFPHLQNCVTVGESL-LPETLENWRAQTGLDIRESYGQTET-GLTCMVSKTMKIKPGYMGTAASCY
1ba3A           IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDK-PGAVGKVVPFF
3cw8X           XXXGSSDSLRHVTFAGATMPDAVLETVHQHLPGEKVNI-YGTTEAMNSLYM------RQPKTGTEMAPGF
1t5dX           XXXGSSDSLRHVTFAGATMPDAVLETVHQHLPGEKVNI-YGTTEAMNSLYM------RQPKTGTEMAPGF
3dayA           LSSYKFPHLQNCVTVGESL-LPETLENWRAQTGLDIRESYGQTET-GLTCMVSKTMKIKPGYMGTAASCY
2d1qA           LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK-PGASGKVVPLF
2qvxX           XXXGSSDSLRHVTFAGATMPDAVLETVHQHLPGEKVN-GYGTTEAMNSLYM------RQPKTGTEMAPGF
3eynA           LSSYKFPHLQNCVTVGESL-LPETLENWRAQTGLDIRESYGQTET-GLTCMVSKTMKIKPGYMGTAASCY
1ultA           STGHRLKTLRRLVVGGSAAPRSLIARFERM--GVEVRQGYGLTETXXXXXXXXXXXXXXXXXTGLPIPLV
3eynB           LSSYKFPHLQNCVTVGESL-LPETLENWRAQTGLDIRESYGQTET-GLTCMVSKTMKIKPGYMGTAASCY
2v7bA           LPARADVAIRICTSAGEALPREIGERFTAHFG-CEILDGIGSTEMLH-IFLSNRAGAVEYGTTGRPVPGY
2qvyX           XXXGSSDSLRHVTFAGATMPDAVLETVHQHLPGEKVN-GYGTTEAMNSLYM------RQPKTGTEMAPGF
1pg4B           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
1pg4A           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
1pg3A           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2qvzX           XXXGSSDSLRHVTFAGATMPDAVLETVHQHLPGEKVNA-YGTTEAMNSLYM------RQPKTGTEMAPGF
2p2qB           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2qA           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p20B           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p20A           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2mB           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2mA           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2fB           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2fA           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2bB           IEGTDRSSLRILGSAGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2bA           IEGTDRSSLRILGSAGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2jB           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
2p2jA           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
1nnnB           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
1nnnA           IEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKVVDTWWQTETGGFMITPPGAIELKAGSATR--PFF
3iplB           EPYNLQKILLGGAKLSATM---IETALQYNLP---IYNSFGMTETC-SQFLTPEMLHARPDTVGMPSANV
3ivrB           APAQLA-SLR--AVTGLDTPE-TIERFEATCPNATFWATFGQSESGLSTFAPYRD---RPKSAGRPLFWR
3ivrA           APAQLA-SLR--AVTGLDTPE-TIERFEATCPNATFWATFGQSESGLSTFAPYRD---RPKSAGRPLFWR
3iplA           EPYNLQKILLGGAKLSATM---IETALQYNLP---IYNSFGMTETC-SQFLTPEMLHARPDTVGMPSANV
1lciA           IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEG----PGAVGKVVPFF
1t5hX           XXXGSSDSLRHVTFAGAT-PDAVLETVHQHLPGEKVNI-YGTTEA-NSLYRQPKTGTEAPGFFS------
3iplC           EPYNLQKILLGGAKLSATM---IETALQYNLP---IYNSFGMTETC-SQFLTPEMLHARPDTVGMPSANV
1mdbA           XXXXXXXXXXQVLQVGGAKFSAEAARRVKAVFGCTLQQVFGMAEGLVNTRLDPEEIIVNTQ--GKPMPYD
1v26B           STGHRLKTLRRLVVGGSAAPRSLIARFERM--GVEVRQGYGLTETXXXXXXXXXXXXXXXXXTGLPIPLV
1ultB           STGHRLKTLRRLVVGGSAAPRSLIARFERM--GVEVRQGYGLTETXXXXXXXXXXXXXXXXXTGLPIPLV
1v25B           STGHRLKTLRRLVVGGSAAPRSLIARFERM--GVEVRQGYGLTETXXXXXXXXXXXXXXXXXTGLPIPLV
1v26A           STGHRLKTLRRLVVGGSAAPRSLIARFERM--GVEVRQGYGLTETXXXXXXXXXXXXXXXXXTGLPIPLV
1v25A           STGHRLKTLRRLVVGGSAAPRSLIARFERM--GVEVRQGYGLTETXXXXXXXXXXXXXXXXXTGLPIPLV
1md9A           XXXXXXQVLQ----VGGAKFSAEAARRVKAVFGCTLQQVFGAEGLVNYTRLDPEEIIVNTQ--GKPSPYD
1ry2A           ----------------------------------------------------------------------
3g7sB           ------------------------------------------TEACPVTTNPPLRLDK---STTQGVPSI
3gqwB           ----------------------------------------------------------------------
3gqwA           ----------------------------------------------------------------------
3g7sA           SSNKTYDWSYLKVFATGAWPXXXXXXXXXXXPRLRHNQIWG-TEACPVTTNPPLRLDK---STTQGVPSI


                         .         .         .         .         *         .         .:420
query           EIQVAREDGSLCLPGESGELVHRGVLVAMGYWNDPKKTAERFRPTPGQPPELPLTEIAVWSGDTVRMDED
1amuA           QIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVDNPFVPGEK-----LYKTGDQARWLSD
1amuB           QIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVDNPFVPGEK-----LYKTGDQARWLSD
2vsqA           SVYILNEQSQLQPFGAVGELCISGMGVSKGYVNRADLTKEKFIENPFKPGETLYR-----TGDLARWLPD
3fceA           RLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDG--------ERAYKTGDAGYV-EN
3e7wA           NIFIMDEEGQPLPEGEKGEIVIAGPSVSRGYLGEPELTEKAFFSHEGQ--------WAYRTGD-AGFIQD
3dhvA           RLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDG--------ERAYKTGDAGYV-EN
2d1tA           KAKVIDLDTKKSLPNRRGEVCVKGPMLMKGYVNNPEATKE-------------LIDEEGWTGDIGYYDEE
2d1sA           KAKVIDLDTKKSLPNRRGEVCVKGPMLMKGYVNNPEATKE-------------LIDEEGWTGDIGYYDEE
2d1rA           KAKVIDLDTKKSLPNRRGEVCVKGPMLMKGYVNNPEATKE-------------LIDEEGWTGDIGYYDEE
3etcB           KIELMDRDGRLCEVGEEGEIVGKPVGLFVHYGKDPERTEETWH------------DGYYHTGDMAWMDED
3etcA           KIELMDRDGRLCEVGEEGEIVGKPVGLFVHYGKDPERTEETWH------------DGYYHTGDMAWMDED
3cw9A           EVRIVRIGGGIVANGEEGELIVAASDSAVGYLNQPQATAEKL-----QDGWYRTSDVAVWTPETVRI---
3dlpX           EVRIVRIGGEIVANGEEGELIVAASDSAVGYLNQPQATAEKL-----QDGWYRTSDVAVWT-------PE
2vzeA           DVQIIDDKGNVLPPGTEGDIPIRPIGIFSGYVDNPDKTAANIRGD-------------FWLGDRGIKDED
3c5eA           DVQIIDDKGNVLPPGTEGDIPIRPIGIFSGYVDNPDKTAANIRGD-------------FWLGDRGIKDED
3b7wA           DVQIIDDKGNVLPPGTEGDIPIRPIGIFSGYVDNPDKTAANIRGD-------------FWLGDRGIKDED
1ba3A           EAKVVDLDGKTLGVNQRGELCVRGPMIMSGYVNNPEATNA-------------LIDKDGWSGDIAYWDED
3cw8X           EVRIVRIGGGIVANGEEGELIVAASDSAVGYLNQPEATAEKL-----QDGWYRTSDVAVWTPETVRI---
1t5dX           EVRIVRIGGGIVANGEEGELIVAASDSAVGYLNQPQATAEKL-----QDGWYRTSDVAVWTPETVRI---
3dayA           DVQIIDDKGNVLPPGTEGDIPIRPIGIFSGYVDNPDKTAANIRGD-------------FWLGDRGIKDED
2d1qA           KAKVIDLDTKKSLPNRRGEVCVKGPMLMKGYVNNPEATKE-------------LIDEEGWTGDIGYYDEE
2qvxX           EVRIVRIGGGIVANGEEGELIVAASDSAVGYLNQPQATAEKL-----QDGWYRTSDVAVWTPETVRI---
3eynA           DVQIIDDKGNVLPPGTEGDIPIRPIGIFSGYVDNPDKTAANIRGD-------------FWLGDRGIKDED
1ultA           RLRVADEEGRP-VPKDGGEVQLKGPWITGGYYGNEEATRSALTPDGF----FRTGDIAVW-------DEE
3eynB           DVQIIDDKGNVLPPGTEGDIPIRPIGIFSGYVDNPDKTAANIRGD-------------FWLGDRGIKDED
2v7bA           EIELRDEAGHAVPDGEVGDLYIKGPSAAVMYWNNREKSRATF--------------LGEWSGDKYCRLPN
2qvyX           EVRIVRIGGGIVANGEEGELIVAASDSAVGYLNQPQATAEKL-----QDGWYRTSDVAVWTPETVRI---
1pg4B           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
1pg4A           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
1pg3A           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2qvzX           EVRIVRIGGGIVANGEEGELIVAASDSAVGYLNQPQATAEKL-----QDGWYRTSDVAVWTPETVRI---
2p2qB           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2qA           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p20B           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p20A           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2mB           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2mA           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2fB           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2fA           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2bB           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2bA           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2jB           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
2p2jA           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
1nnnB           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
1nnnA           GVQPALVDNE----GHPQEGATEGNLVITDSWPGQARTLERFEQT-----YFSTFKNMYFSGDGARRDED
3iplB           DVKIKNPNKE-----GHGELMIKGANVMNGYL---------------YPTDLTGTFENGYTGDIAEIDHE
3ivrB           TVAVVDAEDRPLPPGEVGEIVLRGPTVFKGYWNNAAATQHAFRNG--------------WTGDMGRFDAD
3ivrA           TVAVVDAEDRPLPPGEVGEIVLRGPTVFKGYWNNAAATQHAFRNG--------------WTGDMGRFDAD
3iplA           DVKIKNPNKE-----GHGELMIKGANVMNGYL---------------YPTDLTGTFENGYTGDIAEIDHE
1lciA           EAKVVDLDGKTLGVNQRGELCVRGPMIMSGYVNNPEATNA-------------LIDKDGWSGDIAYWDED
1t5hX           EVRIVRIGGGIVANGEEGELIVAASDSAVGYLNQPQATAEKL-----QDGWYRTSDVAVWT-------PE
3iplC           DVKIKNPNKE-----GHGELMIKGANVMNGY---------------------------------------
1mdbA           ESRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNAASF------------TEDGFYTGDIVRLTRD
1v26B           RLRVADEEGR-PVPKDGGEVQLKGPWITGGYYGNEEATRSALTP----DGFFRTGDIAVW-------DEE
1ultB           RLRVADEEGR-PVPKDGGEVQLKGPWITGGYYGNEEATRSALTP----DGFFRTGDIAVW-------DEE
1v25B           RLRVADEEGR-PVPKDGGEVQLKGPWITGGYYGNEEATRSALTP----DGFFRTGDIAVW-------DEE
1v26A           RLRVADEEGR-PVPKDGGEVQLKGPWITGGYYGNEEATRSALTP----DGFFRTGDIAVW-------DEE
1v25A           RLRVADEEGR-PVPKDGGEVQLKGPWITGGYYGNEEATRSALTP----DGFFRTGDIAVW-------DEE
1md9A           ESRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNAASF------------TEDGFYTGDIVRLTRD
1ry2A           -----------------------------------------------------------FTGDGAAKDKD
3g7sB           ELKVSLEDGRELGVGESGEIVIRGPNIFKGYWKREKENQEWWYDEKGRK--------FFRTGDVGFIDEE
3gqwB           ----------------------------------------------------------------------
3gqwA           ----------------------------------------------------------------------
3g7sA           ELKVSLEDGRELGVGESGEIVIRGPNIFKGYWKREKENQEWWYDEKGRK--------FFRTGDVGFIDEE


                         .         .         +         .         .         .         .:490
query           GFFYFIGRQDEMIKTSGYRVSPTEVEEVLYQXXXXXXXXXXXXXHPKLGQGIVAIVKPNKDNFDPEDLLA
1amuA           GNIEYLGRIDNQVKIRGHRVELEEVESILLK-------------HMYISETAVSVHKDHQEHIPLEQLRQ
1amuB           GNIEYLGRIDNQVKIRGHRVELEEVESILLK-------------HMYISETAVSVHKDHQEHIPLEQLRQ
2vsqA           GTIEYAGRIDDQVKIRGHRXXXXXXXXXXXXYPGVKDAVVVADRHES-GDASINAYLVNRTQLSAEDVKA
3fceA           GLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLT
3e7wA           GQIFCQGRLDFQIKLHGYRMELEEIEFHVRQSQYVRSAVVIPYQPNGTVEYLIAAIVPEEHEFEKEFQLT
3dhvA           GLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLT
2d1tA           KHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGEGAVVVLESGK-NMTEKEVMD
2d1sA           KHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGEGAVVVLESGK-NMTEKEVMD
2d1rA           KHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGEGAVVVLESGK-NMTEKEVMD
3etcB           GYLWFVGRADDIIKTSGYKVGPFEVESALIQHPAVLECAITGVPDPVRGQVIKATIVLTKD-YTPSDSL-
3etcA           GYLWFVGRADDIIKTSGYKVGPFEVESALIQHPAVLECAITGVPDPVRGQVIKATIVLTKD-YTPSDSL-
3cw9A           -----LGRVDDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALD
3dlpX           GTVRILGRVPDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALD
2vzeA           GYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQSHDPEQLTK
3c5eA           GYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQSHDPEQLTK
3b7wA           GYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQSHDPEQLTK
1ba3A           EHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGEAAVVVLEHGKTMTEKEIVDY
3cw8X           -----LGRVDDMIISGGENIHPSEIERVL-GTAPGVTEVVVIGLADQWGQSVTACVVPRLGETLSADALD
1t5dX           -----LGRVDDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALD
3dayA           GYFQFMGRADDIINSSGYRIGPSEVENALME--HPAVVETAVISSPDRGEVVKAFVVLASQSHDPEQLTK
2d1qA           KHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGEGAVVVLESGK-NMTEKEVMD
2qvxX           -----LGRVDDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALD
3eynA           GYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQSHDPEQLTK
1ultA           GYVEIKDRLKDLIKSGGEWISSVDLENALMGHPKVKEAAVVAIPHPKWQERPLAVVVPRGEKPTPEELNE
3eynB           GYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQSHDPEQLTK
2v7bA           GCYVYAGRSDDMLK----YVSPVEVEMVLVQHDAVLEAAVVGVDHGGLVKTRAFVVL--KREFAPEELKA
2qvyX           -----LGRVDDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALD
1pg4B           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
1pg4A           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
1pg3A           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2qvzX           -----LGRVDDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALD
2p2qB           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2qA           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p20B           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p20A           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2mB           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2mA           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2fB           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2fA           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2bB           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2bA           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2jB           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
2p2jA           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
1nnnB           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
1nnnA           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYA
3iplB           GYVMIYDRRKDLIISGGENIYPYQIETVAKQ---------------------------------------
3ivrB           GYLFYAGR--------------------------------------------------------------
3ivrA           GYLFYAGR--------------------------------------------------------------
3iplA           GYVMIYDRRKDLIISGGENIYPYQIETVAKQ---------------------------------------
1lciA           EHFFIV-----LIKYKGYQVAPAELESILLQ---------------------------------------
1t5hX           GTVRILGRVDDII-SGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALD
3iplC           ----------------------------------------------------------------------
1mdbA           GYIVVEGRAKDQINRGGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRDEAPKAAELKA
1v26B           GYVEIKDRLKDLIKSGGEWISSVDLENA---------AAVVAIPHPKWQERPLA-VTPEELN---EHLL-
1ultB           GYVEIKDRLKDLIKSGGEWISSVDLENAL-------------MGHPKVKEAAVVAI-PHR----------
1v25B           GYVEIKDRLKDLIKSGGEWISSVDLENAL-----------------------------------------
1v26A           GYVEIKDRLKDLIKSGGEWISSVDLE--------------------------------------------
1v25A           GYVEIKDRLKDLIKSGGEWISSVDLE--------------------------------------------
1md9A           GYIVVEGRAKDQINRGGEKVAAEEVENHLLAHPAVHDAAVSPDQF--LGERSCVFIIPRDEAPKAAELKA
1ry2A           GYIWILGRVDDVVNVSGHRLSTXXXXXXXXXXXXXXXCAVVGFNDDLTGQAVAAFVVLKLQDI-KKHLVF
3g7sB           GFLHF---QD--------RVKPFELEALL-----------------------------------------
3gqwB           ----------------------------------------------------------------------
3gqwA           ----------------------------------------------------------------------
3g7sA           GFLHFQDR--------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TCRAELPNFMVPLAVIVSENLPRNTNGKIDRRALAMEFELLFKxxxxx
1amuA           FSSEELPTYMIPSYFIQLDKMPLTSNGKIDRKQL--------------
1amuB           FSSEELPTYMIPSYFIQLDKMPLTSNGKIDRKQL--------------
2vsqA           HLKKQLPAYMVPQTFTFLDELPLTTNGKVNKRLL--------------
3fceA           SANERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSE-----------
3e7wA           SAAASLPAYMIPRKFIYQDHIQMTANGKIDRKRIGEE-----------
3dhvA           SANERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSE-----------
2d1tA           YVASQVSNARLRGGVRFVDEVPKGLTGKIDGRAI--------------
2d1sA           YVASQVSNARLRGGVRFVDEVPKGLTGKIDGRAI--------------
2d1rA           YVASQVSNARLRGGVRFVDEVPKGLTGKIDGRAI--------------
3etcB           ------------------------------------------------
3etcA           ------------------------------------------------
3cw9A           TCRSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ-----------
3dlpX           TCRSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ-----------
2vzeA           ELQQHVKSYKYPRKIEFVLNLPKTVTGKIQRAKL--------------
3c5eA           ELQQHVKSYKYPRKIEFVLNLPKTVTGKIQRAKL--------------
3b7wA           ELQQHVKSYKYPRKIEFVLNLPKTVTGKIQRAKL--------------
1ba3A           VASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKIR---EILIK-----
3cw8X           TCRSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ-----------
1t5dX           TCRSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ-----------
3dayA           ELQQHVKSYKYPRKIEFVLNLPKTVTGKIQRAKL--------------
2d1qA           YVASQVSNARLRGGVRFVDEVPKGLTGKIDGRAI--------------
2qvxX           TCRSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ-----------
3eynA           ELQQHVKSYKYPRKIEFVLNLPKTVTGKIQRAKL--------------
1ultA           LLKAGFAKWQLPDAYVFAEEIPRTSAGKFLKRALREQYK---------
3eynB           ELQQHVKSYKYPRKIEFVLNLPKTVTGKIQRAKL--------------
2v7bA           FVKDRLAPHKYPRDIVFVDDLPKTATGKIQR-----------------
2qvyX           TCRSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ-----------
1pg4B           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
1pg4A           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
1pg3A           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
2qvzX           TCRSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ-----------
2p2qB           EVRNWVEKEIGPLALHWTDSLPKTRSGKIMRRIL--------------
2p2qA           EVRNWVEKEIGPLALHWTDSLPKTRSGKIMRRIL--------------
2p20B           EVRNWVAKEIGPLALHWTDSLPKTRSGKIMRRIL--------------
2p20A           EVRNWVAKEIGPLALHWTDSLPKTRSGKIMRRIL--------------
2p2mB           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
2p2mA           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
2p2fB           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
2p2fA           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
2p2bB           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
2p2bA           EVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRIL--------------
2p2jB           EVRKEIGPLATPDVLHWTDSLPKTRSGAIMRRIL--------------
2p2jA           EVRKEIGPLATPDVLHWTDSLPKTRSGAIMRRIL--------------
1nnnB           EVRKEIGPLATPDVLHWTDSLPKTRSG-IMRRIL--------------
1nnnA           EVRKEIGPLATPDVLHWTDSLPKTRSG-IMRRIL--------------
3iplB           ------------------------------------------------
3ivrB           ------------------------------------------------
3ivrA           ------------------------------------------------
3iplA           ------------------------------------------------
1lciA           ------------------------------------------------
1t5hX           TCRSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ-----------
3iplC           ------------------------------------------------
1mdbA           FLRERLAAYKIPDRVEFVESFPQTGVGKVSKKAL--------------
1v26B           --KAGFAKWQLPDAYVFAEEIPR-------------------------
1ultB           -----------PLAVVVEKPTPEELN----------------------
1v25B           ------------------------------------------------
1v26A           ------------------------------------------------
1v25A           ------------------------------------------------
1md9A           FLRERLAAYKIPDRVEFVESFPQTGVGKVSKKAL--------------
1ry2A           TVRKDIGPFAAPKLIILVDDLPKTRSGKIMRRIL--------------
3g7sB           ------------------------------------------------
3gqwB           ------------------------------------------------
3gqwA           ------------------------------------------------
3g7sA           ------------------------------------------------