[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA58871.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b6iA.bssp"
#ERROR : Can't open dsspfile "2r97C.bssp"
#ERROR : Can't open dsspfile "3b6mB.bssp"
#ERROR : Can't open dsspfile "3b6mA.bssp"
#ERROR : Can't open dsspfile "2rg1A.bssp"
#ERROR : Can't open dsspfile "2rg1B.bssp"
#ERROR : Can't open dsspfile "1zwlA.bssp"
#ERROR : Can't open dsspfile "1zwkA.bssp"
#ERROR : Can't open dsspfile "2zkiE.bssp"
#ERROR : Can't open dsspfile "2zkiD.bssp"
#ERROR : Can't open dsspfile "2zkiB.bssp"
#ERROR : Can't open dsspfile "2zkiA.bssp"
#ERROR : Can't open dsspfile "2zkiG.bssp"
#ERROR : Can't open dsspfile "2a5lB.bssp"
#ERROR : Can't open dsspfile "1ydgE.bssp"
#ERROR : Can't open dsspfile "1ydgB.bssp"
#ERROR : Can't open dsspfile "1ydgA.bssp"
#ERROR : Can't open dsspfile "2a5lA.bssp"
#ERROR : Can't open dsspfile "1yrhF.bssp"
#ERROR : Can't open dsspfile "1yrhE.bssp"
#ERROR : Can't open dsspfile "1yrhC.bssp"
#ERROR : Can't open dsspfile "1yrhA.bssp"
#ERROR : Can't open dsspfile "3d7nA.bssp"
#ERROR : Can't open dsspfile "2arkF.bssp"
#ERROR : Can't open dsspfile "2arkE.bssp"
#ERROR : Can't open dsspfile "2arkC.bssp"
#ERROR : Can't open dsspfile "2arkB.bssp"
#ERROR : Can't open dsspfile "2arkA.bssp"
#ERROR : Can't open dsspfile "2ohhA.bssp"
#ERROR : Can't open dsspfile "3edoB.bssp"
#ERROR : Can't open dsspfile "3edoA.bssp"

## Summary of PDB Search
:200
    3e-59  58%  3b6iA  [x.x.x] FLAVOPROTEIN WRBA
    7e-57  60%  2r97C  [x.x.x] FLAVOPROTEIN WRBA
    8e-56  60%  3b6mB  [x.x.x] FLAVOPROTEIN WRBA
    8e-56  60%  3b6mA  [x.x.x] FLAVOPROTEIN WRBA
    4e-53  67%  2rg1A  [x.x.x] FLAVOPROTEIN WRBA
    3e-45  61%  2rg1B  [x.x.x] FLAVOPROTEIN WRBA
    6e-29  42%  1zwlA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    8e-27  41%  1zwkA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    4e-25  36%  2zkiE  [x.x.x] 199AA LONG HYPOTHETICAL TRP REPRESSOR BINDING
    4e-25  36%  2zkiD  [x.x.x] 199AA LONG HYPOTHETICAL TRP REPRESSOR BINDING
    4e-25  36%  2zkiB  [x.x.x] 199AA LONG HYPOTHETICAL TRP REPRESSOR BINDING
    4e-25  36%  2zkiA  [x.x.x] 199AA LONG HYPOTHETICAL TRP REPRESSOR BINDING
    3e-24  38%  2zkiG  [x.x.x] 199AA LONG HYPOTHETICAL TRP REPRESSOR BINDING
    5e-24  45%  2a5lB  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    5e-23  38%  1ydgE  [c.23.5] TRP REPRESSOR BINDING PROTEIN WRBA
    5e-23  38%  1ydgB  [c.23.5] TRP REPRESSOR BINDING PROTEIN WRBA
    5e-23  38%  1ydgA  [c.23.5] TRP REPRESSOR BINDING PROTEIN WRBA
    7e-23  45%  2a5lA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    3e-17  38%  1yrhF  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    3e-17  38%  1yrhE  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    3e-17  38%  1yrhC  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    3e-17  38%  1yrhA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    4e-10  44%  3d7nA  [x.x.x] FLAVODOXIN, WRBA-LIKE PROTEIN
    7e-09  40%  2arkF  [x.x.x] FLAVODOXIN
    7e-09  40%  2arkE  [x.x.x] FLAVODOXIN
    7e-09  40%  2arkC  [x.x.x] FLAVODOXIN
    7e-09  40%  2arkB  [x.x.x] FLAVODOXIN
    7e-09  40%  2arkA  [x.x.x] FLAVODOXIN
    3e-04  37%  2ohhA  [x.x.x] TYPE A FLAVOPROTEIN FPRA
    0.001  31%  3edoB  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    0.001  31%  3edoA  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
:200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKLLVLYYSMYGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAPIATVDELPEY
3b6iA           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
2r97C           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
3b6mB           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
3b6mA           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
2rg1A           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPE-----------TGKTQTAPVATPQELADY
2rg1B           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPE--------------TQTAPVATPQELADY
1zwlA           ---ILVLYYSRHGATAEMARQIARGVEQ-GGFEARVRTVPAV-------------STGALYATLEDLKNC
1zwkA           ---ILVLYYSRHGATAEMARQIARGVEQ-GGFEARVRTVPAVSTEG------------ALYATLEDLKNC
2zkiE           ------------------------------------RRVRETLPPEFQSRIPFDKVKDIPEVTLDDMRWA
2zkiD           ------------------------------------RRVRETLPPEFQSRIPFDKVKDIPEVTLDDMRWA
2zkiB           ------------------------------------RRVRETLPPEFQSRIPFDKVKDIPEVTLDDMRWA
2zkiA           ------------------------------------RRVRETLPPEFQSRIPFDKVKDIPEVTLDDMRWA
2zkiG           ------------------------------------RRVRETLPPEFQSRI-----PDIPEVTLDDMRWA
2a5lB           ---ILVLYYSRHG-------ATAEAARGVEQFEARVRTVPAV-------------STEALYATLEDLKNC
1ydgE           ---------------------------------VRLLKVRETAPQDVAWKANIEAMKDVPEATPADLEWA
1ydgB           ---------------------------------VRLLKVRETAPQDVAWKANIEAMKDVPEATPADLEWA
1ydgA           ---------------------------------VRLLKVRETAPQDVAWKANIEAMKDVPEATPADLEWA
2a5lA           ---ILVLYYSRHG-------ATAEAARGVEQFEARVRTVPAV--------------STALYATLEDLKNC
1yrhF           ---------------------------------VRLLKVRETAPQDVIDGQDAWKAKDVPEATPADLEWA
1yrhE           ---------------------------------VRLLKVRETAPQDVIDGQDAWKAKDVPEATPADLEWA
1yrhC           ---------------------------------VRLLKVRETAPQDVIDGQDAWKAKDVPEATPADLEWA
1yrhA           ---------------------------------VRLLKVRETAPQDVIDGQDAWKAKDVPEATPADLEWA
3d7nA           ----VVVYHSGYGHTHR-AEAVAEGA------EATLHAI----------DAEGNLSEDGWAA----LDAA
2arkF           --KVLVIYDTRTGNTKK-AELVAEGARSLEGTEVRLKHVDE--------------------ATKEDVLWA
2arkE           --KVLVIYDTRTGNTKK-AELVAEGARSLEGTEVRLKHVDE--------------------ATKEDVLWA
2arkC           --KVLVIYDTRTGNTKK-AELVAEGARSLEGTEVRLKHVDE--------------------ATKEDVLWA
2arkB           --KVLVIYDTRTGNTKK-AELVAEGARSLEGTEVRLKHVDE--------------------ATKEDVLWA
2arkA           --KVLVIYDTRTGNTKK-AELVAEGARSLEGTEVRLKHVDE--------------------ATKEDVLWA
2ohhA           --RVTVIYDTMHGSTRKMAHAIAEGAMS-EGVDVRVYCLHEDDRSEIVKDLGAPTIYDEPYPSVGDLLMY
3edoB           --KTLILYYSWSGETKKAEKINSEIKDSLKEVKVSEGTFDDYKTSDIALDQGNKDFPEIQLDNID-YNNY
3edoA           --KTLILYYSWSGETKKAEKINSEIKDSLKEVKVSEGTFDDYKTSDIALDQGNKDFPEIQLDNID-YNNY


                         .         .         *         .         .         .         .:140
query           DAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHGGQETTITSFHSTLLHQGMVI
3b6iA           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
2r97C           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
3b6mB           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
3b6mA           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
2rg1A           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTG---GGQEQTITSTWTTLAHHGMVI
2rg1B           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
1zwlA           AGLALGSPTRFGNMASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQXXXXXXXXXXXXXX
1zwkA           AGLALGSPTRFGNMASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQXXXXXXXXXXXXXX
2zkiE           DGFAIGSPTRYGNMAGGLKTFLDTTAILWKDNVLYGKPVTFFTEASTVHGGHETTILTMSTYAYHFGMII
2zkiD           DGFAIGSPTRYGNMAGGLKTFLDTTAILWKDNVLYGKPVTFFTEASTVHGGHETTILTMSTYAYHFGMII
2zkiB           DGFAIGSPTRYGNMAGGLKTFLDTTAILWKDNVLYGKPVTFFTEASTVHGGHETTILTMSTYAYHFGMII
2zkiA           DGFAIGSPTRYGNMAGGLKTFLDTTAILWKDNVLYGKPVTFFTEASTVHGGHETTILTMSTYAYHFGMII
2zkiG           DGFAIGSPTRYGNMAGGLKTFLDTTAILWKDNVLYGKPVTFFTEASTVHGGHETTILTMSTYAYHFGMII
2a5lB           AGLALGSPTRFGN-ASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQET--TQXXXXXXXXXXXX
1ydgE           EAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVL
1ydgB           EAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVL
1ydgA           EAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVL
2a5lA           AGLALGSPTRFGN-ASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQET--TQXXXXXXXXXXXX
1yrhF           EAIVFSSPTRFGGATSQ-RAFIDTLGGLWSSGKLANKTFSA-TSAQNVNGGQETTLQTLYTA--HWGAVL
1yrhE           EAIVFSSPTRFGGATSQ-RAFIDTLGGLWSSGKLANKTFSA-TSAQNVNGGQETTLQTLYTA--HWGAVL
1yrhC           EAIVFSSPTRFGGATSQ-RAFIDTLGGLWSSGKLANKTFSA-TSAQNVNGGQETTLQTLYTA--HWGAVL
1yrhA           EAIVFSSPTRFGGATSQ-RAFIDTLGGLWSSGKLANKTFSA-TSAQNVNGGQETTLQTLYTA--HWGAVL
3d7nA           DAIIFGTPT-YGGPSWQFKKFADASSKPWFSAKWQDKVFGGFTNSASLNGDKLNTL--------------
2arkF           DGLAVGSPTN-GLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAVTDYKKFTLHYGAVV
2arkE           DGLAVGSPTN-GLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAVTDYKKFTLHYGAVV
2arkC           DGLAVGSPTN-GLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAVTDYKKFTLHYGAVV
2arkB           DGLAVGSPTN-GLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAVTDYKKFTLHYGAVV
2arkA           DGLAVGSPTN-GLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAVTDYKKFTLHYGAVV
2ohhA           ----------------------------------------------------------------------
3edoB           DLILIGSPVWSGYPATPIKTLLDQKNYR-------GEVASFFTSAGTNH---------------------
3edoA           DLILIGSPVWSGYPATPIKTLLDQKNYR-------GEVASFFTSAGTNH---------------------


                         +         .         .         .         .         *         .:210
query           VGVPYSCQALLNMNEITGGSPYGASTLADADGSRQPSENELTIARFQGEHVAKFTKKVVE
3b6iA           VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
2r97C           VPIGYAAQ------ELRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
3b6mB           VPIGYAAQ--------EGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
3b6mA           VPIGYAAQ---------GGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
2rg1A           VPIGYA------------GTPYGATTIA----SRQPSQEELSIARYQGEYVAGLAVKL--
2rg1B           VPIGYA------------GTPYGATTIA------QPSQEELSIARYQGEYVAGLAVKL--
1zwlA           XXIPY------------GGTPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKL--
1zwkA           XXIP---------------TPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKL--
2zkiE           VPIGYGIPELFQTT--TGGGPYGATHLGSKE---ELDEMERKIARFQGKRITEVAKAI--
2zkiD           VPIGYGIPELFQTT--TGGGPYGATHLGSKE---ELDEMERKIARFQGKRITEVAKAI--
2zkiB           VPIGYGIPELFQTT--TGGGPYGATHLGSKE---ELDEMERKIARFQGKRITEVAKAI--
2zkiA           VPIGYGIPELFQTT--TGGGPYGATHLGSKE---ELDEMERKIARFQGKRITEVAKAI--
2zkiG           VPIGYGIPELFQTT--TGGGPYGATHL----GKEELDEMERKIARFQGKRITEVAKAI--
2a5lB           XXIPYS-----------EPTPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKL--
1ydgE           TPPGYTDEVIFK----SGGNPYGASVTANG----QPLENDRASIRHQVRRQVELTAKLLE
1ydgB           TPPGYTDEVIFK----SGGNPYGASVTANG----QPLENDRASIRHQVRRQVELTAKLLE
1ydgA           TPPGYTDEVIFK----SGGNPYGASVTANG----QPLENDRASIRHQVRRQVELTAKLLE
2a5lA           XXIPY--------------TPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKL--
1yrhF           TPPGYTDEVIFK----SGGNPYGASVTANG----QPLENDRASIRHQVRRQVELTAKLLE
1yrhE           TPPGYTDEVIFK----SGGNPYGASVTANG----QPLENDRASIRHQVRRQVELTAKLLE
1yrhC           TPPGYTDEVIFK----SGGNPYGASVTANG----QPLENDRASIRHQVRRQVELTAKLLE
1yrhA           TPPGYTDEVIFK----SGGNPYGASVTANG----QPLENDRASIRHQVRRQVELTAKLLE
3d7nA           ------------------------------------------------------------
2arkF           AGEPRS------------------------------------------------------
2arkE           AGEPRS------------------------------------------------------
2arkC           AGEPRS------------------------------------------------------
2arkB           AGEPRS------------------------------------------------------
2arkA           AGEPRS------------------------------------------------------
2ohhA           ------------------------------------------------------------
3edoB           ------------------------------------------------------------
3edoA           ------------------------------------------------------------