[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA58880.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eyyA.bssp"
#ERROR : Can't open dsspfile "2o03A.bssp"
#ERROR : Can't open dsspfile "2rgvB.bssp"
#ERROR : Can't open dsspfile "2rgvA.bssp"
#ERROR : Can't open dsspfile "2fe3B.bssp"
#ERROR : Can't open dsspfile "2fe3A.bssp"
#ERROR : Can't open dsspfile "3f8nA.bssp"
#ERROR : Can't open dsspfile "3f8nB.bssp"

## Summary of PDB Search
:163
    5e-10  38%  3eyyA  [x.x.x] PUTATIVE IRON UPTAKE REGULATORY PROTEIN
    7e-10  28%  2o03A  [x.x.x] PROBABLE ZINC UPTAKE REGULATION PROTEIN FURB
    4e-09  26%  2rgvB  [x.x.x] PEROXIDE OPERON REGULATOR
    4e-09  26%  2rgvA  [x.x.x] PEROXIDE OPERON REGULATOR
    2e-08  26%  2fe3B  [x.x.x] PEROXIDE OPERON REGULATOR
    2e-08  26%  2fe3A  [x.x.x] PEROXIDE OPERON REGULATOR
    2e-08  26%  3f8nA  [x.x.x] PEROXIDE OPERON REGULATOR
    5e-08  26%  3f8nB  [x.x.x] PEROXIDE OPERON REGULATOR
:163

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxASRGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEH
3eyyA           ----------------------------------RGYRLTPQRQLVLEAV-DTLEHATPDDILGEVRKTA
2o03A           --------------------------------SAAGVRSTRQRAAISTLLETLDDFRSAQELHDELRRRG
2rgvB           -----------------------------------GVRITPQRHAILEYLVNSMAPT-ADDIYKALEGKF
2rgvA           -----------------------------------GVRITPQRHAILEYLVNSMAPT-ADDIYKALEGKF
2fe3B           -----------------------------------GVRITPQRHAILEYLVNSMAHPTADDIYKALEGKF
2fe3A           -----------------------------------GVRITPQRHAILEYLVNSMAHPTADDIYKALEGKF
3f8nA           -----------------------------------GVRITPQRHAILEYLVNSMAHPTADDIYKALEGKF
3f8nB           -----------------------------------GVRITPQRHAILEYLVNSMAHPTADDIYKALEGKF


                         .         .         *         .         .         .         .:140
query           QAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRCGTVAELDAPEITGIITREAK
3eyyA           SGINISTVYRTLELLEELGLVS-----HAHLGHGAPDR-HHHIHLVCRDCTNVIEADLSVAADFTAKLRE
2o03A           ENIGLTTVYRTLQSMASSGLVDTLHTESVYRRCSEHHHHH----LVCRSCGSTIEVGDHEVEAWAAEVAT
2rgvB           PNMSVATVYNNLRVFRESGLVKEL----TYGDASSRFDFVTSDYAICENCGKIVDFHYPGLDEVEQLAAH
2rgvA           PNMSVATVYNNLRVFRESGLVKEL----TYGDASSRFDFVTSDYAICENCGKIVDFHYPGLDEVEQLAAH
2fe3B           PNMSVATVYNNLRVFRESGLVKELTDASSRFDFVTSDHYHA----ICENCGKIVDFHYPGLDEVEQLAAH
2fe3A           PNMSVATVYNNLRVFRESGLVKELTDASSRFDFVTSDHYHA----ICENCGKIVDFHYPGLDEVEQLAAH
3f8nA           PNMSVATVYNNLRVFRESGLVKELTDASSRFDFVTSDHYHA----ICENCGKIVDFHYPGLDEVEQLAAH
3f8nB           PNMSVATVYNNLRVFRESGLVKELTDASSRFDFVTSDHYHA----ICENCGKIVDFHYPGLDEVEQLAAH


                         +         .         .         .         .         *         .:210
query           YLGFRVDRQTVEIRGLCPQCSxx
3eyyA           QFGFDTDMKHFAIFGRC------
2o03A           KHGFSDVSHTIEIFGTCSDC---
2rgvB           VTGFKVSHHRLEIYGVCQECS--
2rgvA           VTGFKVSHHRLEIYGVCQECS--
2fe3B           VTGFKVSHHRLEIYGVCQECS--
2fe3A           VTGFKVSHHRLEIYGVCQECS--
3f8nA           VTGFKVSHHRLEIYGVCQECS--
3f8nB           VTGFKVSHHRLEIYGVCQEC---