[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA58884.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dt0C.bssp"
#ERROR : Can't open dsspfile "1dt0A.bssp"
#ERROR : Can't open dsspfile "2w7wA.bssp"
#ERROR : Can't open dsspfile "3sdpA.bssp"
#ERROR : Can't open dsspfile "1isaA.bssp"
#ERROR : Can't open dsspfile "2bkbA.bssp"
#ERROR : Can't open dsspfile "1za5A.bssp"
#ERROR : Can't open dsspfile "3h1sB.bssp"
#ERROR : Can't open dsspfile "3h1sA.bssp"
#ERROR : Can't open dsspfile "2a03A.bssp"
#ERROR : Can't open dsspfile "2gojB.bssp"
#ERROR : Can't open dsspfile "2gojA.bssp"
#ERROR : Can't open dsspfile "2bpiA.bssp"
#ERROR : Can't open dsspfile "2cw2B.bssp"
#ERROR : Can't open dsspfile "2cw2A.bssp"
#ERROR : Can't open dsspfile "2awpB.bssp"
#ERROR : Can't open dsspfile "2awpA.bssp"
#ERROR : Can't open dsspfile "1my6A.bssp"
#ERROR : Can't open dsspfile "3ceiB.bssp"
#ERROR : Can't open dsspfile "3ceiA.bssp"
#ERROR : Can't open dsspfile "1uesA.bssp"
#ERROR : Can't open dsspfile "2rcvA.bssp"
#ERROR : Can't open dsspfile "1xuqA.bssp"
#ERROR : Can't open dsspfile "2rcvD.bssp"
#ERROR : Can't open dsspfile "2rcvB.bssp"
#ERROR : Can't open dsspfile "1qnnA.bssp"
#ERROR : Can't open dsspfile "1qnnD.bssp"
#ERROR : Can't open dsspfile "1unfX.bssp"
#ERROR : Can't open dsspfile "2ce4B.bssp"
#ERROR : Can't open dsspfile "1y67A.bssp"
#ERROR : Can't open dsspfile "2aw9B.bssp"
#ERROR : Can't open dsspfile "2cdyD.bssp"
#ERROR : Can't open dsspfile "2cdyA.bssp"
#ERROR : Can't open dsspfile "2cdyC.bssp"
#ERROR : Can't open dsspfile "1y67C.bssp"
#ERROR : Can't open dsspfile "1y67B.bssp"
#ERROR : Can't open dsspfile "3js4C.bssp"
#ERROR : Can't open dsspfile "3js4A.bssp"
#ERROR : Can't open dsspfile "1y67D.bssp"
#ERROR : Can't open dsspfile "1jr9A.bssp"
#ERROR : Can't open dsspfile "2cdyB.bssp"
#ERROR : Can't open dsspfile "2ce4A.bssp"
#ERROR : Can't open dsspfile "2gpcA.bssp"
#ERROR : Can't open dsspfile "3esfA.bssp"
#ERROR : Can't open dsspfile "1gv3A.bssp"
#ERROR : Can't open dsspfile "1mngA.bssp"
#ERROR : Can't open dsspfile "1em1A.bssp"
#ERROR : Can't open dsspfile "1varA.bssp"
#ERROR : Can't open dsspfile "1qnmA.bssp"
#ERROR : Can't open dsspfile "1luvA.bssp"
#ERROR : Can't open dsspfile "2cw3B.bssp"
#ERROR : Can't open dsspfile "2cw3A.bssp"
#ERROR : Can't open dsspfile "2adqB.bssp"
#ERROR : Can't open dsspfile "2qkaA.bssp"
#ERROR : Can't open dsspfile "3c3tA.bssp"
#ERROR : Can't open dsspfile "2qkcA.bssp"
#ERROR : Can't open dsspfile "1pl4C.bssp"
#ERROR : Can't open dsspfile "1pl4B.bssp"
#ERROR : Can't open dsspfile "1pl4A.bssp"
#ERROR : Can't open dsspfile "1ap6A.bssp"
#ERROR : Can't open dsspfile "1zteA.bssp"
#ERROR : Can't open dsspfile "1xreA.bssp"
#ERROR : Can't open dsspfile "3c3sA.bssp"
#ERROR : Can't open dsspfile "2gdsA.bssp"
#ERROR : Can't open dsspfile "1zuqA.bssp"
#ERROR : Can't open dsspfile "1luwA.bssp"
#ERROR : Can't open dsspfile "1zspA.bssp"
#ERROR : Can't open dsspfile "2p4kA.bssp"
#ERROR : Can't open dsspfile "1pm9B.bssp"
#ERROR : Can't open dsspfile "1pm9A.bssp"
#ERROR : Can't open dsspfile "1n0nA.bssp"
#ERROR : Can't open dsspfile "1szxA.bssp"
#ERROR : Can't open dsspfile "1ja8A.bssp"
#ERROR : Can't open dsspfile "1en6A.bssp"
#ERROR : Can't open dsspfile "1d5nA.bssp"
#ERROR : Can't open dsspfile "2adpA.bssp"
#ERROR : Can't open dsspfile "1en4A.bssp"
#ERROR : Can't open dsspfile "1ix9A.bssp"
#ERROR : Can't open dsspfile "1en5A.bssp"
#ERROR : Can't open dsspfile "1i08A.bssp"
#ERROR : Can't open dsspfile "1ma1A.bssp"
#ERROR : Can't open dsspfile "3dc6C.bssp"
#ERROR : Can't open dsspfile "3dc6A.bssp"
#ERROR : Can't open dsspfile "3dc5C.bssp"
#ERROR : Can't open dsspfile "3dc5A.bssp"
#ERROR : Can't open dsspfile "1xilA.bssp"
#ERROR : Can't open dsspfile "1kkcX.bssp"
#ERROR : Can't open dsspfile "1kkcB.bssp"
#ERROR : Can't open dsspfile "1gn4A.bssp"
#ERROR : Can't open dsspfile "1gn3A.bssp"
#ERROR : Can't open dsspfile "1idsA.bssp"
#ERROR : Can't open dsspfile "1ar4A.bssp"
#ERROR : Can't open dsspfile "1xdcA.bssp"
#ERROR : Can't open dsspfile "1gn2A.bssp"
#ERROR : Can't open dsspfile "1gn6A.bssp"
#ERROR : Can't open dsspfile "3bfrA.bssp"
#ERROR : Can't open dsspfile "1kkcA.bssp"
#ERROR : Can't open dsspfile "1wb8A.bssp"
#ERROR : Can't open dsspfile "1b06A.bssp"
#ERROR : Can't open dsspfile "1wb7A.bssp"
#ERROR : Can't open dsspfile "1cojA.bssp"
#ERROR : Can't open dsspfile "1p7gH.bssp"
#ERROR : Can't open dsspfile "1p7gA.bssp"
#ERROR : Can't open dsspfile "3evkA.bssp"

## Summary of PDB Search
:193
    4e-78  68%  1dt0C  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    4e-78  68%  1dt0A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    2e-76  66%  2w7wA  [x.x.x] SUPEROXIDE DISMUTASE [FE]
    3e-76  69%  3sdpA  [a.2.11 - d.44.1] IRON SUPEROXIDE DISMUTASE
    2e-74  66%  1isaA  [a.2.11 - d.44.1] IRON(II) SUPEROXIDE DISMUTASE
    5e-74  65%  2bkbA  [x.x.x] SUPEROXIDE DISMUTASE [FE]
    8e-74  65%  1za5A  [x.x.x] SUPEROXIDE DISMUTASE [FE]
    4e-73  64%  3h1sB  [x.x.x] SUPEROXIDE DISMUTASE
    1e-72  65%  3h1sA  [x.x.x] SUPEROXIDE DISMUTASE
    2e-65  55%  2a03A  [x.x.x] FE-SUPEROXIDE DISMUTASE HOMOLOG
    9e-65  56%  2gojB  [x.x.x] FE-SUPEROXIDE DISMUTASE
    9e-65  56%  2gojA  [x.x.x] FE-SUPEROXIDE DISMUTASE
    9e-65  56%  2bpiA  [x.x.x] FE-SUPEROXIDE DISMUTASE
    1e-62  58%  2cw2B  [x.x.x] SUPEROXIDE DISMUTASE 1
    1e-62  58%  2cw2A  [x.x.x] SUPEROXIDE DISMUTASE 1
    3e-62  53%  2awpB  [x.x.x] IRON SUPER-OXIDE DISMUTASE
    3e-62  53%  2awpA  [x.x.x] IRON SUPER-OXIDE DISMUTASE
    8e-59  57%  1my6A  [a.2.11 - d.44.1] IRON (III) SUPEROXIDE DISMUTASE
    2e-57  54%  3ceiB  [x.x.x] SUPEROXIDE DISMUTASE
    2e-57  54%  3ceiA  [x.x.x] SUPEROXIDE DISMUTASE
    2e-56  51%  1uesA  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    3e-56  54%  2rcvA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    8e-56  51%  1xuqA  [x.x.x] SUPEROXIDE DISMUTASE
    1e-55  54%  2rcvD  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-55  54%  2rcvB  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-55  51%  1qnnA  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    5e-55  51%  1qnnD  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    7e-55  57%  1unfX  [a.2.11 - d.44.1] IRON SUPEROXIDE DISMUTASE
    1e-54  53%  2ce4B  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    3e-54  53%  1y67A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    3e-54  53%  2aw9B  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    4e-54  52%  2cdyD  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    4e-54  52%  2cdyA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-53  52%  2cdyC  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-53  54%  1y67C  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    2e-53  54%  1y67B  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    2e-52  55%  3js4C  [x.x.x] SUPEROXIDE DISMUTASE
    2e-52  55%  3js4A  [x.x.x] SUPEROXIDE DISMUTASE
    7e-52  52%  1y67D  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    9e-52  50%  1jr9A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    2e-51  53%  2cdyB  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-50  53%  2ce4A  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    5e-50  49%  2gpcA  [x.x.x] IRON SUPEROXIDE DISMUTASE
    1e-49  49%  3esfA  [x.x.x] IRON-CONTAINING SUPEROXIDE DISMUTASE B2
    2e-49  46%  1gv3A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    9e-47  46%  1mngA  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    1e-45  48%  1em1A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    3e-45  48%  1varA  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    4e-45  48%  1qnmA  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    5e-45  48%  1luvA  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN]
    5e-45  47%  2cw3B  [x.x.x] IRON SUPEROXIDE DISMUTASE
    5e-45  47%  2cw3A  [x.x.x] IRON SUPEROXIDE DISMUTASE
    5e-45  48%  2adqB  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-44  47%  2qkaA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-44  47%  3c3tA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-44  47%  2qkcA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-44  47%  1pl4C  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    1e-44  47%  1pl4B  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    1e-44  47%  1pl4A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    1e-44  47%  1ap6A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    2e-44  47%  1zteA  [x.x.x] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    2e-44  43%  1xreA  [x.x.x] SUPEROXIDE DISMUTASE
    2e-44  47%  3c3sA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    3e-44  47%  2gdsA  [x.x.x] SUPEROXIDE DISMUTASE
    4e-44  47%  1zuqA  [x.x.x] SUPEROXIDE DISMUTASE
    4e-44  47%  1luwA  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN]
    5e-44  47%  1zspA  [x.x.x] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    5e-44  47%  2p4kA  [x.x.x] SUPEROXIDE DISMUTASE
    9e-44  46%  1pm9B  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    9e-44  46%  1pm9A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    9e-44  47%  1n0nA  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN]
    2e-43  46%  1szxA  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    2e-43  47%  1ja8A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    8e-43  46%  1en6A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    8e-43  46%  1d5nA  [a.2.11 - d.44.1] PROTEIN (MANGANESE SUPEROXIDE DISMUTASE)
    8e-43  47%  2adpA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-42  46%  1en4A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    2e-42  45%  1ix9A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    2e-42  45%  1en5A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    1e-41  45%  1i08A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    5e-41  48%  1ma1A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    6e-40  43%  3dc6C  [x.x.x] SUPEROXIDE DISMUTASE [MN] 1
    2e-39  43%  3dc6A  [x.x.x] SUPEROXIDE DISMUTASE [MN] 1
    5e-39  40%  3dc5C  [x.x.x] SUPEROXIDE DISMUTASE [MN] 2
    1e-38  40%  3dc5A  [x.x.x] SUPEROXIDE DISMUTASE [MN] 2
    5e-36  45%  1xilA  [x.x.x] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    8e-35  40%  1kkcX  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    8e-35  40%  1kkcB  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    1e-34  40%  1gn4A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    1e-34  40%  1gn3A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    1e-34  40%  1idsA  [a.2.11 - d.44.1] IRON SUPEROXIDE DISMUTASE
    2e-34  40%  1ar4A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    3e-34  45%  1xdcA  [x.x.x] SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL
    5e-34  40%  1gn2A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    6e-34  40%  1gn6A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    1e-33  43%  3bfrA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    2e-29  40%  1kkcA  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    5e-29  37%  1wb8A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [FE]
    5e-29  40%  1b06A  [a.2.11 - d.44.1] PROTEIN (SUPEROXIDE DISMUTASE)
    1e-28  37%  1wb7A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE [FE]
    2e-20  36%  1cojA  [a.2.11 - d.44.1] PROTEIN (SUPEROXIDE DISMUTASE)
    4e-14  28%  1p7gH  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    4e-14  28%  1p7gA  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    1e-12  28%  3evkA  [x.x.x] SUPEROXIDE DISMUTASE [FE]
:193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKASGTLFNNGAQ
1dt0C           ----LPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSSGGIFNNAAQ
1dt0A           ----LPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSSGGIFNNAAQ
2w7wA           ----LPALPFAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTSTGGVFNNAAQ
3sdpA           -----PPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSSSGGIFNNAAQ
1isaA           ----LPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAQ
2bkbA           ----LPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAE
1za5A           ----LPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAH
3h1sB           MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTSNGGIFNNAAQ
3h1sA           ----LPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTSNGGIFNNAAQ
2a03A           MAITLPKLKYALNALSPHISEETLSFHYNKHHAGYVNKLNGLIKDTPLANKSLTDILKESTGAIFNNAAQ
2gojB           ----LPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
2gojA           ----LPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
2bpiA           ----LPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
2cw2B           -----PPLPYVKNALEPHMSAETLTYHHDKHHQTYVDTLNSIAANSTIASKTLEQIIKTETGKPFNQAAQ
2cw2A           -----PPLPYVKNALEPHMSAETLTYHHDKHHQTYVDTLNSIAANSTIASKTLEQIIKTETGKPFNQAAQ
2awpB           ----LPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQ
2awpA           ----LPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQ
1my6A           -------LPFDPGALEPYMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRTTYGDIFNNAAQ
3ceiB           ----LRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQ
3ceiA           ----LRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQ
1uesA           MTHELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKSEGGIFNNAGQ
2rcvA           --YELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGTALANKSVEELVADLDSVVRNNGGG
1xuqA           --HELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGAELADKSVEELVANLNEVVRNNGGG
2rcvD           --YELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNA--NKSVEELVADLDSVVRNNGGG
2rcvB           --YELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAV--TALANKSVEELVADLDSVVRNNGGG
1qnnA           MTHELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKSEGGIFNNAGQ
1qnnD           -THELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKSEGGIFNNAGQ
1unfX           --------PYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQV--TELDGKSLEEIIVTAYNKAFNNAAQ
2ce4B           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG
1y67A           --YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG
2aw9B           --YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG
2cdyD           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDGALRNNAGG
2cdyA           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDGALRNNAGG
2cdyC           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG
1y67C           --YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG
1y67B           --YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG
3js4C           ----LSDLPY--EGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFENESLGDIVVKAHNSIFNNAAQ
3js4A           ----LSDLPY--EGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFENESLGDIVVKAHNSIFNNAAQ
1y67D           --YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG
1jr9A           ----LPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHELKNKSLNDLISNLDAVVRNNGGG
2cdyB           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALE--EFADLPVEQLIQQLDGALRNNAGG
2ce4A           --YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALE-TEFADLPVEQLIQQLDGALRNNAGG
2gpcA           ----IPPLPWGYDGLAAKLSKQQVTLHYDKHHQGYVTKLNAAAQNSALATKSIEEIIRTEKGPIFNLAAQ
3esfA           MAFSIPPLPWGYDGLAAKISKEQVTFHYDKHHMGYVTXXXXXXXXXXXXXXXVEEIIRTEKGPIFNLAAQ
1gv3A           ----LPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNLKKHPELQNSSVEALLRDLNSTVRNNGGG
1mngA           ---KLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLLRHLAALRNNGGG
1em1A           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1varA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQTALQFNGGGH
1qnmA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1luvA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
2cw3B           -------LPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDAT-GLPESRINLKSLVTRAGENVFNAAGQ
2cw3A           -------LPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDAT-GLPESRINLKSLVTRAGENVFNAAGQ
2adqB           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
2qkaA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQIAALKANGGG
3c3tA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
2qkcA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQIAALKLNGGG
1pl4C           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1pl4B           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1pl4A           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1ap6A           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1zteA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAHVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1xreA           ---QLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENSELHNKSLEELLCNLETAVRNNGGG
3c3sA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
2gdsA           --HSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1zuqA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1luwA           --HSLPDLPYDYGALEPHINAQIMQLHHSKQHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1zspA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAAVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
2p4kA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAANVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1pm9B           --HSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1pm9A           --HSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1n0nA           --HSLPDLPYDYGALEPHINAQIMQLHHSKVHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1szxA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1ja8A           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1en6A           -SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLEFANLPVEELITKLDQVLRNNAGG
1d5nA           -SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLEFANLPVEELITKLDQVLRNNAGG
2adpA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAA-VNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
1en4A           -SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLEFANLPVEELITKLDQVLRNNAGG
1ix9A           -SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESPEFANLPVEELITKKKTVLRNNAGG
1en5A           -SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTFVNNANAALESLEFANLPVEELITKLDQVLRNNAGG
1i08A           -SYTLPSLPYAYDALEPHFDKQTMEIHHTKAHQTYVNNANAALESLEFANLPVEELITKLDQVLRNNAGG
1ma1A           --YELPELPYPYDALEPHISREQLTIHHQKHHQAYVDGANALLRKLDEARESDTDVDIKAAELSFHVGGY
3dc6C           MKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNVKEAIALQPALKFNGGGH
3dc6A           --HSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNVKEAIALQPALKFNGGGH
3dc5C           MKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNLKEAIALQPALKFNGGGH
3dc5A           --HTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNLKEAIALQPALKFNGGGH
1xilA           --HSLPDLPDG--ALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKQELAKGDVTAQIALQPALKFNGGGH
1kkcX           --YTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNXXXXXXXXXXTDVPKLVSVQQAIKFNGGGH
1kkcB           --YTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNXXXXXXXXXXTDVPKLVSVQQAIKFNGGGH
1gn4A           --YTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHILLNEKNLAFNLAGH
1gn3A           --YTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHILLNEKNLAFNLAGH
1idsA           --YTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHILLNEKNLAFNLAGH
1ar4A           --YTLPELPYDYSALEPYISGEIMELHHDKHHKAYVDGANALDKLAEARDKADFGAINKLEKDLAFNLAG
1xdcA           --HSLPDLPDG--ALEPHINAQIMQLHHSKHHAA-VNNLNVTEEKQELAKGDVTAQIALQPALKFNGGGH
1gn2A           --YTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHILLNEKNLAFNLAGH
1gn6A           --YTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHILLNEKNLAFNLAGH
3bfrA           ----LPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDAKEPSPANARKMIAIQQNIKFHGGGF
1kkcA           ------------------ISQQIMELHHKKHHQTYVNGLNXXXXXXXXXXTDVPKLVSVQQAIKFNGGGH
1wb8A           --YELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEVVKGDLQDIQGIIRGLTFNNGHK
1b06A           --YEFPQLPYKVDALEPYISKDIIDVHYNGHHKGYVDRLEKLIKGDLPQGQDLQGIL---RGLTFNNGHK
1wb7A           --YELPPLPYKIDALEPYISKDIIDVHYNGHHKGFVNGANSLLERLEVVKGDLQDIQGIIRGLTFNNGHK
1cojA           ------------------ISNEQIEPHFEAHYKGYVAKYNEIQEKLADQNFASEYRELKVEETFNYMGVV
1p7gH           --YTLPPLPYAYNALEPYISAE-IQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRARDLSFHLNGH
1p7gA           --YTLPPLPYAYNALEPYISAE-IQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRARDLSFHLNGH
3evkA           --YTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRARDLSFHLNGH


                         .         .         *         .         .         .         .:140
query           VWNHTFYWNCLTPQGGGEPSGALLEAIEKNFGSFSDFKEKFSQSATTLFGSGWAWLVKNSDGSLDIVGTS
1dt0C           VWNHTFYWNCLSPNAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKKADGSLALASTI
1dt0A           VWNHTFYWNCLSPNAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKKADGSLALASTI
2w7wA           IWNHTFYWNCLAPNAGGQPTGXXXXXXXXXFGSFEEFKAKFTDSAINNFGSSWTWLVKNADGSLAIVNTS
3sdpA           VWNHTFYWNCLSPDAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWAWLVK-ADGSLALCSTI
1isaA           VWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTS
2bkbA           VWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTS
1za5A           VWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTS
3h1sB           VFNHTFYWNCLTPNKT-EASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTS
3h1sA           VFNHTFYWNCLTPNKT-EASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTS
2a03A           IWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKDQFSNVLCGHFGSGWGWLALNKNNKLVILQTH
2gojB           IWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
2gojA           IWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
2bpiA           IWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
2cw2B           VYNHTFFFNNLAPNGGGEPTGKIAELITRDFGSFEKFKEDFSAAAVGHFGSGWVWLIAD-DGKLKIVQGH
2cw2A           VYNHTFFFNNLAPNGGGEPTGKIAELITRDFGSFEKFKEDFSAAAVGHFGSGWVWLIAD-DGKLKIVQGH
2awpB           IWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWXXXXXXXXXXXXQTH
2awpA           IWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWXXXXXXXXXXXXQTH
1my6A           VWNHTFFWNSLKPGGGGVPTGDVAARINSAFGSYDEFKAQFKNAAATQFGSGWAWLVLEA-GTLKVTKTA
3ceiB           IYNHDFYWDCLSPKATA-LSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDQKIEIIQTS
3ceiA           IYNHDFYWDCLSPKATA-LSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDQKIEIIQTS
1uesA           TLNHNLYFTQFRXXXXXXXXXXXXEAIDKQFGSFEKFKEEFNTAGTTLFGSGWVWLASDANGKLSIEKEP
2rcvA           HANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFXXXXXGRFGSGWAWLVVNN-GKLEITSTP
1xuqA           HANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVN-NGELEVTSTP
2rcvD           HANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFXXXXXGRFGSGWAWLVVNN-GKLEITSTP
2rcvB           HANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFXXXXXGRFGSGWAWLVVNN-GKLEITSTP
1qnnA           TLNHNLYFTQFRXXXXXXXXXXXXEAIDKQFGSFEKFKEEFNTAGTTLFGSGWVWLASDANGKLSIEKEP
1qnnD           TLNHNLYFTQFRXXXXXXXXXXXXEAIDKQFGSFEKFKEEFNTAGTTLFGSGWVWLASDANGKLSIEKEP
1unfX           VWNHDFFWECMKPGGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAADEDNKLVVIKSP
2ce4B           HANHSMFWQ-IMGQGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
1y67A           HANHSMFWQIMQGQGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
2aw9B           HANHSMFWQIMQGQGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
2cdyD           HANHSMFWQIMGQGQANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
2cdyA           HANHSMFWQIMGQGQANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
2cdyC           HANHSMFWQIMGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
1y67C           HANHSMFWQIM----GNQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
1y67B           HANHSMFWQIM---GQNQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
3js4C           IWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAALKVVSTA
3js4A           IWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAALKVVSTA
1y67D           HANHSMFWQIMXXXXXXXPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
1jr9A           HANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEFXXXXXGRFGSGWAWLVVNN-GEIEIMSTP
2cdyB           HANHSMFWQIMG-QGQNQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA
2ce4A           HANHSMFWQIMGQ--ANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA
2gpcA           IFNHTFYWESM-PNGGGEPTGKVADEINASFGSFAKFKEEFTNVAVGHFGSGWAWLVKDTNGKLKVYQTH
3esfA           IFNHNFYWESMSPNGGGEPSGKLAEAIRASFGSFAKFKEEFTNAAVGHFGSGWAWLVQDTTKKLKVFQTH
1gv3A           HLNHTIFWQIMSPDGGGQPTGDIAQEINQTFGSFEEFKKQFNQAGGDRFGSGWVWLVRNPQGQLQVVSTP
1mngA           HLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTP
1em1A           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1varA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1qnmA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1luvA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
2cw3B           IYNHNMYWLSMVPTSGSHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDTERRLDLVGTK
2cw3A           IYNHNMYWLSMVPTSGSHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDTERRLDLVGTK
2adqB           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
2qkaA           HINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
3c3tA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
2qkcA           HINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1pl4C           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1pl4B           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1pl4A           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1ap6A           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1zteA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1xreA           HYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGE-ELSVMSTP
3c3sA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
2gdsA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1zuqA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1luwA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1zspA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
2p4kA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1pm9B           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1pm9A           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1n0nA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1szxA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGFGWLGFNKEGHLQIAACP
1ja8A           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1en6A           HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
1d5nA           HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
2adpA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1en4A           HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
1ix9A           HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
1en5A           HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
1i08A           HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
1ma1A           VL-HLFFWGNMGPECGGEPSGKLAEYIEKDFGSFERFRKEFSQAAISAEGSGWAVLTQRTDRLFIMQVEK
3dc6C           I-NHSIFWTNLA-KDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATC
3dc6A           I-NHSIFWTNLA-KDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATC
3dc5C           I-NHSIFWTNLA-KDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATC
3dc5A           I-NHSIFWTNLA-KDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATC
1xilA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1kkcX           I-NHSLFWKNLAPEGGGDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGKGKLDIT-TT
1kkcB           I-NHSLFWKNLAPEGGGDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGKGKLDIT-TT
1gn4A           V-NHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNLLIFQVY
1gn3A           V-NHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNLLIFQVY
1idsA           V-NHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNLLIFQVY
1ar4A           HVNHSVFWKNMAPKGSARPTDELGAAIDEFFGSFDNMKAQFTAAATGIQGSGWASLVWDPLGKINTLQFY
1xdcA           I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
1gn2A           V-NHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGCGWAALGWDTLGNLLIFQVY
1gn6A           V-NHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNLLIFQVY
3bfrA           T-NHCLFWENLAPQGGGEPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNNGGKLDVVQTY
1kkcA           I-NHSLFWKNLAPEGGGKIDQALKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGPGKLDIT-TT
1wb8A           L--HALYWENMAPSXXXXXXXALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTEGNLQIMTFE
1b06A           L--HAIYWNNMXXXXXXXXXXXLADLIDKQYGSFDRFKQVFSESANSLPGSGWTVLYDNESGNLQIMTVE
1wb7A           L--HALYWENMAPSXXXXXXXALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTEGNLQIMTFE
1cojA           L--HELYFGMLTPGGKGEPSEALKKKIEEDIGGLDACTNELKAAAMAF--RGWAILGLDIFSGRLVVNGL
1p7gH           ILHSIFWPNAXXXXXXXXXXXXIADLINXXXXXXXXXXXXXXQAAKNVEGVGWAILVYXXXXXXXXXXXX
1p7gA           ILHSIFWPNAXXXXXXXXXXXXIADLINXXXXXXXXXXXXXXQAAKNVEGVGWAILVYXXXXXXXXXXXX
3evkA           ILHSIFWPNAXXXXXXXXXXXXIADLINXXXXXXXXXXXXXXQAAKNVEGVGWAILVYXXXXXXXXXXXX


                         +         .         .         .         .         *         .:210
query           NAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLEAFWKLANWDFVAKNLAN
1dt0C           GAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWAFVAE----
1dt0A           GAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWAFVAE----
2w7wA           NAATPLTEGVTPLLTVDLWEHAYYIDFRNVRPDYMGAFWSLVNWSFVEENLA-
3sdpA           GAGAPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWAFVAE----
1isaA           NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLA-
2bkbA           NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLA-
1za5A           NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLA-
3h1sB           NAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYVEALWDIVNWQFVSEQFAD
3h1sA           NAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYVEALWDIVNWQFVSEQFA-
2a03A           DAGNPIKENTIPILTCDVWEHAYYIDYRNDRLSYVKAWWNLVNWNFANENLKN
2gojB           DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENL--
2gojA           DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENL--
2bpiA           DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENL--
2cw2B           DAGNPIRESKTPLMNIDVWEHAYYIDYRNARAQYVKNYWNLVNWDFVNDNVA-
2cw2A           DAGNPIRESKTPLMNIDVWEHAYYIDYRNARAQYVKNYWNLVNWDFVNDNVA-
2awpB           DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRPSYVKAWWNLVNWNFANENL--
2awpA           DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRPSYVKAWWNLVNWNFANENL--
1my6A           NAENPLVHGQVPLLTIDVWEHAYYLDYQNRRPDFIDNFLQLVNWDFVAKNLA-
3ceiB           NAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQ----
3ceiA           NAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQ----
1uesA           NAGNPVRKGLNPLLTFDVWEHAYYLTYQNRRADHLKDLWSIVDWDIV------
2rcvA           NQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVAR----
1xuqA           NQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEK----
2rcvD           NQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVAR----
2rcvB           NQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVAR----
1qnnA           NAGNPVRKGLNPLLGFDVWEHAYYLTYQNRRADHLKDLWSIVDWDIV------
1qnnD           NAGNPVRKGLNPLLGFDVWEHAYYLTYQNRRADHLKDLWSIVDWDIV------
1unfX           NAVNPLVGGYYPLLTIDVWEHAYYLDFQNRRPDYISVFMKLVSWDAVSSRL--
2ce4B           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
1y67A           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
2aw9B           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
2cdyD           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
2cdyA           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
2cdyC           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
1y67C           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
1y67B           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
3js4C           NADSPLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLELLNWDFVLGRL--
3js4A           NADSPLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLELLNWDFVLGRL--
1y67D           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
1jr9A           IQDNPLMEGKKPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWDEVA-----
2cdyB           NQDNPLMGSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
2ce4A           NQDNPLMGSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
2gpcA           DAGCPLTEPNLPLLTCDVWEHAYYVDYKNDRAAYVQTFWNVVNWKNVERQL--
3esfA           DAGCPLTEADKPILTCDVWEHAYYIDYKNDRPAYVQTFWNVVNWD--------
1gv3A           NQDNPIMEGSYPIMGNDVWEHAYYLRYQNRRPEYLNNWWNVVNW---------
1mngA           NQDNPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWD--------
1em1A           NA-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1varA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1qnmA           N-NDPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1luvA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
2cw3B           DAHSPLSEGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWSLINWEFADSNL--
2cw3A           DAHSPLSEGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWSLINWEFADSNL--
2adqB           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
2qkaA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
3c3tA           NQ-DPLTTGLIPLLGIDVWDHAYYLQYKNVRPDYLKAIWNVINWENVTE----
2qkcA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1pl4C           NQ-DPLTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTE----
1pl4B           NQ-DPLTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTE----
1pl4A           NQ-DPLTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTE----
1ap6A           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1zteA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1xreA           NQDTPLQEGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDRV------
3c3sA           NQ-DPLTTGLIPLLGIDVWAHAYYLQYKNVRPDYLKAIWNVINWENVTE----
2gdsA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1zuqA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1luwA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1zspA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
2p4kA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1pm9B           NQ-DPLTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTE----
1pm9A           NQ-DPLTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTE----
1n0nA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1szxA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1ja8A           NQ-DPLTTGLIPLLGIDVAEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1en6A           NLDSPLMASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
1d5nA           NQDSPLMASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
2adpA           NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
1en4A           NHDSPLMASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
1ix9A           NQDSPLMASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFA-
1en5A           NQDSPLMASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
1i08A           NQDSPLMASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
1ma1A           HNVNVIPHFRI-LLVLDVWEHAYYIDYRNVRPDYVEAFWNIVNWKEVEK----
3dc6C           ANQDPLTTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFA-
3dc6A           ANQDPLTTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFA-
3dc5C           ANQDPL-EGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFAN
3dc5A           ANQDPL-EGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFAN
1xilA           NQ-DPLTTGLIPLLGIDVWEHAL---QKNVRPD-LKAIWNVINWENVTERMA-
1kkcX           HDQDPVT-GAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINW---------
1kkcB           HDQDPVT-GAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINW---------
1gn4A           DEQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYA-
1gn3A           DQQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYA-
1idsA           DHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYA-
1ar4A           DHQNNLPAGSIPLLQLDMWEHAFYLQYKNVKGDYVKSWWNVVNWDDVA-----
1xdcA           NQ-DPLTTGLIPLLGIDVWEHAL---QKNVRPD-LKAIWNVINWENVTERMA-
1gn2A           DHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYA-
1gn6A           DHQTNFPLAIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYA-
3bfrA           NQ-DTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNW---------
1kkcA           HDQDPVT-GAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINW---------
1wb8A           NHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKL--
1b06A           NHFMNHIAELPVILIVDEFEHAYYLQYKNKRGDYLNAWWNVVNWDDAEKRL--
1wb7A           NHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKL--
1cojA           DAHNVYNTGLIPLIVIDTYEHAYYVDYKNKRPPYIDAFFKNINWDVV------
1p7gH           XKHNXXXXXXXXXXXXXXWEHAYYLQYKNDRGSY-------------------
1p7gA           XKHNXXXXXXXXXXXXXXWEHAYYLQYKNDRGSY-------------------
3evkA           XKHNLMXXXXXXXXXXXXWEHAYYLQYKNDRGSY-------------------