[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA59023.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eizA.bssp"
#ERROR : Can't open dsspfile "2nyuA.bssp"
#ERROR : Can't open dsspfile "2nyuB.bssp"
#ERROR : Can't open dsspfile "2plwA.bssp"
#ERROR : Can't open dsspfile "3douA.bssp"
#ERROR : Can't open dsspfile "2yxlA.bssp"

## Summary of PDB Search
:212
    3e-52  56%  1eizA  [c.66.1] FTSJ
    5e-25  39%  2nyuA  [x.x.x] PUTATIVE RIBOSOMAL RNA METHYLTRANSFERASE 2
    1e-24  39%  2nyuB  [x.x.x] PUTATIVE RIBOSOMAL RNA METHYLTRANSFERASE 2
    7e-18  31%  2plwA  [x.x.x] RIBOSOMAL RNA METHYLTRANSFERASE, PUTATIVE
    4e-12  32%  3douA  [x.x.x] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
    9e-05  44%  2yxlA  [x.x.x] 450AA LONG HYPOTHETICAL FMU PROTEIN
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAER
1eizA           ---------------------------GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
2nyuA           ----------------------------YRSRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQK
2nyuB           ----------------------------YRSRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQK
2plwA           ----------------------------YRSRAAYKLIELDNKYLFLKKNKIILDIGCYPGSWCQVILER
3douA           -----------------------------RSRAAFKLEFLLDRYRVVRKGDAVIEIGSSPGGWTQVLNSL
2yxlA           ------------------------------------------------PGETVVDLAAAPGGKTTHLAEL


                         .         .         *         .         .         .         .:140
query           VGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIY
1eizA           IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
2nyuA           VNAAGTVLGVDLLHIFPLEGATFLPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLIS
2nyuB           VNAAGTVLGVDLLHIFPLEGATFLPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLIS
2plwA           TNYKNKIIGIDKKIMDPIPNVYFIQGEIGKDNVDYKLKEILQDKKIDIILSDAAVPCIGNKIDDHLNSCE
3douA           A---RKIISID-LQEEEIAGVRFIRCDIFKETIFDDIDRALEGIEXXXXXXXXXXXXXGIPSRDHAVSYQ
2yxlA           MKNKGKIYAFDV----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVARxxxxxxx
1eizA           LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
2nyuA           LCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKP--------EVYFLA--------
2nyuB           LCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIK-------SSEVYFLA--------
2plwA           LTLSITHFMEQYINIGGTYIVKMYLGSQTNNLKTYLKGMFQLVHTTKP-----KSREIYLVCK-------
3douA           IGQ-RVEIAVRYLRNGGNVLLKQFQGDTNDFI-AIWRKNFSSYKISKP------SSEIYI----------
2yxlA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xx
1eizA           --
2nyuA           --
2nyuB           --
2plwA           --
3douA           --
2yxlA           --