[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA59494.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2vepA.bssp"
#ERROR : Can't open dsspfile "2cffA.bssp"
#ERROR : Can't open dsspfile "1vzwA.bssp"
#ERROR : Can't open dsspfile "1qo2A.bssp"
#ERROR : Can't open dsspfile "2w79A.bssp"
#ERROR : Can't open dsspfile "2w79B.bssp"
#ERROR : Can't open dsspfile "1h5yB.bssp"
#ERROR : Can't open dsspfile "1h5yA.bssp"
#ERROR : Can't open dsspfile "1ka9F.bssp"
#ERROR : Can't open dsspfile "1vh7A.bssp"
#ERROR : Can't open dsspfile "1thfD.bssp"
#ERROR : Can't open dsspfile "1gpwA.bssp"
#ERROR : Can't open dsspfile "2a0nA.bssp"
#ERROR : Can't open dsspfile "1gpwE.bssp"
#ERROR : Can't open dsspfile "2rkxA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "2w6rA.bssp"
#ERROR : Can't open dsspfile "1cojA.bssp"

## Summary of PDB Search
:249
    4e-34  36%  2vepA  [x.x.x] PHOSPHORIBOSYL ISOMERASE A
    5e-28  31%  2cffA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    9e-28  37%  1vzwA  [x.x.x] PHOSPHORIBOSYL ISOMERASE A
    2e-27  31%  1qo2A  [c.1.2]
    8e-26  30%  2w79A  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    1e-25  30%  2w79B  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    2e-19  31%  1h5yB  [c.1.2] HISF
    2e-19  31%  1h5yA  [c.1.2] HISF
    6e-16  26%  1ka9F  [c.1.2] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    2e-15  26%  1vh7A  [c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    2e-15  26%  1thfD  [c.1.2] HISF PROTEIN
    2e-15  26%  1gpwA  [c.1.2] HISF PROTEIN
    2e-15  26%  2a0nA  [x.x.x] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    2e-14  25%  1gpwE  [c.1.2] HISF PROTEIN
    8e-11  23%  2rkxA  [x.x.x] CYCLASE SUBUNIT OF
    6e-08  25%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    4e-05  30%  2w6rA  [x.x.x] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    7e-04  29%  1cojA  [a.2.11 - d.44.1] PROTEIN (SUPEROXIDE DISMUTASE)
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQPVNADIIYHIA
2vepA           --LLPAVDVRDGQAVRLVHGESGTETSYGS-PLEAALAWQRSGAEWLHLVDLDAAF-GTGDNRALIAEVA
2cffA           MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS
1vzwA           --LLPAVDVRDGQAVR--------ETSYGS-PLEAALAWQRSGAEWLHLVDLDAAF-GTGDNRALIAEVA
1qo2A           -LVVPAIDLFRGKVARIK-GRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS
2w79A           MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS
2w79B           MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS
1h5yB           --IIPCLDIDGGAKVVVKQGIRE-----VGDPVEMAVRYEEEGADEIAILDITAAPEGRATFIDSVKRVA
1h5yA           --IIPCLDIDGGAKVVVKQGIRE-----VGDPVEMAVRYEEEGADEIAILDITAAPEGRATFIDSVKRVA
1ka9F           --IVPCLDVHAGRVVKVNFVNLRD----AGDPVEAARAYDEAGADELVFLDISATHEERAILLDVVARVA
1vh7A           --IIACLDVKDGRVVK---GTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVA
1thfD           --IIACLDVKDGRVVK---GSNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVA
1gpwA           -------------CLNVKDGRVVKGTNFSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVA
2a0nA           --IIACLDVKDGRVVK---GTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVA
1gpwE           -------------CLNVKDGRVVENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVA
2rkxA           --IIAALIVKDGRVVK---GSNFENLRDSGDPVELGKFYSEIGIDELSFWDITASVEKRKTMLELVEKVA
3cwoX           ---------------------------------------------------------------DAIKEIM
2w6rA           ----------------------------------------------------------------------
1cojA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QALPDMDIQVGGGIRDSDTIQTYLDAGVRYAIIGTKAINAPHFVADACLEFPGHILLGLDAREGKIAING
2vepA           QAM-DIKVELSGGIRXXXXXXXXXXXGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVXXXXXXXXX
2cffA           EFAEH--IQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLK-SLREIDVEPVFSLVTRGGRVAFKG
1vzwA           QAM-DIKVELSGGIRXXXXXXXXXXXGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVXXXXXXXXX
1qo2A           EFAEH--IQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLK-SLREIDVEPVFSLDTRGGRVAFKG
2w79A           EFAE--YIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSSL-KSLREIDVEPVFSLVTRGGRVAFKG
2w79B           EFAE--YIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSSL-KSLREIDVEPVFSLVTRGGRVAFKG
1h5yB           EAV-SIPVLVGGGVRSLEDATTLFRAGADKVSVNTAAVRNPQLVALLAREFGSQTVVAIDAKWNEVYVKG
1h5yA           EAV-SIPVLVGGGVRSLEDATTLFRAGADKVSVNTAAVRNPQLVALLAREFGSQTVVAIDAKWNEVYVKG
1ka9F           ERV-FIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFGAQVVLAIDARWREVHVAG
1vh7A           EQI-DIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQVVVAIDAKDGEFMVFT
1thfD           EQI-DIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQVVVAIDAKDGEFMVFT
1gpwA           EQI-DIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQVVVAIDAKDGEFMVFT
2a0nA           EQI-DIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQVVVAIDAKDGEFMVFT
1gpwE           EQI-DIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQVVVAIDAKDGEFMVFT
2rkxA           EQI-DIPFTVGGGIHDFETASELILRGADKVEINTAAVENPSLITQIAQTFGSQVYIAAKRVDGEFMVFT
3cwoX           KIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVNTAAVENPSLITQIAQTFGSQVVVAIDAKDGEFMVFT
2w6rA           ----------------------------------------------------------------------
1cojA           ----------------------------------------------AAMAFRGWAILGLDIFSGRLVVNG


                         +         .         .         .         .         *         .:210
query           WSKLSRHNLIDIAQRFEKDGVEAIIYTDIQRDGMMKGVNIEATSELAKAINIPVIASGGVSSLTEIEALC
2vepA           XXXXXXXXY-ETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIA
2cffA           WLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAV
1vzwA           XXXXXXXXY-ETLDRLNKEGCARYVVTDI-------GPNLELLKNVCAATDRPVVASGGVSSLDDLRAIA
1qo2A           WLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAV
2w79A           WLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKVGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAV
2w79B           W--LAEIDPVSLLKRLKEYGLEEIVHTEIEKVGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAV
1h5yB           GREATGLDAVKWAKEVEELGAGEILLTSIDRDGTGLGYDVELIRRVADSVRIPVIASGG-----------
1h5yA           GREATGLDAVKWAKEVEELGAGEILLTSIDRDGTGLGYDVELIRRVADSVRIPVIASGG-----------
1ka9F           GRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGTKEGYDLRLTRMVAEAVGVPVIASGGAGRM-------
1vh7A           YSGKKNTGILDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKM-------
1thfD           YSGKKNTGILDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKM-------
1gpwA           YSGKKNTGILDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKM-------
2a0nA           YSGKKNTGILDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKM-------
1gpwE           YSGKKNTGILDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKM-------
2rkxA           YSGKKNTGILDWVVEVEKRGAGEIVLGSIDRLGTKSGYDTEMIRFVRPLTTLPIIAHGGAGKM-------
3cwoX           YSGKKNTGILDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKM-------
2w6rA           --------LRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHLEXXX
1cojA           LDAHNVYNLTGLIPLIVIDTYEHAYYVDYKNDAFFKNINWDVVNE-------------------------


                         .         .         .         +         .         .         .:280
query           QHEQDGIGGAIIGRALYEEKIQLAEALAIAKRLSGExxx
2vepA           GLVPAGVEGAIVGKALYAKAFTLEEAL------------
2cffA           HTETNGLKGVIVGRAFLE---------------------
1vzwA           GLVPAGVEGAIVGKALYAKAFTLEEAL------------
1qo2A           HTETNGLKGVIVGRAFLE---------------------
2w79A           HTETNGLKGVIVGRAFLE---------------------
2w79B           HTETNGLKGVIVGRAFLE---------------------
1h5yB           ---------------------------------------
1h5yA           ---------------------------------------
1ka9F           ---------------------------------------
1vh7A           ---------------------------------------
1thfD           ---------------------------------------
1gpwA           ---------------------------------------
2a0nA           ---------------------------------------
1gpwE           ---------------------------------------
2rkxA           ---------------------------------------
3cwoX           ---------------------------------------
2w6rA           XXXXXXXXXSVFMREL-KEYLKSGQAVVVAKRVDGE---
1cojA           ---------------------------------------