[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for noce0:ABA59517.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2qe7A.bssp"
#ERROR : Can't open dsspfile "1w0jC.bssp"
#ERROR : Can't open dsspfile "2jizC.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2jizA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2ck3A.bssp"
#ERROR : Can't open dsspfile "1mabA.bssp"
#ERROR : Can't open dsspfile "2f43A.bssp"
#ERROR : Can't open dsspfile "1h8eC.bssp"
#ERROR : Can't open dsspfile "1h8eA.bssp"
#ERROR : Can't open dsspfile "1skyB.bssp"
#ERROR : Can't open dsspfile "2v7qB.bssp"
#ERROR : Can't open dsspfile "2jizB.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2ck3B.bssp"
#ERROR : Can't open dsspfile "2v7qC.bssp"
#ERROR : Can't open dsspfile "1fx0A.bssp"
#ERROR : Can't open dsspfile "2r9vA.bssp"
#ERROR : Can't open dsspfile "2hldC.bssp"
#ERROR : Can't open dsspfile "2hldB.bssp"
#ERROR : Can't open dsspfile "2hldA.bssp"
#ERROR : Can't open dsspfile "3fksS.bssp"
#ERROR : Can't open dsspfile "3fksA.bssp"
#ERROR : Can't open dsspfile "2hldT.bssp"
#ERROR : Can't open dsspfile "2hldS.bssp"
#ERROR : Can't open dsspfile "2hldK.bssp"
#ERROR : Can't open dsspfile "3fksK.bssp"
#ERROR : Can't open dsspfile "3fksB.bssp"
#ERROR : Can't open dsspfile "2hldJ.bssp"
#ERROR : Can't open dsspfile "3fksU.bssp"
#ERROR : Can't open dsspfile "3fksT.bssp"
#ERROR : Can't open dsspfile "2hldW.bssp"
#ERROR : Can't open dsspfile "2hldO.bssp"
#ERROR : Can't open dsspfile "2hldF.bssp"
#ERROR : Can't open dsspfile "2hldE.bssp"
#ERROR : Can't open dsspfile "2hldD.bssp"
#ERROR : Can't open dsspfile "3fksW.bssp"
#ERROR : Can't open dsspfile "3fksF.bssp"
#ERROR : Can't open dsspfile "3fksN.bssp"
#ERROR : Can't open dsspfile "2qe7D.bssp"
#ERROR : Can't open dsspfile "3fksD.bssp"
#ERROR : Can't open dsspfile "2oblA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2obmA.bssp"
#ERROR : Can't open dsspfile "3a5cD.bssp"
#ERROR : Can't open dsspfile "1fx0B.bssp"
#ERROR : Can't open dsspfile "1skyE.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2rkwA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1mabB.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2f43B.bssp"
#ERROR : Can't open dsspfile "1ohhD.bssp"
#ERROR : Can't open dsspfile "2ck3F.bssp"
#ERROR : Can't open dsspfile "2ck3D.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "2ck3E.bssp"
#ERROR : Can't open dsspfile "2rkwB.bssp"
#ERROR : Can't open dsspfile "2v7qE.bssp"
#ERROR : Can't open dsspfile "3fksV.bssp"
#ERROR : Can't open dsspfile "1e79D.bssp"
#ERROR : Can't open dsspfile "1h8eE.bssp"
#ERROR : Can't open dsspfile "1nbmE.bssp"
#ERROR : Can't open dsspfile "3dsrA.bssp"
#ERROR : Can't open dsspfile "3a5cA.bssp"
#ERROR : Can't open dsspfile "1vdzA.bssp"

## Summary of PDB Search
:515
    e-170  64%  2qe7A  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA
    e-158  60%  1w0jC  [b.49.1 - c.37.1 - a.69.1] ATP SYNTHASE ALPHA CHAIN HEART
    e-157  60%  2jizC  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
    e-157  61%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    e-157  62%  2jizA  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
    e-156  62%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    e-156  62%  2ck3A  [b.49.1 - c.37.1 - a.69.1 (1bmfA)] ATP SYNTHASE ALPHA CHAIN
    e-156  59%  1mabA  [b.49.1 - c.37.1 - a.69.1] PROTEIN (F1-ATPASE ALPHA CHAIN)
    e-154  61%  2f43A  [x.x.x] ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL
    e-153  61%  1h8eC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    e-152  61%  1h8eA  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    e-151  60%  1skyB  [b.49.1 - c.37.1 - a.69.1] F1-ATPASE
    e-150  61%  2v7qB  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
    e-150  61%  2jizB  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
    e-150  61%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    e-150  61%  2ck3B  [b.49.1 - c.37.1 - a.69.1 (1w0jB)] ATP SYNTHASE ALPHA CHAIN
    e-149  62%  2v7qC  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
    e-145  56%  1fx0A  [b.49.1 - c.37.1 - a.69.1] ATP SYNTHASE ALPHA CHAIN
    e-142  60%  2r9vA  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA
    e-140  56%  2hldC  [x.x.x] ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL
    e-137  56%  2hldB  [x.x.x] ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL
    e-137  56%  2hldA  [x.x.x] ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL
    e-137  56%  3fksS  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
    e-137  56%  3fksA  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
    e-137  56%  2hldT  [x.x.x] ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL
    e-137  56%  2hldS  [x.x.x] ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL
    e-137  56%  2hldK  [x.x.x] ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL
    e-137  55%  3fksK  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
    e-137  56%  3fksB  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
    e-137  56%  2hldJ  [x.x.x] ATP SYNTHASE ALPHA CHAIN, MITOCHONDRIAL
    e-134  56%  3fksU  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
    e-129  56%  3fksT  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
    5e-27  26%  2hldW  [x.x.x] ATP SYNTHASE BETA CHAIN, MITOCHONDRIAL
    5e-27  26%  2hldO  [x.x.x] ATP SYNTHASE BETA CHAIN, MITOCHONDRIAL
    5e-27  26%  2hldF  [x.x.x] ATP SYNTHASE BETA CHAIN, MITOCHONDRIAL
    5e-27  26%  2hldE  [x.x.x] ATP SYNTHASE BETA CHAIN, MITOCHONDRIAL
    5e-27  26%  2hldD  [x.x.x] ATP SYNTHASE BETA CHAIN, MITOCHONDRIAL
    5e-27  26%  3fksW  [x.x.x] ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL
    5e-27  26%  3fksF  [x.x.x] ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL
    2e-26  26%  3fksN  [x.x.x] ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL
    3e-26  27%  2qe7D  [x.x.x] ATP SYNTHASE SUBUNIT BETA
    6e-26  26%  3fksD  [x.x.x] ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL
    4e-25  29%  2oblA  [x.x.x] ESCN
    4e-25  30%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    4e-25  30%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    7e-25  32%  2obmA  [x.x.x] ESCN
    1e-24  28%  3a5cD  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-24  26%  1fx0B  [b.49.1 - c.37.1 - a.69.1] ATP SYNTHASE BETA CHAIN
    7e-24  27%  1skyE  [b.49.1 - c.37.1 - a.69.1] F1-ATPASE
    5e-22  30%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-21  26%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-21  26%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-21  30%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-21  30%  2rkwA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-21  30%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    6e-21  24%  1mabB  [b.49.1 - c.37.1 - a.69.1] PROTEIN (F1-ATPASE BETA CHAIN)
    1e-20  30%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-20  24%  2f43B  [x.x.x] ATP SYNTHASE BETA CHAIN, MITOCHONDRIAL
    5e-20  24%  1ohhD  [b.49.1 - c.37.1 - a.69.1] ATP SYNTHASE BETA CHAIN,
    5e-20  24%  2ck3F  [b.49.1 - c.37.1 - a.69.1 (1bmfE)] ATP SYNTHASE BETA CHAIN
    5e-20  24%  2ck3D  [b.49.1 - c.37.1 - a.69.1 (1bmfD)] ATP SYNTHASE BETA CHAIN
    6e-20  30%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    6e-20  24%  2ck3E  [x.x.x] ATP SYNTHASE BETA CHAIN
    8e-20  30%  2rkwB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-19  24%  2v7qE  [x.x.x] ATP SYNTHASE SUBUNIT BETA
    1e-19  27%  3fksV  [x.x.x] ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL
    2e-19  24%  1e79D  [b.49.1 - c.37.1 - a.69.1] ATP SYNTHASE BETA CHAIN
    3e-19  24%  1h8eE  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    7e-19  24%  1nbmE  [b.49.1 - c.37.1 - a.69.1] F1-ATPASE
    3e-18  30%  3dsrA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    7e-16  29%  3a5cA  [x.x.x] V-TYPE ATP SYNTHASE ALPHA CHAIN
    7e-09  29%  1vdzA  [x.x.x] A-TYPE ATPASE SUBUNIT A
:515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxSELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLER
2qe7A           ------------------------------GTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEE
1w0jC           ---------------ERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2jizC           -----------------ILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1bmfC           ----------------------ADTSVDLEGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2jizA           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2ck3C           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2ck3A           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1mabA           ----------SSILEERI-GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2f43A           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1h8eC           ----------------------ADTSVDLEGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1h8eA           ----------------------ADTSVDLEGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1skyB           ------------------------------GTVIQVGDGIARAHGLDNVMSGEAVEFANAVMGMALNLEE
2v7qB           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2jizB           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1e1qB           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2ck3B           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2v7qC           ------------------------------GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1fx0A           ------------------------------GTVLQVGDGIARIHGLDEVMAGELVEFEEGTIGIALNLES
2r9vA           ------------------KSFEEKIDLEDTGKVIQVGDGIARAYGLNKVV-SELVEFETGVKGVAFNLEE
2hldC           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
2hldB           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
2hldA           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
3fksS           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
3fksA           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
2hldT           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
2hldS           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
2hldK           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
3fksK           -----------------IKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
3fksB           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
2hldJ           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
3fksU           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
3fksT           ------------------------------GRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEP
2hldW           ---------------------------------------------------------------VAQHLGE
2hldO           ---------------------------------------------------------------VAQHLGE
2hldF           ---------------------------------------------------------------VAQHLGE
2hldE           ---------------------------------------------------------------VAQHLGE
2hldD           ---------------------------------------------------------------VAQHLGE
3fksW           ---------------------------------------------------------------VAQHLGE
3fksF           ---------------------------------------------------------------VAQHLGE
3fksN           ---------------------------------------------------------------VAQHLGE
2qe7D           -----------------------------KGRIIQVMGPVVDIQQLPDIYNAITIERPQGTVEAAVHLGD
3fksD           ---------------------------------------------------------------VAQHLGE
2oblA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2obmA           ----------------------------------------------------------------------
3a5cD           ------------------------------GAIVDIKDGTGRVRG------GQVIEV-------------
1fx0B           -------------------------------------------------------------------LGN
1skyE           ------------------------------------------------------------TLEVALHLGD
3eiuB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2rkwA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1mabB           ---------------------------------------------------------------VAQHLGE
3eiuA           ----------------------------------------------------------------------
2f43B           ---------------------------------------------------------------VAQHLGE
1ohhD           ----------------------------TTGRIVAVIGAVVDVQGLPPIL--NALEVQGRETRLAQHLGE
2ck3F           ----------------------------TTGRIVAVIGAVVDVQGLPPIL--NALEVQGRETRLAQHLGE
2ck3D           ----------------------------TTGRIVAVIGAVVDVQGLPPIL--NALEVQGRETRLAQHLGE
3dsrB           ----------------------------------------------------------------------
2ck3E           ----------------------------TTGRIVAVIGAVVDVQGLPPIL--NALEVQGRETRLAQHLGE
2rkwB           ----------------------------------------------------------------------
2v7qE           ---------------------------------------------------------------VAQHLGE
3fksV           ---------------------------------------------------------------VAQHLGE
1e79D           ----------------------------TTGRIVAVIGAVVDVQGLPPIL--NALEVQGRETRLAQHLGE
1h8eE           ----------------------------TTGRIVAVIGAVVDVQGLPPIL--NALEVQGRETRLAQHLGE
1nbmE           ----------------------------TTGRIVAVIGAVVDVQGLPPIL--NALEVQGRETRLAQHLGE
3dsrA           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
1vdzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT
2qe7A           DNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMD
1w0jC           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2jizC           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
1bmfC           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2jizA           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2ck3C           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2ck3A           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
1mabA           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPVGSKIRRRVGLKAPGIIP
2f43A           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPVGSKIRRRVGLKAPGIIP
1h8eC           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
1h8eA           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
1skyB           NNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGETLIGRVVNPLGQPVDGLGPVETTETRPIESRAPGVMD
2v7qB           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2jizB           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
1e1qB           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2ck3B           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2v7qC           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
1fx0A           NNVGVVLMGDGLMIQEGSSVKATGRIAQIPVSEAYLGRVINALAKPIDGRGEITASESRLIESPAPGIMS
2r9vA           DNVGIIILGEYKDIKEGHTVRRLKRIIEVPVGEELLGRVVNPLGEPLDGKGPINAKNFRPIEIKAPGVIY
2hldC           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
2hldB           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
2hldA           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
3fksS           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
3fksA           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
2hldT           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
2hldS           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
2hldK           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
3fksK           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
3fksB           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
2hldJ           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
3fksU           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
3fksT           GQVGIVLFGSDRLVKEGELVKRTGNIXXXXXXXXXXXXXXXALGNPIDGKGPIDAAGRSRAQVKAPGILP
2hldW           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
2hldO           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
2hldF           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
2hldE           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
2hldD           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
3fksW           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
3fksF           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
3fksN           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
2qe7D           NVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEE
3fksD           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
2oblA           ---------------------------KIRVGDALLGRLIDGIGRPMESN---IVAPYLPFERSLPDPLL
2c61A           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
3b2qA           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2obmA           ---------------------------KIRVGDALLGRLIDGIGRPMESN---IVAPYLPFERSLYAEPP
3a5cD           -SEEYAVIQVFEETTGLDLATTSVSLVELGVSKEMLGRRFNGIGKPIDGLPPITPEKRLPITGLPLNPVA
1fx0B           NRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGPTLGRIFNVLGEPVDNLRPVDTRTTSPIHRSAPAFTQ
1skyE           DTVRTIAMASTDGLIRGMEVIDTGAPISVPVGQVTLGRVFNVLGEPIDLEGDIPADARDPIHRPAPKFEE
3eiuB           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2dpyB           ---------------------------QLPLGPALLGRVXXXXXXXXXXXXXXXTLETGALITPPFNPLQ
2dpyA           ---------------------------QLPLGPALLGRVXXXXXXXXXXXXXXXTLETGALITPPFNPLQ
3b2qB           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2rkwA           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2c61B           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
1mabB           STVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIE
3eiuA           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2f43B           STVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIE
1ohhD           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
2ck3F           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
2ck3D           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
3dsrB           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2ck3E           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
2rkwB           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2v7qE           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
3fksV           NTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAE
1e79D           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
1h8eE           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
1nbmE           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
3dsrA           ----------------------TGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
3a5cA           -----------------------GRVKEVPAGEYTVEEPV----VVLEDGTELKMYHTWPVRRARP-VQR
1vdzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAIGQKASSVAGV
2qe7A           RKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGV
1w0jC           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
2jizC           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
1bmfC           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
2jizA           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
2ck3C           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
2ck3A           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
1mabA           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
2f43A           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
1h8eC           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
1h8eA           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
1skyB           RRSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTIINQKDQNMICIYVAIGQKESTVATV
2v7qB           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
2jizB           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
1e1qB           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
2ck3B           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
2v7qC           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGTDEKCIYVAIGQKRSTVAQL
1fx0A           RRSVYEPLQTGLIAIDAMIPVGRGQRELIIGDRQTGKTAVATDTILNQQGQNVICVYVAIGQKASSVAQV
2r9vA           RKPVDTPLQTGIKAIDS-IPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQGVYCIYVAIGQKKSAIARI
2hldC           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
2hldB           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
2hldA           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
3fksS           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
3fksA           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
2hldT           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
2hldS           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
2hldK           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
3fksK           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
3fksB           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
2hldJ           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
3fksU           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
3fksT           RRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKSKKLYCVYVAVGQKRSTVAQL
2hldW           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
2hldO           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
2hldF           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
2hldE           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
2hldD           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
3fksW           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
3fksF           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
3fksN           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
2qe7D           LSTADEILETGIKVIDLLAPYAXXXXXXXXXXXXXXXT-VLIQELINQEHGGLS-VFAGVGERTREGNDL
3fksD           QSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKT-VFIQELINNKAHGGFSVFTGVGERTREGNDL
2oblA           RQVIDQPFILGVRAIDGLLTCGIGQRIGIFAGSGVGKSTL-LGMICNGASADI-IVLALIGERGREVNEF
2c61A           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
3b2qA           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
2obmA           RQVIDQPFILGVRAIDGLLTCGIGQRIGIFAGSGVGKSTL-LGMICNGASADI-IVLALIGERGREVNEF
3a5cD           RRKPEQFIQTGISTIDVMNTLVRGQKLPIFSGSGLPANEIAAQATVRPKEEPFAVVFAAMGITQRELSYF
1fx0B           LDTKLSIFETGIKVVNLLAPYRRGGKIGLFGGAGVGKTVLIMELINNAKAHGGVSVFGGVGERTREGNDL
1skyE           LATEVEILETGIKVVDLLAPYIXXXXXXXXXXXXXXXTVLIQELIHNQEHGGIS-VFAGVGERTREGNDL
3eiuB           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
2dpyB           RTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLL--GMMARYTRADVIVVGLIGERGREVKDF
2dpyA           RTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLL--GMMARYTRADVIVVGLIGERGREVKDF
3b2qB           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
2rkwA           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
2c61B           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
1mabB           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
3eiuA           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
2f43B           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
1ohhD           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
2ck3F           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
2ck3D           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
3dsrB           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
2ck3E           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
2rkwB           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
2v7qE           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
3fksV           QSSAE--LETGIKVVDLLAPYARGGKIGLFG------KTVFIQELINNKAHGGFSVFTGVGERTREGNDL
1e79D           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
1h8eE           ME--QEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
1nbmE           MSVEQEILVTGIKVVDLLAPYAXXXXXXXXXXXXXXXTVLIMELINNAKAHGGYSVFAGVGERTREGNDL
3dsrA           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
3a5cA           KLDPNTPFLTGMRILDVLFPVAMGGTAAIPGPFGSGKT-VTQQSLAKWSNADV-VVYVGCGERGNEMTDV
1vdzA           ------PLITGQRVIDTFFPQAKGGTAAIPGPFGSGKTVTQHQ--LAKWSDAQVVIYIGCGERGNEMTDV


                         .         .         .         +         .         .         .:280
query           VRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLR
2qe7A           VETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLR
1w0jC           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2jizC           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1bmfC           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2jizA           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2ck3C           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2ck3A           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1mabA           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2f43A           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1h8eC           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1h8eA           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1skyB           VETLAKHGAPDYTIVVTASASQPAPLLFLAPYAGVAMGEYFMIMGKHVLVVIDDLSKQAAAYRQLSLLLR
2v7qB           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2jizB           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1e1qB           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2ck3B           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2v7qC           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1fx0A           VTNFQERGAMEYTIVVAETADSPATLQYLAPYTGAALAEYFMYRERHTLIIYDDLSKQAQAYRQMSLLLR
2r9vA           IDKLRQYGA-EYTTVVVASASDPASLQYIAPYAGCA-GEYFAYSGRDALVVYDDLSKHAVAYRQLS-LLR
2hldC           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
2hldB           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
2hldA           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
3fksS           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
3fksA           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
2hldT           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
2hldS           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
2hldK           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
3fksK           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
3fksB           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
2hldJ           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
3fksU           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLR
3fksT           VQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGH-ALIVYDDLSKQAVAYRQLSLLLR
2hldW           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
2hldO           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
2hldF           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
2hldE           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
2hldD           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
3fksW           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
3fksF           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
3fksN           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
2qe7D           YHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDRGQDVLLFIDNIFRFTQAGSEVSALLG
3fksD           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
2oblA           LALLPQ-STLSKCVLVVTTSDRPALERMKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLASG
2c61A           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQMGAARN
3b2qA           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQMGAARN
2obmA           LALLPQ-STLSKCVLVVTTSDRPALERMKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLASG
3a5cD           IQEFERTGALSRSVLFLNKADDPTIERILTPRMALTVAEYLAEHDYHVLVILTDMTNYCEALREIGAARE
1fx0B           YMEMKESGVINEVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEDVLLFIDNIFRFVQAGSEVSALLG
1skyE           YHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDQGQDGLLFIDNIFRFTQAGSEVSALLG
3eiuB           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQM-----
2dpyB           IENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIG
2dpyA           IENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIG
3b2qB           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQMG----
2rkwA           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQMG----
2c61B           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQMG----
1mabB           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
3eiuA           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQMG----
2f43B           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
1ohhD           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
2ck3F           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
2ck3D           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
3dsrB           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQMG----
2ck3E           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
2rkwB           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQM-----
2v7qE           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
3fksV           YREMKETGVISKVALVFGQMNEPPGARARVALTGLTIAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
1e79D           YHMIESKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
1h8eE           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
1nbmE           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
3dsrA           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQMGA---
3a5cA           LVEFPEGGPLMHTVLIANTSNMPVAAREASIYVGVTIAEYFRDQGFSVALMADSTSRWAEALREISSRLE
1vdzA           LEEFPKKPLMERTVLIANTSNMPVAAREASIYTGITIAEYFRDMGYDVALMADSTSR--WA---------


                         .         *         .         .         .         .         +:350
query           RPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISI
2qe7A           RPPGREAYPGDVFYLHSRLLERAAKLSDE----------KG-GGSLTALPFIETQAGDVSAYIPTNVISI
1w0jC           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2jizC           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
1bmfC           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2jizA           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2ck3C           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2ck3A           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
1mabA           RPPGREAYPGDVFYLHSRLLERAAKMNDSF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2f43A           RPPGREAYPGDVFYLHSRLLERAAKMNDSF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
1h8eC           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
1h8eA           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
1skyB           RPPGREAYPGDIFYLHSRLLERAA--------KLSDAK---GGGSLTALPFVETQAGDISAYIPTNVISI
2v7qB           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2jizB           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
1e1qB           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2ck3B           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2v7qC           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
1fx0A           RPPGREAYPGDVFYLHSRLLERAAKLSSLLGE-----------GSMTALPIVETQAGDVSAYIPTNVISI
2r9vA           RPPGREAYPGDIFYLHSRLLERAVRLN---------DKLGG--GSLTALPIVETQANDISAYIPTNVISI
2hldC           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
2hldB           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
2hldA           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
3fksS           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
3fksA           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
2hldT           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
2hldS           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
2hldK           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
3fksK           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
3fksB           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
2hldJ           RPPGREAYPGDVFYLHSRLLERAA--------KLSE---KEGSGSLTALPVIETQGGDVSAYIPTNVISI
3fksU           RPPGREAYPGDVFYLHSRLLERAAKLEKE------------GSGSLTALPVIETQGGDVSAYIPTNVISI
3fksT           RPPGREAYPGDVFYLHSRLLERAALSEKE-------------GSSLTALPVIETQGGDVSAYIPTNVISI
2hldW           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
2hldO           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
2hldF           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
2hldE           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
2hldD           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
3fksW           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
3fksF           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
3fksN           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
2qe7D           RMPSAVGYQPTL---------------ATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAH
3fksD           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
2oblA           EPDVRGGFPPSVFSSLPKLLERAG---------------PAPKGSITAIYTVLLESDNVNDPIGDEVRSI
2c61A           EVPGRRGYPGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
3b2qA           EVPGRRGYPGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
2obmA           EPDVRGGFPPSVFSSLPKLLERAG---------------PAPKGSITAIYTVLLESDNVNDPIGDEVRSI
3a5cD           EIPGRRGYPGYMYTDLATIYERA-------------GVVEGKKGSVTQIPILSMPDDDRTHPIPDLTGYI
1fx0B           RMPSAVGYQPTL---------------STEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAH
1skyE           RMPSAIGYQPTL---------------ATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSH
3eiuB           ---GAAGYPGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
2dpyB           EPPATKGYPPSVFAKLPALVERAG--NGIH-----------GGGSITAFYTVLTEGDDQQDPIADSARAI
2dpyA           EPPATKGYPPSVFAKLPALVERAG--NGIH-----------GGGSITAFYTVLTEGDDQQDPIADSARAI
3b2qB           -----RGYPGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
2rkwA           -------YPGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
2c61B           -------YPGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
1mabB           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
3eiuA           --------PGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
2f43B           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
1ohhD           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
2ck3F           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
2ck3D           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
3dsrB           --AARRGYPGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMHP------IPDLSGYI
2ck3E           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
2rkwB           ---------GAMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
2v7qE           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
3fksV           RIPSAVGYQPTL---------------ATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAH
1e79D           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
1h8eE           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAH
1nbmE           RIPSAVGYQPTL---------------ATDMGTMQERITTTKKGSITSVQAI-VPADDLTDPAPATTFAH
3dsrA           --------PGYMYTDLATLYERA-------------GIVKGAKGSVTQIPILSMPP------IPDLSGYI
3a5cA           EMPAEEGYPP---YLAARLYERAGKV-------ITLG---GEEGAVTIVGAVSPPGGDMSEPVTQSTLRI
1vdzA           -----EALPA---YLASKLYERAGRV-------VTLGS-DYRVGSVSVIGAVSPPGGDFSEPVVQNTLRV


                         .         .         .         .         *         .         .:420
query           TDGQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR
2qe7A           TDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQ
1w0jC           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
2jizC           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
1bmfC           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
2jizA           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
2ck3C           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
2ck3A           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
1mabA           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
2f43A           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
1h8eC           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFA----DLDAATQ
1h8eA           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAF------LDAATQ
1skyB           TDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDLAAYREL-EFAQFSD--DKATQ
2v7qB           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVA--------LDAATQ
2jizB           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVA--------LDAATQ
1e1qB           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVA--------LDAATQ
2ck3B           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVA--------LDAATQ
2v7qC           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFA-----LDAATQ
1fx0A           TDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKKVAGKLKXXXXXXXXXXXXXXXXSDLDKATQ
2r9vA           TDGQIYLEPGLFYAGQRPAINVGLSVSRVGGSAQIK--AKQVAGLRIDLAQYRELETFAQFATELDPATR
2hldC           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTK
2hldB           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ--SDLDASTK
2hldA           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ--SDLDASTK
3fksS           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ--SDLDASTK
3fksA           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ--SDLDASTK
2hldT           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ---DLDASTK
2hldS           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ---DLDASTK
2hldK           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ---DLDASTK
3fksK           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ----LDASTK
3fksB           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQ---DLDASTK
2hldJ           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAA---FASDLDASTK
3fksU           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFAS-----TK
3fksT           TDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVA--------LDASTK
2hldW           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAIMDELSEQDK
2hldO           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAIMDELSEQDK
2hldF           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAIMDELSEQDK
2hldE           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAIMDELSEQDK
2hldD           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAIMDELSEQDK
3fksW           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAIMDELSEQDK
3fksF           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAIMDELSEQDK
3fksN           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAIMDELSEQDK
2qe7D           LDATTNLERKLAEMGIYPAVDPLASTSRISPAVVGEEHYRVARGVQQVLQRYNDLQDIIAIMDELSDEDK
3fksD           LDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVQEHYDVASKVQETLQTYKSLQDIIAILGMDELSDK
2oblA           LDGHIVLTRELAEENHFPAIDIGLSASRVMHNVVTSEHLRAAAECKKLIATYKNLIRIGEYTMGQDPEAD
2c61A           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
3b2qA           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
2obmA           LDGHIVLTRELAEENHFPAIDIGLSASRV-----------------------------------------
3a5cD           TEGQIQLSRELHRKGIYPPIDPLPSLSRL-----------------------------------------
1fx0B           LDATTVLSRGLAAKGIYPAVDPLDSTSRIVGEEHYEIAQR----VKETLQRYKELQDIIAILDELSEEDR
1skyE           LDATTNLERKLAEMGIYPAVDPLVSTSRIVGEEHYQVARK----VQQTLERYKELQDIIAIMDELSDEDK
3eiuB           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
2dpyB           LDGHIVLSRRLAEAGHYPAIDIEASISRAMTAARVRLFKQLLSSFQ----RNRDLVSVGAYAKGSDPMLD
2dpyA           LDGHIVLSRRLAEAGHYPAIDIEASISRAMTAARVRLFKQLLSSFQ----RNRDLVSVGAYAKGSDPMLD
3b2qB           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
2rkwA           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
2c61B           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
1mabB           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAIMDELSEEDK
3eiuA           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
2f43B           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAILG-MDELSE
1ohhD           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAIMDELSEEDK
2ck3F           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAIMDELSEEDK
2ck3D           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAIMDELSEEDK
3dsrB           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
2ck3E           LDATTVLSRAIAELGIYPAVDPLDSTSRI-------MDPNIVGSEHYDVARQKILQDYKSLQDILSEEDK
2rkwB           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
2v7qE           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAIMDELSEEDK
3fksV           LD--------------------------------------------------------------------
1e79D           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAIMDELSEEDK
1h8eE           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAIMDELSEEDK
1nbmE           LDATTVLSRAIAELGIYPAVDPLDSTSRI---MDPNIVGSVARGVQKILQDYKSLQDIIAIMDELSEEDK
3dsrA           TEGQIVVARELHRKGIYPPINVLPSLSRL-----------------------------------------
3a5cA           VGAFWRLDASLAFRRHFPAIN-------------------------------------------------
1vdzA           VKVFWALDADLARRRHFPAIN-------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITK
2qe7A           AKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQ
1w0jC           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
2jizC           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKIRT
1bmfC           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
2jizA           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKIRT
2ck3C           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
2ck3A           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
1mabA           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFESAFLSHVVSQHQSLLGNIRT
2f43A           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFESAFLSHVVSQHQSLLGNIRS
1h8eC           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
1h8eA           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
1skyB           ANVARGARTVEVLKQDLHQPIPVEKQVLIIYALTRGFLDDIPVEDVRRFEKEFYLWLDQNGQHLLEHIRT
2v7qB           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKIRT
2jizB           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKIRT
1e1qB           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
2ck3B           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
2v7qC           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKID-
1fx0A           NQLARGQRLRELLKQPQSAPLTVEEQVMTIYTGTNGYLDSLELDQVRKYLVELRTYVKTNKPEFQEIISS
2r9vA           AQIIRGQRL-ELLKQEQYSP-PVEEQVVVLFAGVRGYLDDLPVEEVRRFEKEFLRF-HEKHQDILDDIXX
2hldC           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
2hldB           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
2hldA           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
3fksS           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
3fksA           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
2hldT           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
2hldS           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
2hldK           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
3fksK           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
3fksB           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
2hldJ           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
3fksU           QTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGH-DGIELSRIGEFESSFLSYLKSNHNELLTEI--
3fksT           QTLVRGERLTQLLKQNQYSPLATEEQ-VPLIYAGVGHLDGIELSRIGEFESSFLSYLKSNHNELLTEI--
2hldW           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLEG---------------
2hldO           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLEG---------------
2hldF           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLEG---------------
2hldE           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLEG---------------
2hldD           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLEG---------------
3fksW           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLEG---------------
3fksF           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLEG---------------
3fksN           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLGKY--------------
2qe7D           LIVARARKIQRFLSQ-------------------------------------------------------
3fksD           LTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRLK-DTVASFKAVLGKY--------------
2oblA           KAIKNRKLIQNFIQQSTKDISSYEKTIESLF---------------------------------------
2c61A           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2obmA           ----------------------------------------------------------------------
3a5cD           ----------------------------------------------------------------------
1fx0B           LTVARARKIERFLSQ-------------------------------------------------------
1skyE           LVVHRARRIQFFLSQ-------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2dpyB           KAITLWPQLEAFLQQ-------------------------------------------------------
2dpyA           KAITLWPQLEAFLQQ-------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2rkwA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1mabB           LTVSRARKIQRFLSQ----PFQVAE----VFTGHMGKLVPLK-ETIKGFQQILAG---------------
3eiuA           ----------------------------------------------------------------------
2f43B           ERARKIQRF--LSQPFQVAEVFTGHM--------------------------------------------
1ohhD           LTVSRARKIQRFLSQ----PFQVAE----VFTGHLGKLVPLK-ETIKGFQQILAG---------------
2ck3F           LTVSRARKIQRFLSQ----PFQVAE----VFTGHLGKLVPLK-ETIKGFQQILAG---------------
2ck3D           LTVSRARKIQRFLSQ----PFQVAE----VFTGHLGKLVPLK-ETIKGFQQILAG---------------
3dsrB           ----------------------------------------------------------------------
2ck3E           LTVSRARKIQRFLSQ----PFQVAE----VFTGHLGKLVPLK-ETIKGFQQILAG---------------
2rkwB           ----------------------------------------------------------------------
2v7qE           LTVSRARKIQRFLSQ----PFQVAE----VFTGHLGKLVPLK-ETIKGFQQILAG---------------
3fksV           ----------------------------------------------------------------------
1e79D           LTVSRARKIQRFLSQ----PFQVAE----VFTGHLGKLVPLK-ETIKGFQQILAG---------------
1h8eE           LTVSRARKIQRFLSQ----PFQVAE----VFTGHLGKLVPLK-ETIKGFQQILAG---------------
1nbmE           LTVSRARKIQRFLSQ----PFQVAE----VFTGHLGKLVPLK-ETIKGFQQILAG---------------
3dsrA           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
1vdzA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TGDYSDEIAAELRAAIENFKTTxxx
2qe7A           TGELPD--TKELDAAIEEFK-----
1w0jC           DGKISEESDAKLKEIVTNF------
2jizC           DGKISEESDAKLKEIVTNF------
1bmfC           DGKISEESDAKLKEIVTNF------
2jizA           DGKISEESDAKLKEIVTNF------
2ck3C           DGKISEESDAKLKEIVTNF------
2ck3A           DGKISEESDAKLKEIVTNF------
1mabA           DGKISEQSDAKLKEIVTNF------
2f43A           DGKISEQSDAKLKEIV---------
1h8eC           DGKISEESDAKLKEIVTNF------
1h8eA           DGKISEESDAKLKEIVTNF------
1skyB           TKDLPNE--DDLNQAIEAFKKT---
2v7qB           DGKISEESDAKLKEIVTNF------
2jizB           DGKISEESDAKLKEIVTNF------
1e1qB           DGKISEESDAKLKEIVTNF------
2ck3B           DGKISEESDAKLKEIVTNF------
2v7qC           ---------AKLKEIVTNF------
1fx0A           TKTFTEEAEALLKEAIQ--------
2r9vA           XXXXXXXXXXXXXXAIEEFKTT---
2hldC           -------------------------
2hldB           -------------------------
2hldA           -------------------------
3fksS           -------------------------
3fksA           -------------------------
2hldT           -------------------------
2hldS           -------------------------
2hldK           -------------------------
3fksK           -------------------------
3fksB           -------------------------
2hldJ           -------------------------
3fksU           -------------------------
3fksT           -------------------------
2hldW           -------------------------
2hldO           -------------------------
2hldF           -------------------------
2hldE           -------------------------
2hldD           -------------------------
3fksW           -------------------------
3fksF           -------------------------
3fksN           -------------------------
2qe7D           -------------------------
3fksD           -------------------------
2oblA           -------------------------
2c61A           -------------------------
3b2qA           -------------------------
2obmA           -------------------------
3a5cD           -------------------------
1fx0B           -------------------------
1skyE           -------------------------
3eiuB           -------------------------
2dpyB           -------------------------
2dpyA           -------------------------
3b2qB           -------------------------
2rkwA           -------------------------
2c61B           -------------------------
1mabB           -------------------------
3eiuA           -------------------------
2f43B           -------------------------
1ohhD           -------------------------
2ck3F           -------------------------
2ck3D           -------------------------
3dsrB           -------------------------
2ck3E           -------------------------
2rkwB           -------------------------
2v7qE           -------------------------
3fksV           -------------------------
1e79D           -------------------------
1h8eE           -------------------------
1nbmE           -------------------------
3dsrA           -------------------------
3a5cA           -------------------------
1vdzA           -------------------------