[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA56702.1

[Show Plain Result]


## Summary of Sequence Search
    1::214
    1::171     1e-96 100%  171 aa  APT_NITOC RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     5e-75  77%  171 aa  APT_METCA RecName: Full=Adenine phosphoribosyltransferase;       
   19::186     2e-49  52%  206 aa  APT_RHOBA RecName: Full=Adenine phosphoribosyltransferase;       
   13::173     2e-48  54%  176 aa  APT_THEFY RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-48  57%  170 aa  APT_CARHZ RecName: Full=Adenine phosphoribosyltransferase;       
    5::178     4e-48  53%  181 aa  APT_METNO RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-47  51%  170 aa  APT_KOSOT RecName: Full=Adenine phosphoribosyltransferase;       
    7::176     3e-47  54%  179 aa  APT_DINSH RecName: Full=Adenine phosphoribosyltransferase;       
    9::178     3e-47  53%  181 aa  APT_METPB RecName: Full=Adenine phosphoribosyltransferase;       
    9::178     3e-47  52%  181 aa  APT_METEP RecName: Full=Adenine phosphoribosyltransferase;       
    9::178     3e-47  52%  181 aa  APT_METC4 RecName: Full=Adenine phosphoribosyltransferase;       
    9::170     1e-46  52%  181 aa  APT_METRJ RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     1e-46  52%  175 aa  APT_FRAP2 RecName: Full=Adenine phosphoribosyltransferase;       
    6::173     1e-46  54%  173 aa  APT_CHLAA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-46  53%  170 aa  APT_CLOD6 RecName: Full=Adenine phosphoribosyltransferase;       
   10::179     2e-46  51%  181 aa  APT_ACIC5 RecName: Full=Adenine phosphoribosyltransferase;       
    7::179     3e-46  52%  185 aa  APT_RUBXD RecName: Full=Adenine phosphoribosyltransferase;       
    3::164     3e-46  50%  180 aa  APT_RHIME RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-46  49%  170 aa  APT_THELT RecName: Full=Adenine phosphoribosyltransferase;       
    9::172     4e-46  51%  172 aa  APT_HERA2 RecName: Full=Adenine phosphoribosyltransferase;       
    7::176     5e-46  51%  179 aa  APT_BRASO RecName: Full=Adenine phosphoribosyltransferase;       
    8::178     8e-46  51%  178 aa  APT_PELCD RecName: Full=Adenine phosphoribosyltransferase;       
    7::176     1e-45  50%  179 aa  APT_BRASB RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-45  52%  170 aa  APT_STRSY RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-45  52%  170 aa  APT_STRS2 RecName: Full=Adenine phosphoribosyltransferase;       
    8::164     1e-45  51%  180 aa  APT_SINMW RecName: Full=Adenine phosphoribosyltransferase;       
    5::155     1e-45  55%  181 aa  APT_METS4 RecName: Full=Adenine phosphoribosyltransferase;       
    3::176     1e-45  52%  179 aa  APT_JANSC RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     1e-45  54%  172 aa  APT_ANAVT RecName: Full=Adenine phosphoribosyltransferase;       
    1::178     2e-45  48%  181 aa  APT_RHILW RecName: Full=Adenine phosphoribosyltransferase;       
    2::165     2e-45  50%  181 aa  APT_RHILO RecName: Full=Adenine phosphoribosyltransferase;       
   18::174     2e-45  50%  190 aa  APT_RALME RecName: Full=Adenine phosphoribosyltransferase;       
   18::176     2e-45  51%  190 aa  APT_RALEH RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     2e-45  51%  187 aa  APT_YERE8 RecName: Full=Adenine phosphoribosyltransferase;       
   18::174     2e-45  52%  190 aa  APT_CUPTR RecName: Full=Adenine phosphoribosyltransferase;       
   11::182     3e-45  51%  185 aa  APT_PECCP RecName: Full=Adenine phosphoribosyltransferase;       
    2::165     3e-45  52%  181 aa  APT_MESSB RecName: Full=Adenine phosphoribosyltransferase;       
   11::182     3e-45  51%  185 aa  APT_ERWCT RecName: Full=Adenine phosphoribosyltransferase;       
    3::168     3e-45  51%  171 aa  APT_DESMR RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     4e-45  50%  171 aa  APT_GEOSM RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     4e-45  48%  171 aa  APT_GEOSL RecName: Full=Adenine phosphoribosyltransferase;       
    4::177     5e-45  48%  180 aa  APT_RHIL3 RecName: Full=Adenine phosphoribosyltransferase;       
   18::176     5e-45  50%  190 aa  APT_RALEJ RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     5e-45  53%  172 aa  APT_NOSP7 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-45  51%  171 aa  APT_GRAFK RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     5e-45  50%  171 aa  APT_GEOBB RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-45  51%  173 aa  APT2_METVS RecName: Full=Adenine phosphoribosyltransferase 2;      
    3::172     7e-45  52%  172 aa  APT_SYNY3 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     7e-45  53%  170 aa  APT_SYMTH RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  49%  170 aa  APT_STRZP RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  49%  170 aa  APT_STRR6 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  49%  170 aa  APT_STRPN RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  49%  170 aa  APT_STRPJ RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  49%  170 aa  APT_STRPI RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  49%  170 aa  APT_STRP7 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  49%  170 aa  APT_STRP2 RecName: Full=Adenine phosphoribosyltransferase;       
   10::172     7e-45  54%  178 aa  APT_RHOSK RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     7e-45  50%  171 aa  APT_GEOUR RecName: Full=Adenine phosphoribosyltransferase;       
    2::170     7e-45  50%  170 aa  APT_FLAJ1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  55%  172 aa  APT_CLOPS RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  55%  172 aa  APT_CLOPE RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-45  55%  172 aa  APT_CLOP1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     9e-45  53%  172 aa  APT_ANASP RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-44  50%  170 aa  APT_STRZT RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-44  52%  170 aa  APT_STRSV RecName: Full=Adenine phosphoribosyltransferase;       
   10::172     1e-44  54%  178 aa  APT_RHOS4 RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     1e-44  49%  171 aa  APT_GEOSF RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-44  51%  170 aa  APT_ENTFA RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     2e-44  50%  172 aa  APT_SYNP2 RecName: Full=Adenine phosphoribosyltransferase;       
   10::172     2e-44  54%  178 aa  APT_RHOS1 RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     2e-44  51%  187 aa  APT_YERPY RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     2e-44  51%  187 aa  APT_YERPS RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     2e-44  51%  187 aa  APT_YERPB RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     2e-44  51%  187 aa  APT_YERP3 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-44  49%  170 aa  APT_STRP4 RecName: Full=Adenine phosphoribosyltransferase;       
    3::168     2e-44  49%  170 aa  APT_DESAD RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     3e-44  51%  187 aa  APT_YERPP RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     3e-44  51%  187 aa  APT_YERPN RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     3e-44  51%  187 aa  APT_YERPG RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     3e-44  51%  187 aa  APT_YERPE RecName: Full=Adenine phosphoribosyltransferase;       
   12::184     3e-44  51%  187 aa  APT_YERPA RecName: Full=Adenine phosphoribosyltransferase;       
    9::167     3e-44  52%  181 aa  APT_SHELP RecName: Full=Adenine phosphoribosyltransferase;       
   25::183     3e-44  51%  197 aa  APT_RALSO RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     3e-44  50%  175 aa  APT_MARMM RecName: Full=Adenine phosphoribosyltransferase;       
    5::172     3e-44  48%  172 aa  APT_LACPL RecName: Full=Adenine phosphoribosyltransferase;       
    3::171     3e-44  51%  171 aa  APT_CLOTH RecName: Full=Adenine phosphoribosyltransferase;       
    8::169     3e-44  48%  180 aa  APT_AGRT5 RecName: Full=Adenine phosphoribosyltransferase;       
    2::173     4e-44  49%  173 aa  APT_THEP3 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-44  52%  170 aa  APT_STRGC RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_SHISS RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_SHIFL RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_SHIF8 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_SHIDS RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_SHIBS RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_SHIB3 RecName: Full=Adenine phosphoribosyltransferase;       
   27::188     4e-44  49%  199 aa  APT_RHOPB RecName: Full=Adenine phosphoribosyltransferase;       
    7::176     4e-44  49%  179 aa  APT_NITHX RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOUT RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOSM RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOSE RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOLU RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOLI RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOLC RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOL6 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOL5 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOK1 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOHS RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECODH RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECOBW RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECO8A RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECO81 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECO7I RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECO55 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECO45 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECO27 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-44  52%  183 aa  APT_ECO24 RecName: Full=Adenine phosphoribosyltransferase;       
    4::177     4e-44  47%  180 aa  APT1_RHIEC RecName: Full=Adenine phosphoribosyltransferase 1;      
    9::165     5e-44  50%  181 aa  APT_RHIGA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-44  51%  170 aa  APT_LACLA RecName: Full=Adenine phosphoribosyltransferase;       
    7::170     8e-44  51%  172 aa  APT_STRS7 RecName: Full=Adenine phosphoribosyltransferase;       
    7::170     8e-44  51%  172 aa  APT_STREM RecName: Full=Adenine phosphoribosyltransferase;       
    7::170     8e-44  51%  172 aa  APT_STRE4 RecName: Full=Adenine phosphoribosyltransferase;       
   10::172     8e-44  52%  178 aa  APT_RHOS5 RecName: Full=Adenine phosphoribosyltransferase;       
    9::178     8e-44  48%  181 aa  APT_RHOP2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     8e-44  52%  172 aa  APT_CLOBA RecName: Full=Adenine phosphoribosyltransferase;       
    7::175     8e-44  50%  181 aa  APT1_WHEAT RecName: Full=Adenine phosphoribosyltransferase 1;      
    3::170     1e-43  49%  171 aa  APT_SYNP6 RecName: Full=Adenine phosphoribosyltransferase;       
   23::195     1e-43  50%  198 aa  APT_SERP5 RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     1e-43  49%  181 aa  APT_RHOPS RecName: Full=Adenine phosphoribosyltransferase;       
    7::176     1e-43  48%  179 aa  APT_NITWN RecName: Full=Adenine phosphoribosyltransferase;       
    1::162     1e-43  51%  177 aa  APT_LEPIN RecName: Full=Adenine phosphoribosyltransferase;       
    1::162     1e-43  51%  177 aa  APT_LEPIC RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-43  51%  170 aa  APT_LACLS RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     1e-43  51%  183 aa  APT_ESCF3 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     1e-43  51%  183 aa  APT_ENT38 RecName: Full=Adenine phosphoribosyltransferase;       
    3::163     1e-43  50%  175 aa  APT_COPPD RecName: Full=Adenine phosphoribosyltransferase;       
    2::173     1e-43  48%  173 aa  APT_THEPX RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-43  49%  170 aa  APT_THENN RecName: Full=Adenine phosphoribosyltransferase;       
    3::168     1e-43  51%  170 aa  APT_THEAB RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     1e-43  51%  183 aa  APT_SALAR RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-43  51%  170 aa  APT_LACLM RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     1e-43  51%  183 aa  APT_ENTS8 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     1e-43  51%  183 aa  APT_ECO5E RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     1e-43  51%  183 aa  APT_ECO57 RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     1e-43  50%  172 aa  APT_CYAP7 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-43  51%  172 aa  APT_CLOBB RecName: Full=Adenine phosphoribosyltransferase;       
   10::181     1e-43  49%  184 aa  APT_ACISJ RecName: Full=Adenine phosphoribosyltransferase;       
    2::173     2e-43  48%  173 aa  APT_THETN RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALTY RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALSV RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALPK RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALPC RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALPB RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALPA RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALNS RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALEP RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALDC RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALCH RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     2e-43  51%  183 aa  APT_SALA4 RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-43  48%  181 aa  APT_RHOPT RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-43  48%  181 aa  APT_RHOPA RecName: Full=Adenine phosphoribosyltransferase;       
    3::168     2e-43  52%  170 aa  APT_HALOH RecName: Full=Adenine phosphoribosyltransferase;       
    7::166     2e-43  48%  182 aa  APT_BORPD RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-43  49%  172 aa  APT2_METMP RecName: Full=Adenine phosphoribosyltransferase 2;      
    3::172     3e-43  49%  172 aa  APT_CYAA5 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     3e-43  49%  172 aa  APT1_METM5 RecName: Full=Adenine phosphoribosyltransferase 1;      
    8::180     4e-43  50%  183 aa  APT_SALTI RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-43  51%  183 aa  APT_SALHS RecName: Full=Adenine phosphoribosyltransferase;       
    8::173     4e-43  51%  183 aa  APT_KLEP3 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-43  51%  170 aa  APT_FUSNN RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     4e-43  51%  183 aa  APT_CITK8 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-43  51%  170 aa  APT_BACP2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::171     5e-43  54%  172 aa  APT_SYNPW RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-43  51%  173 aa  APT_MACCJ RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-43  51%  170 aa  APT_GEOTN RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     5e-43  48%  170 aa  APT_BREBN RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-43  51%  170 aa  APT_BACA2 RecName: Full=Adenine phosphoribosyltransferase;       
    7::163     5e-43  49%  179 aa  APT_AZOC5 RecName: Full=Adenine phosphoribosyltransferase;       
   20::178     7e-43  50%  194 aa  APT_RHOFD RecName: Full=Adenine phosphoribosyltransferase;       
    1::162     7e-43  50%  177 aa  APT_LEPBL RecName: Full=Adenine phosphoribosyltransferase;       
    1::162     7e-43  50%  177 aa  APT_LEPBJ RecName: Full=Adenine phosphoribosyltransferase;       
   10::181     7e-43  49%  184 aa  APT_DIAST RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-43  46%  173 aa  APT_DESOH RecName: Full=Adenine phosphoribosyltransferase;       
    7::176     7e-43  48%  179 aa  APT_BRAJA RecName: Full=Adenine phosphoribosyltransferase;       
    8::173     9e-43  50%  183 aa  APT_KLEP7 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     9e-43  51%  170 aa  APT_GEOKA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     9e-43  51%  170 aa  APT_BACSU RecName: Full=Adenine phosphoribosyltransferase;       
    8::181     9e-43  49%  184 aa  APT_ACIAC RecName: Full=Adenine phosphoribosyltransferase;       
    2::172     1e-42  48%  172 aa  APT_PELPD RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     1e-42  48%  181 aa  APT_OCHA4 RecName: Full=Adenine phosphoribosyltransferase;       
    9::172     1e-42  48%  172 aa  APT_LACBA RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     1e-42  50%  181 aa  APT_BRUSI RecName: Full=Adenine phosphoribosyltransferase;       
    7::167     1e-42  52%  183 aa  APT_SHEPW RecName: Full=Adenine phosphoribosyltransferase;       
    1::160     1e-42  49%  176 aa  APT_ROSDO RecName: Full=Adenine phosphoribosyltransferase;       
    2::158     1e-42  54%  174 aa  APT_PHOPR RecName: Full=Adenine phosphoribosyltransferase;       
   10::173     1e-42  49%  182 aa  APT_NITSB RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-42  51%  172 aa  APT_CLOB8 RecName: Full=Adenine phosphoribosyltransferase;       
   16::175     1e-42  48%  191 aa  APT_BORPA RecName: Full=Adenine phosphoribosyltransferase;       
   16::175     1e-42  48%  191 aa  APT_BORBR RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-42  51%  170 aa  APT_ACHLI RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-42  48%  172 aa  APT2_METM7 RecName: Full=Adenine phosphoribosyltransferase 2;      
    2::170     2e-42  48%  172 aa  APT_STRTD RecName: Full=Adenine phosphoribosyltransferase;       
    2::170     2e-42  48%  172 aa  APT_STRT2 RecName: Full=Adenine phosphoribosyltransferase;       
    2::170     2e-42  48%  172 aa  APT_STRT1 RecName: Full=Adenine phosphoribosyltransferase;       
    7::167     2e-42  50%  183 aa  APT_SHEPA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-42  50%  170 aa  APT_GEOSW RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     2e-42  46%  171 aa  APT_GEOLS RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-42  49%  172 aa  APT_CLOK5 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-42  49%  172 aa  APT_CLOK1 RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-42  50%  181 aa  APT_BRUSU RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-42  50%  181 aa  APT_BRUO2 RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-42  50%  181 aa  APT_BRUME RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-42  50%  181 aa  APT_BRUC2 RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-42  50%  181 aa  APT_BRUAB RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-42  50%  181 aa  APT_BRUA2 RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     2e-42  50%  181 aa  APT_BRUA1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     3e-42  48%  172 aa  APT_STAHJ RecName: Full=Adenine phosphoribosyltransferase;       
    9::172     3e-42  51%  175 aa  APT_LACH4 RecName: Full=Adenine phosphoribosyltransferase;       
    7::167     3e-42  46%  182 aa  APT_BORA1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     3e-42  48%  170 aa  APT_THESQ RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     3e-42  48%  170 aa  APT_THEP1 RecName: Full=Adenine phosphoribosyltransferase;       
    6::173     3e-42  48%  173 aa  APT_THEMA RecName: Full=Adenine phosphoribosyltransferase;       
    7::170     3e-42  49%  172 aa  APT_STRU0 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     3e-42  47%  172 aa  APT_STRA1 RecName: Full=Adenine phosphoribosyltransferase;       
   17::184     3e-42  47%  184 aa  APT_MYXXD RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-42  47%  172 aa  APT_STRA5 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-42  47%  172 aa  APT_STRA3 RecName: Full=Adenine phosphoribosyltransferase;       
    5::172     4e-42  48%  172 aa  APT_LACS1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-42  51%  170 aa  APT_BACLD RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRPZ RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRPM RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRPF RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRPD RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRPC RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRPB RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRP8 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRP6 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRP3 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STRP1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     6e-42  48%  172 aa  APT_STAAB RecName: Full=Adenine phosphoribosyltransferase;       
    7::167     6e-42  50%  183 aa  APT_SHEHH RecName: Full=Adenine phosphoribosyltransferase;       
   24::171     6e-42  50%  196 aa  APT_METPP RecName: Full=Adenine phosphoribosyltransferase;       
    9::167     7e-42  52%  182 aa  APT_STRGB RecName: Full=Adenine phosphoribosyltransferase;       
    9::172     7e-42  48%  172 aa  APT_ROSS1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     7e-42  48%  172 aa  APT_CLOTE RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     7e-42  43%  174 aa  APT_CLOPH RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAW RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAU RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAT RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAS RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAR RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAN RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAM RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAE RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAAC RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAA9 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAA8 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAA3 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAA2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STAA1 RecName: Full=Adenine phosphoribosyltransferase;       
    5::167     1e-41  50%  181 aa  APT_SHEWM RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     1e-41  46%  174 aa  APT_NITEC RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  50%  172 aa  APT_FINM2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     1e-41  49%  172 aa  APT_CYAP8 RecName: Full=Adenine phosphoribosyltransferase;       
    5::166     1e-41  49%  181 aa  APT_AERS4 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STRPG RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-41  48%  172 aa  APT_STRMU RecName: Full=Adenine phosphoribosyltransferase;       
    5::161     1e-41  51%  178 aa  APT_STRCL RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     1e-41  50%  183 aa  APT_SALG2 RecName: Full=Adenine phosphoribosyltransferase;       
    1::162     1e-41  48%  177 aa  APT_LEPBA RecName: Full=Adenine phosphoribosyltransferase;       
   10::181     1e-41  46%  181 aa  APT_CYTH3 RecName: Full=Adenine phosphoribosyltransferase;       
   14::172     1e-41  48%  188 aa  APT_BURP8 RecName: Full=Adenine phosphoribosyltransferase;       
   11::180     1e-41  48%  182 aa  APT_ACIBL RecName: Full=Adenine phosphoribosyltransferase;       
    3::167     2e-41  51%  175 aa  APT_PARL1 RecName: Full=Adenine phosphoribosyltransferase;       
    9::172     2e-41  50%  175 aa  APT_LACAC RecName: Full=Adenine phosphoribosyltransferase;       
   16::168     2e-41  50%  188 aa  APT_BURM1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-41  48%  172 aa  APT_STAS1 RecName: Full=Adenine phosphoribosyltransferase;       
    1::168     2e-41  47%  184 aa  APT_SHESH RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     2e-41  47%  184 aa  APT_SHEB9 RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     2e-41  47%  184 aa  APT_SHEB8 RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     2e-41  47%  184 aa  APT_SHEB5 RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     2e-41  47%  184 aa  APT_SHEB2 RecName: Full=Adenine phosphoribosyltransferase;       
    5::165     2e-41  50%  181 aa  APT_SHEAM RecName: Full=Adenine phosphoribosyltransferase;       
   18::172     2e-41  56%  185 aa  APT_NOCSJ RecName: Full=Adenine phosphoribosyltransferase;       
   21::179     2e-41  47%  193 aa  APT_CHRVO RecName: Full=Adenine phosphoribosyltransferase;       
   16::174     2e-41  47%  188 aa  APT_BURXL RecName: Full=Adenine phosphoribosyltransferase;       
    5::166     2e-41  48%  181 aa  APT_AERHH RecName: Full=Adenine phosphoribosyltransferase;       
   12::163     3e-41  53%  177 aa  APT_PROAC RecName: Full=Adenine phosphoribosyltransferase;       
    6::172     3e-41  49%  175 aa  APT_LACGA RecName: Full=Adenine phosphoribosyltransferase;       
    9::172     4e-41  46%  172 aa  APT_ROSCS RecName: Full=Adenine phosphoribosyltransferase;       
    6::172     4e-41  50%  175 aa  APT_LACJO RecName: Full=Adenine phosphoribosyltransferase;       
   37::201     4e-41  48%  207 aa  APT_CORJK RecName: Full=Adenine phosphoribosyltransferase;       
    7::166     4e-41  46%  182 aa  APT_BORPE RecName: Full=Adenine phosphoribosyltransferase;       
    6::173     5e-41  46%  173 aa  APT_PETMO RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-41  47%  172 aa  APT_CLOAB RecName: Full=Adenine phosphoribosyltransferase;       
   16::174     5e-41  46%  188 aa  APT_BURPP RecName: Full=Adenine phosphoribosyltransferase;       
    5::165     5e-41  47%  181 aa  APT_ALISL RecName: Full=Adenine phosphoribosyltransferase;       
   15::176     6e-41  51%  186 aa  APT_SULNB RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     6e-41  47%  188 aa  APT_NEIM0 RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     6e-41  47%  188 aa  APT_NEIG1 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     6e-41  49%  183 aa  APT_EDWI9 RecName: Full=Adenine phosphoribosyltransferase;       
    5::165     8e-41  48%  181 aa  APT_VIBVY RecName: Full=Adenine phosphoribosyltransferase;       
    5::165     8e-41  48%  181 aa  APT_VIBVU RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     8e-41  47%  180 aa  APT_STOLO RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     8e-41  47%  184 aa  APT_SHESW RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     8e-41  47%  184 aa  APT_SHEPC RecName: Full=Adenine phosphoribosyltransferase;       
   16::168     8e-41  49%  188 aa  APT_BURS3 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     8e-41  49%  170 aa  APT_ALKMQ RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     1e-40  48%  181 aa  APT_VIBF1 RecName: Full=Adenine phosphoribosyltransferase;       
    8::169     1e-40  48%  182 aa  APT_PSEMY RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     1e-40  47%  188 aa  APT_NEIMF RecName: Full=Adenine phosphoribosyltransferase;       
    6::172     1e-40  47%  172 aa  APT_LACSS RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-40  48%  172 aa  APT_CLONN RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-40  48%  172 aa  APT_STACT RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     1e-40  48%  170 aa  APT_OCEIH RecName: Full=Adenine phosphoribosyltransferase;       
   16::185     1e-40  46%  188 aa  APT_BURCH RecName: Full=Adenine phosphoribosyltransferase;       
   16::185     1e-40  46%  188 aa  APT_BURCA RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     1e-40  49%  170 aa  APT_BACCZ RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     1e-40  49%  170 aa  APT_BACCR RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     1e-40  49%  170 aa  APT_BACC4 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     1e-40  49%  170 aa  APT_BACC2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::171     2e-40  51%  172 aa  APT_PROM3 RecName: Full=Adenine phosphoribosyltransferase;       
    8::174     2e-40  49%  183 aa  APT_PHOLL RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     2e-40  47%  180 aa  APT_MASHI RecName: Full=Adenine phosphoribosyltransferase;       
    5::177     2e-40  48%  180 aa  APT_HAEIE RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     2e-40  48%  171 aa  APT_GEOMG RecName: Full=Adenine phosphoribosyltransferase;       
   16::168     2e-40  49%  188 aa  APT_BURCM RecName: Full=Adenine phosphoribosyltransferase;       
   16::168     2e-40  49%  188 aa  APT_BURA4 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACHK RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACCQ RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACC7 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACC1 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACC0 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACAN RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACAH RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACAC RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-40  49%  170 aa  APT_BACAA RecName: Full=Adenine phosphoribosyltransferase;       
    9::160     2e-40  52%  182 aa  APT_STRAW RecName: Full=Adenine phosphoribosyltransferase;       
    3::171     2e-40  51%  172 aa  APT_PROMM RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     2e-40  47%  180 aa  APT_CRIGR RecName: Full=Adenine phosphoribosyltransferase;       
   16::168     2e-40  49%  188 aa  APT_BURCC RecName: Full=Adenine phosphoribosyltransferase;       
   17::165     3e-40  52%  181 aa  APT_VIBSL RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     3e-40  47%  172 aa  APT_STAES RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     3e-40  47%  172 aa  APT_STAEQ RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     3e-40  47%  180 aa  APT_RAT RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     3e-40  47%  180 aa  APT_MUSPA RecName: Full=Adenine phosphoribosyltransferase;       
    6::165     3e-40  49%  173 aa  APT_LISW6 RecName: Full=Adenine phosphoribosyltransferase;       
    6::165     3e-40  49%  173 aa  APT_LISMO RecName: Full=Adenine phosphoribosyltransferase;       
    6::165     3e-40  49%  173 aa  APT_LISMH RecName: Full=Adenine phosphoribosyltransferase;       
    6::165     3e-40  49%  173 aa  APT_LISMF RecName: Full=Adenine phosphoribosyltransferase;       
    6::165     3e-40  49%  173 aa  APT_LISMC RecName: Full=Adenine phosphoribosyltransferase;       
    6::165     3e-40  49%  173 aa  APT_LISIN RecName: Full=Adenine phosphoribosyltransferase;       
    1::164     3e-40  50%  177 aa  APT_IDILO RecName: Full=Adenine phosphoribosyltransferase;       
   12::173     3e-40  46%  187 aa  APT_BURP6 RecName: Full=Adenine phosphoribosyltransferase;       
   11::179     4e-40  49%  182 aa  APT_SULDN RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     4e-40  47%  180 aa  APT_MUSSI RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     4e-40  43%  179 aa  APT_METI4 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-40  46%  170 aa  APT_CYAP4 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     4e-40  49%  170 aa  APT_BACWK RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     4e-40  48%  170 aa  APT_BACCN RecName: Full=Adenine phosphoribosyltransferase;       
    8::175     4e-40  46%  177 aa  APT_ACIC1 RecName: Full=Adenine phosphoribosyltransferase;       
    9::165     5e-40  49%  181 aa  APT_VIBHB RecName: Full=Adenine phosphoribosyltransferase;       
    5::170     5e-40  46%  185 aa  APT_SHEDO RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     5e-40  44%  180 aa  APT_BUTFI RecName: Full=Adenine phosphoribosyltransferase;       
   16::168     5e-40  48%  188 aa  APT_BURVG RecName: Full=Adenine phosphoribosyltransferase;       
    7::168     7e-40  48%  183 aa  APT_SHESM RecName: Full=Adenine phosphoribosyltransferase;       
    7::168     7e-40  48%  183 aa  APT_SHESA RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     7e-40  46%  188 aa  APT_NEIMB RecName: Full=Adenine phosphoribosyltransferase;       
    5::177     7e-40  47%  180 aa  APT_HAEIN RecName: Full=Adenine phosphoribosyltransferase;       
    5::177     7e-40  47%  180 aa  APT_HAEIG RecName: Full=Adenine phosphoribosyltransferase;       
    5::177     7e-40  47%  180 aa  APT_HAEI8 RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     7e-40  47%  175 aa  APT_FRATW RecName: Full=Adenine phosphoribosyltransferase;       
    2::176     9e-40  45%  179 aa  APT_SILST RecName: Full=Adenine phosphoribosyltransferase;       
    5::165     9e-40  48%  181 aa  APT_PSYIN RecName: Full=Adenine phosphoribosyltransferase;       
    1::169     9e-40  46%  188 aa  APT_NEIMA RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     9e-40  47%  180 aa  APT_MOUSE RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     9e-40  47%  175 aa  APT_FRATT RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     9e-40  47%  175 aa  APT_FRATO RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     9e-40  47%  175 aa  APT_FRATN RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     9e-40  47%  175 aa  APT_FRATM RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     9e-40  47%  175 aa  APT_FRATH RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     9e-40  47%  175 aa  APT_FRATF RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     9e-40  47%  175 aa  APT_FRAT1 RecName: Full=Adenine phosphoribosyltransferase;       
   10::173     9e-40  49%  173 aa  APT_DESHY RecName: Full=Adenine phosphoribosyltransferase;       
    7::170     9e-40  49%  170 aa  APT_DESHD RecName: Full=Adenine phosphoribosyltransferase;       
    5::164     1e-39  51%  180 aa  APT_ACTSZ RecName: Full=Adenine phosphoribosyltransferase;       
   17::165     2e-39  50%  181 aa  APT_VIBCM RecName: Full=Adenine phosphoribosyltransferase;       
   17::165     2e-39  50%  181 aa  APT_VIBCH RecName: Full=Adenine phosphoribosyltransferase;       
   17::165     2e-39  50%  181 aa  APT_VIBC3 RecName: Full=Adenine phosphoribosyltransferase;       
    9::160     2e-39  53%  182 aa  APT_STRCO RecName: Full=Adenine phosphoribosyltransferase;       
   11::173     2e-39  48%  179 aa  APT_SILPO RecName: Full=Adenine phosphoribosyltransferase;       
    6::169     2e-39  47%  178 aa  APT_PSEA6 RecName: Full=Adenine phosphoribosyltransferase;       
    6::172     2e-39  46%  175 aa  APT_LACC3 RecName: Full=Adenine phosphoribosyltransferase;       
    2::172     2e-39  45%  172 aa  APT_ANASK RecName: Full=Adenine phosphoribosyltransferase;       
    2::172     2e-39  45%  172 aa  APT_ANAD2 RecName: Full=Adenine phosphoribosyltransferase;       
   11::174     2e-39  48%  183 aa  APT_SODGM RecName: Full=Adenine phosphoribosyltransferase;       
    7::168     2e-39  47%  183 aa  APT_SHESR RecName: Full=Adenine phosphoribosyltransferase;       
    3::159     2e-39  48%  174 aa  APT_NITEU RecName: Full=Adenine phosphoribosyltransferase;       
   12::162     2e-39  47%  187 aa  APT_BURPS RecName: Full=Adenine phosphoribosyltransferase;       
   12::162     2e-39  47%  187 aa  APT_BURP1 RecName: Full=Adenine phosphoribosyltransferase;       
   12::162     2e-39  47%  187 aa  APT_BURP0 RecName: Full=Adenine phosphoribosyltransferase;       
    2::161     3e-39  47%  175 aa  APT_NITMU RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     3e-39  45%  180 aa  APT_HUMAN RecName: Full=Adenine phosphoribosyltransferase;       
    1::179     3e-39  45%  180 aa  APT_GERCA RecName: Full=Adenine phosphoribosyltransferase;       
    6::172     3e-39  46%  175 aa  APT_LACDB RecName: Full=Adenine phosphoribosyltransferase;       
    6::172     3e-39  46%  175 aa  APT_LACDA RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     3e-39  44%  181 aa  APT_CHRSD RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     3e-39  49%  179 aa  APT_ACTPJ RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     3e-39  49%  179 aa  APT_ACTP7 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     3e-39  49%  179 aa  APT_ACTP2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     3e-39  46%  170 aa  APT_ACAM1 RecName: Full=Adenine phosphoribosyltransferase;       
    1::173     4e-39  45%  181 aa  APT_TOLAT RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     4e-39  47%  182 aa  APT_PSEPF RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     4e-39  47%  182 aa  APT_PSEFS RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     4e-39  46%  182 aa  APT_PSEF5 RecName: Full=Adenine phosphoribosyltransferase;       
    5::164     4e-39  50%  180 aa  APT_MANSM RecName: Full=Adenine phosphoribosyltransferase;       
    4::175     4e-39  47%  178 aa  APT_HELHP RecName: Full=Adenine phosphoribosyltransferase;       
    8::175     8e-39  46%  175 aa  APT_THEM4 RecName: Full=Adenine phosphoribosyltransferase;       
    2::174     8e-39  43%  182 aa  APT_SHEFN RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     8e-39  46%  170 aa  APT_FERNB RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     8e-39  46%  171 aa  APT_BACHD RecName: Full=Adenine phosphoribosyltransferase;       
    9::166     1e-38  46%  181 aa  APT_PSEHT RecName: Full=Adenine phosphoribosyltransferase;       
    3::171     1e-38  47%  171 aa  APT_CLOCE RecName: Full=Adenine phosphoribosyltransferase;       
    9::172     1e-38  47%  172 aa  APT_PEDPA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-38  44%  170 aa  APT_BRAHW RecName: Full=Adenine phosphoribosyltransferase;       
   13::163     2e-38  45%  188 aa  APT_BURTA RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     2e-38  46%  173 aa  APT_SOLUE RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-38  44%  172 aa  APT_EXIS2 RecName: Full=Adenine phosphoribosyltransferase;       
   18::165     4e-38  51%  181 aa  APT_VIBPA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-38  46%  170 aa  APT_LYSSC RecName: Full=Adenine phosphoribosyltransferase;       
    9::162     4e-38  48%  176 aa  APT_LEUMM RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-38  46%  172 aa  APT_CLOBM RecName: Full=Adenine phosphoribosyltransferase;       
   14::189     4e-38  44%  193 aa  APT_BIFLI RecName: Full=Adenine phosphoribosyltransferase;       
   73::239     4e-38  43%  243 aa  APT1_ARATH RecName: Full=Adenine phosphoribosyltransferase 1;      
    4::171     5e-38  46%  171 aa  APT_MYCMO RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-38  45%  172 aa  APT_CLOBL RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-38  45%  172 aa  APT_CLOBK RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-38  45%  172 aa  APT_CLOBH RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     5e-38  45%  172 aa  APT_CLOB1 RecName: Full=Adenine phosphoribosyltransferase;       
    6::176     6e-38  45%  180 aa  APT_MARAV RecName: Full=Adenine phosphoribosyltransferase;       
    8::165     8e-38  50%  180 aa  APT_PASMU RecName: Full=Adenine phosphoribosyltransferase;       
    3::160     8e-38  48%  171 aa  APT_GRABC RecName: Full=Adenine phosphoribosyltransferase;       
    9::162     1e-37  48%  177 aa  APT_LEUCK RecName: Full=Adenine phosphoribosyltransferase;       
    9::169     1e-37  45%  182 aa  APT_PSE14 RecName: Full=Adenine phosphoribosyltransferase;       
    8::174     1e-37  47%  183 aa  APT_PROMH RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     1e-37  46%  172 aa  APT_MICAN RecName: Full=Adenine phosphoribosyltransferase;       
    4::168     1e-37  48%  179 aa  APT_HAES2 RecName: Full=Adenine phosphoribosyltransferase;       
    4::168     1e-37  48%  179 aa  APT_HAES1 RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     1e-37  45%  171 aa  APT_BACSK RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-37  46%  172 aa  APT_ALKOO RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-37  47%  170 aa  APT_TRIEI RecName: Full=Adenine phosphoribosyltransferase;       
   14::180     2e-37  46%  182 aa  APT_RENSM RecName: Full=Adenine phosphoribosyltransferase;       
    6::179     2e-37  45%  180 aa  APT_BOVIN RecName: Full=Adenine phosphoribosyltransferase;       
   14::189     2e-37  47%  193 aa  APT_BIFAA RecName: Full=Adenine phosphoribosyltransferase;       
    3::173     2e-37  46%  173 aa  APT_UREPA RecName: Full=Adenine phosphoribosyltransferase;       
    3::173     2e-37  46%  173 aa  APT_UREP2 RecName: Full=Adenine phosphoribosyltransferase;       
    9::169     2e-37  44%  182 aa  APT_PSESM RecName: Full=Adenine phosphoribosyltransferase;       
    9::169     3e-37  44%  182 aa  APT_PSEU2 RecName: Full=Adenine phosphoribosyltransferase;       
    9::175     3e-37  44%  184 aa  APT_BLOPB RecName: Full=Adenine phosphoribosyltransferase;       
    5::168     4e-37  46%  171 aa  APT_MYCHJ RecName: Full=Adenine phosphoribosyltransferase;       
    5::168     4e-37  46%  171 aa  APT_MYCH7 RecName: Full=Adenine phosphoribosyltransferase;       
    5::168     4e-37  46%  171 aa  APT_MYCH2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     5e-37  45%  177 aa  APT_PELPB RecName: Full=Adenine phosphoribosyltransferase;       
    8::174     5e-37  46%  183 aa  APT_ERWT9 RecName: Full=Adenine phosphoribosyltransferase;       
    5::168     5e-37  48%  172 aa  APT_DESRM RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     5e-37  45%  177 aa  APT_CHLCH RecName: Full=Adenine phosphoribosyltransferase;       
    2::172     5e-37  43%  172 aa  APT_ANADE RecName: Full=Adenine phosphoribosyltransferase;       
    3::163     7e-37  45%  177 aa  APT_CHLPB RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     9e-37  45%  170 aa  APT_THEEB RecName: Full=Adenine phosphoribosyltransferase;       
    4::162     9e-37  48%  178 aa  APT_BACFN RecName: Full=Adenine phosphoribosyltransferase;       
    9::163     2e-36  46%  175 aa  APT_OENOB RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     2e-36  43%  172 aa  APT_EXISA RecName: Full=Adenine phosphoribosyltransferase;       
    5::177     2e-36  44%  177 aa  APT_ANADF RecName: Full=Adenine phosphoribosyltransferase;       
    6::172     3e-36  47%  174 aa  APT_DICNV RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     3e-36  42%  177 aa  APT_CHLTE RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     4e-36  46%  182 aa  APT_PSEAE RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     4e-36  46%  182 aa  APT_PSEAB RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     4e-36  46%  182 aa  APT_PSEA8 RecName: Full=Adenine phosphoribosyltransferase;       
    3::172     5e-36  43%  175 aa  APT_PELUB RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     5e-36  42%  174 aa  APT_EUBR3 RecName: Full=Adenine phosphoribosyltransferase;       
   12::158     5e-36  49%  183 aa  APT_BLOFL RecName: Full=Adenine phosphoribosyltransferase;       
   26::189     8e-36  46%  193 aa  APT_BIFA0 RecName: Full=Adenine phosphoribosyltransferase;       
    7::176     8e-36  43%  179 aa  APT_BEII9 RecName: Full=Adenine phosphoribosyltransferase;       
    4::166     8e-36  47%  176 aa  APT_BACTN RecName: Full=Adenine phosphoribosyltransferase;       
    3::169     1e-35  44%  171 aa  APT_RHORT RecName: Full=Adenine phosphoribosyltransferase;       
    3::169     1e-35  47%  171 aa  APT_ACICJ RecName: Full=Adenine phosphoribosyltransferase;       
    3::169     1e-35  43%  171 aa  APT_RHOCS RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     1e-35  43%  182 aa  APT_PSEU5 RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     2e-35  46%  182 aa  APT_PSEA7 RecName: Full=Adenine phosphoribosyltransferase;       
    1::171     2e-35  43%  171 aa  APT_NATTJ RecName: Full=Adenine phosphoribosyltransferase;       
    4::180     2e-35  44%  182 aa  APT_CAMFF RecName: Full=Adenine phosphoribosyltransferase;       
   19::160     2e-35  52%  187 aa  APT_PARDP RecName: Full=Adenine phosphoribosyltransferase;       
   17::172     2e-35  45%  183 aa  APT_CORK4 RecName: Full=Adenine phosphoribosyltransferase;       
   12::172     3e-35  48%  182 aa  APT_WOLSU RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     3e-35  43%  182 aa  APT_PSEST RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     3e-35  43%  177 aa  APT_PELLD RecName: Full=Adenine phosphoribosyltransferase;       
    8::177     4e-35  45%  180 aa  APT_MARMS RecName: Full=Adenine phosphoribosyltransferase;       
   22::185     5e-35  44%  190 aa  APT_TREDE RecName: Full=Adenine phosphoribosyltransferase;       
    4::162     5e-35  47%  178 aa  APT_BACFR RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     7e-35  42%  177 aa  APT_PROA2 RecName: Full=Adenine phosphoribosyltransferase;       
   20::196     9e-35  42%  200 aa  APT_SORC5 RecName: Full=Adenine phosphoribosyltransferase;       
   20::175     1e-34  52%  177 aa  APT_RHOSR RecName: Full=Adenine phosphoribosyltransferase;       
    8::174     1e-34  46%  176 aa  APT_GLUDA RecName: Full=Adenine phosphoribosyltransferase;       
    1::174     1e-34  42%  182 aa  APT_CAMJE RecName: Full=Adenine phosphoribosyltransferase;       
    4::174     1e-34  44%  182 aa  APT_CAMC1 RecName: Full=Adenine phosphoribosyltransferase;       
   14::169     1e-34  44%  193 aa  APT_BIFLO RecName: Full=Adenine phosphoribosyltransferase;       
    8::164     1e-34  46%  182 aa  APT_PSEE4 RecName: Full=Adenine phosphoribosyltransferase;       
    3::159     1e-34  45%  176 aa  APT_METFK RecName: Full=Adenine phosphoribosyltransferase;       
   12::174     1e-34  43%  182 aa  APT_CAMHC RecName: Full=Adenine phosphoribosyltransferase;       
   12::171     2e-34  49%  174 aa  APT_MYCSS RecName: Full=Adenine phosphoribosyltransferase;       
   12::171     2e-34  49%  174 aa  APT_MYCSK RecName: Full=Adenine phosphoribosyltransferase;       
   12::171     2e-34  49%  174 aa  APT_MYCSJ RecName: Full=Adenine phosphoribosyltransferase;       
   14::169     2e-34  44%  193 aa  APT_BIFLD RecName: Full=Adenine phosphoribosyltransferase;       
   11::177     3e-34  45%  179 aa  APT_GLUOX RecName: Full=Adenine phosphoribosyltransferase;       
    1::174     3e-34  41%  182 aa  APT_CAMJR RecName: Full=Adenine phosphoribosyltransferase;       
    1::174     3e-34  41%  182 aa  APT_CAMJD RecName: Full=Adenine phosphoribosyltransferase;       
    1::174     3e-34  41%  182 aa  APT_CAMJ8 RecName: Full=Adenine phosphoribosyltransferase;       
    1::174     3e-34  41%  182 aa  APT_CAMJJ RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-34  41%  175 aa  APT_CALS8 RecName: Full=Adenine phosphoribosyltransferase;       
    1::178     7e-34  41%  181 aa  APT_COLP3 RecName: Full=Adenine phosphoribosyltransferase;       
    3::164     1e-33  41%  174 aa  APT_MAGSA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-33  41%  175 aa  APT_ANATD RecName: Full=Adenine phosphoribosyltransferase;       
   20::175     2e-33  51%  177 aa  APT_RHOOB RecName: Full=Adenine phosphoribosyltransferase;       
    8::164     2e-33  45%  182 aa  APT_PSEPW RecName: Full=Adenine phosphoribosyltransferase;       
    8::164     2e-33  45%  182 aa  APT_PSEPK RecName: Full=Adenine phosphoribosyltransferase;       
    8::164     2e-33  45%  182 aa  APT_PSEPG RecName: Full=Adenine phosphoribosyltransferase;       
    8::164     2e-33  45%  182 aa  APT_PSEP1 RecName: Full=Adenine phosphoribosyltransferase;       
    8::170     2e-33  44%  187 aa  APT_ASHGO RecName: Full=Adenine phosphoribosyltransferase;       
   11::169     3e-33  41%  186 aa  APT_DEBHA RecName: Full=Adenine phosphoribosyltransferase;       
   10::178     3e-33  43%  188 aa  APT_CANAL RecName: Full=Adenine phosphoribosyltransferase;       
    9::167     4e-33  44%  188 aa  APT_SCHPO RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     4e-33  41%  177 aa  APT_CHLPD RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     5e-33  41%  177 aa  APT_CHLL2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::165     6e-33  46%  165 aa  APT_BDEBA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     1e-32  38%  170 aa  APT_MYCCT RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     1e-32  42%  177 aa  APT_PROVI RecName: Full=Adenine phosphoribosyltransferase;       
    3::160     2e-32  46%  175 aa  APT_SYNJA RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-32  39%  170 aa  APT_MYCMS RecName: Full=Adenine phosphoribosyltransferase;       
   21::180     2e-32  44%  184 aa  APT2_RHIEC RecName: Full=Adenine phosphoribosyltransferase 2;      
   22::180     2e-32  43%  182 aa  APT_SACEN RecName: Full=Adenine phosphoribosyltransferase;       
    3::174     2e-32  39%  177 aa  APT_CHLP8 RecName: Full=Adenine phosphoribosyltransferase;       
   14::178     3e-32  41%  185 aa  APT_CORGL RecName: Full=Adenine phosphoribosyltransferase;       
   16::174     3e-32  45%  182 aa  APT_CAMC5 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     4e-32  40%  170 aa  APT_MESFL RecName: Full=Adenine phosphoribosyltransferase;       
    3::171     5e-32  43%  172 aa  APT_SYNSC RecName: Full=Adenine phosphoribosyltransferase;       
   17::182     5e-32  42%  184 aa  APT_FRASN RecName: Full=Adenine phosphoribosyltransferase;       
    2::172     5e-32  44%  174 aa  APT_BACV8 RecName: Full=Adenine phosphoribosyltransferase;       
    3::166     7e-32  43%  170 aa  APT_MYCPU RecName: Full=Adenine phosphoribosyltransferase;       
    3::161     7e-32  43%  171 aa  APT_GLOVI RecName: Full=Adenine phosphoribosyltransferase;       
   22::187     7e-32  42%  189 aa  APT_FRAAA RecName: Full=Adenine phosphoribosyltransferase;       
    4::170     9e-32  41%  179 aa  APT_HAEDU RecName: Full=Adenine phosphoribosyltransferase;       
    3::171     1e-31  45%  172 aa  APT_SYNPX RecName: Full=Adenine phosphoribosyltransferase;       
   12::182     1e-31  43%  185 aa  APT_CAEEL RecName: Full=Adenine phosphoribosyltransferase;       
    7::177     2e-31  39%  177 aa  APT_SYNR3 RecName: Full=Adenine phosphoribosyltransferase;       
   14::173     2e-31  41%  185 aa  APT_CORGB RecName: Full=Adenine phosphoribosyltransferase;       
    3::180     2e-31  40%  181 aa  APT2_YEAST RecName: Full=Adenine phosphoribosyltransferase 2;      
    7::171     3e-31  44%  172 aa  APT_SYNS3 RecName: Full=Adenine phosphoribosyltransferase;       
    3::159     3e-31  43%  170 aa  APT_MYCAP RecName: Full=Adenine phosphoribosyltransferase;       
    7::175     6e-31  38%  185 aa  APT_ARCB4 RecName: Full=Adenine phosphoribosyltransferase;       
    4::172     8e-31  38%  172 aa  APT_PROM0 RecName: Full=Adenine phosphoribosyltransferase;       
    4::162     8e-31  43%  172 aa  APT_MYCPE RecName: Full=Adenine phosphoribosyltransferase;       
   12::175     8e-31  40%  176 aa  APT_BORBU RecName: Full=Adenine phosphoribosyltransferase;       
   10::165     1e-30  44%  172 aa  APT_POLSQ RecName: Full=Adenine phosphoribosyltransferase;       
   12::175     1e-30  40%  176 aa  APT_BORBZ RecName: Full=Adenine phosphoribosyltransferase;       
   26::183     1e-30  43%  185 aa  APT_ARTS2 RecName: Full=Adenine phosphoribosyltransferase;       
    3::160     2e-30  44%  175 aa  APT_SYNJB RecName: Full=Adenine phosphoribosyltransferase;       
   11::176     2e-30  42%  179 aa  APT_MYCGI RecName: Full=Adenine phosphoribosyltransferase;       
   14::160     3e-30  44%  188 aa  APT_SALAI RecName: Full=Adenine phosphoribosyltransferase;       
   11::172     5e-30  41%  184 aa  APT_CORDI RecName: Full=Adenine phosphoribosyltransferase;       
   13::184     6e-30  40%  190 aa  APT_TREPS RecName: Full=Adenine phosphoribosyltransferase;       
   13::184     6e-30  40%  190 aa  APT_TREPA RecName: Full=Adenine phosphoribosyltransferase;       
    8::171     6e-30  40%  187 aa  APT1_YEAST RecName: Full=Adenine phosphoribosyltransferase 1;      
   10::159     8e-30  43%  172 aa  APT_POLNS RecName: Full=Adenine phosphoribosyltransferase;       
   10::149     1e-29  44%  192 aa  APT2_ARATH RecName: Full=Adenine phosphoribosyltransferase 2;      
   64::192     1e-29  46%  206 aa  APT_BURMS RecName: Full=Adenine phosphoribosyltransferase;       
   64::192     1e-29  46%  206 aa  APT_BURM9 RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-29  38%  170 aa  APT_CENSY RecName: Full=Adenine phosphoribosyltransferase;       
    5::166     3e-29  39%  181 aa  APT_SHEON RecName: Full=Adenine phosphoribosyltransferase;       
    7::170     9e-29  42%  179 aa  APT_HELPJ RecName: Full=Adenine phosphoribosyltransferase;       
   21::135     1e-28  51%  186 aa  APT_XANCP RecName: Full=Adenine phosphoribosyltransferase;       
   21::135     1e-28  51%  186 aa  APT_XANCB RecName: Full=Adenine phosphoribosyltransferase;       
   21::135     1e-28  51%  186 aa  APT_XANC8 RecName: Full=Adenine phosphoribosyltransferase;       
    7::169     1e-28  42%  179 aa  APT_HELPY RecName: Full=Adenine phosphoribosyltransferase;       
    7::169     1e-28  42%  179 aa  APT_HELPS RecName: Full=Adenine phosphoribosyltransferase;       
    7::169     1e-28  42%  179 aa  APT_HELPH RecName: Full=Adenine phosphoribosyltransferase;       
    7::169     1e-28  42%  179 aa  APT_HELP2 RecName: Full=Adenine phosphoribosyltransferase;       
   21::135     2e-28  51%  186 aa  APT_XANAC RecName: Full=Adenine phosphoribosyltransferase;       
   12::159     2e-28  41%  184 aa  APT_SPHAL RecName: Full=Adenine phosphoribosyltransferase;       
    3::170     2e-28  35%  170 aa  APT_NITMS RecName: Full=Adenine phosphoribosyltransferase;       
    4::181     2e-28  41%  184 aa  APT_MYCUA RecName: Full=Adenine phosphoribosyltransferase;       
   14::177     2e-28  40%  180 aa  APT_MYCS2 RecName: Full=Adenine phosphoribosyltransferase;       
    7::169     3e-28  41%  179 aa  APT_HELPG RecName: Full=Adenine phosphoribosyltransferase;       
    2::175     5e-28  40%  178 aa  APT_ERYLH RecName: Full=Adenine phosphoribosyltransferase;       
   11::182     5e-28  39%  182 aa  APT_DROME RecName: Full=Adenine phosphoribosyltransferase;       
    4::181     6e-28  41%  184 aa  APT_MYCMM RecName: Full=Adenine phosphoribosyltransferase;       
   14::160     8e-28  41%  188 aa  APT_SALTO RecName: Full=Adenine phosphoribosyltransferase;       
    3::171     8e-28  41%  171 aa  APT_MYCFE RecName: Full=Adenine phosphoribosyltransferase;       
   21::135     1e-27  50%  186 aa  APT_XANC5 RecName: Full=Adenine phosphoribosyltransferase;       
   22::145     1e-27  48%  185 aa  APT_KINRD RecName: Full=Adenine phosphoribosyltransferase;       
    6::174     2e-27  42%  175 aa  APT_SYNS9 RecName: Full=Adenine phosphoribosyltransferase;       
    6::175     2e-27  39%  178 aa  APT_NOVAD RecName: Full=Adenine phosphoribosyltransferase;       
   10::170     2e-27  38%  182 aa  APT_YARLI RecName: Full=Adenine phosphoribosyltransferase;       
    8::166     3e-27  39%  178 aa  APT_MYCGA RecName: Full=Adenine phosphoribosyltransferase;       
    7::169     4e-27  39%  179 aa  APT_HELAH RecName: Full=Adenine phosphoribosyltransferase;       
   21::135     7e-27  50%  186 aa  APT_XANOR RecName: Full=Adenine phosphoribosyltransferase;       
   21::135     7e-27  50%  186 aa  APT_XANOP RecName: Full=Adenine phosphoribosyltransferase;       
   21::135     7e-27  50%  186 aa  APT_XANOM RecName: Full=Adenine phosphoribosyltransferase;       
    5::168     1e-26  38%  172 aa  APT_PROMA RecName: Full=Adenine phosphoribosyltransferase;       
    8::152     1e-26  40%  174 aa  APT_MYCVP RecName: Full=Adenine phosphoribosyltransferase;       
    4::172     1e-26  38%  172 aa  APT_PROM2 RecName: Full=Adenine phosphoribosyltransferase;       
   10::181     7e-26  37%  181 aa  APT_DROPS RecName: Full=Adenine phosphoribosyltransferase;       
    1::172     1e-25  35%  172 aa  APT_PROMT RecName: Full=Adenine phosphoribosyltransferase;       
    3::169     2e-25  38%  171 aa  APT_PELTS RecName: Full=Adenine phosphoribosyltransferase;       
   62::220     2e-25  42%  223 aa  APT_MYCBP RecName: Full=Adenine phosphoribosyltransferase;       
   62::220     2e-25  42%  223 aa  APT_MYCBO RecName: Full=Adenine phosphoribosyltransferase;       
   12::175     2e-25  36%  176 aa  APT_BORGA RecName: Full=Adenine phosphoribosyltransferase;       
    1::168     5e-25  37%  170 aa  APT_PROMS RecName: Full=Adenine phosphoribosyltransferase;       
   15::162     6e-25  39%  172 aa  APT_PROM4 RecName: Full=Adenine phosphoribosyltransferase;       
   10::170     6e-25  38%  187 aa  APT_KLULA RecName: Full=Adenine phosphoribosyltransferase;       
   16::186     8e-25  36%  188 aa  APT_FRASC RecName: Full=Adenine phosphoribosyltransferase;       
   62::220     1e-24  41%  223 aa  APT_MYCTU RecName: Full=Adenine phosphoribosyltransferase;       
   62::220     1e-24  41%  223 aa  APT_MYCTA RecName: Full=Adenine phosphoribosyltransferase;       
   13::170     1e-24  38%  172 aa  APT_THICR RecName: Full=Adenine phosphoribosyltransferase;       
   12::175     5e-24  34%  176 aa  APT_BORAP RecName: Full=Adenine phosphoribosyltransferase;       
    9::174     2e-23  38%  177 aa  APT_MYCA9 RecName: Full=Adenine phosphoribosyltransferase;       
    2::177     3e-23  36%  177 aa  APT_MYCPN RecName: Full=Adenine phosphoribosyltransferase;       
   28::186     3e-23  37%  192 aa  APT_COREF RecName: Full=Adenine phosphoribosyltransferase;       
    1::166     2e-22  35%  171 aa  APT_PROMP RecName: Full=Adenine phosphoribosyltransferase;       
    1::161     4e-22  34%  170 aa  APT_PROM9 RecName: Full=Adenine phosphoribosyltransferase;       
    1::172     4e-22  33%  172 aa  APT_PROM1 RecName: Full=Adenine phosphoribosyltransferase;       
    8::180     6e-22  38%  180 aa  APT_MYCGE RecName: Full=Adenine phosphoribosyltransferase;       
   21::189     7e-21  33%  191 aa  APT_CLAMS RecName: Full=Adenine phosphoribosyltransferase;       
   12::129     1e-20  42%  180 aa  APT_MYCA1 RecName: Full=Adenine phosphoribosyltransferase;       
   12::129     4e-20  41%  180 aa  APT_MYCPA RecName: Full=Adenine phosphoribosyltransferase;       
   10::173     4e-20  33%  175 aa  APT_CLAM3 RecName: Full=Adenine phosphoribosyltransferase;       
   14::138     5e-20  38%  171 aa  APT_PROM5 RecName: Full=Adenine phosphoribosyltransferase;       
    2::148     2e-18  35%  169 aa  APT_MYCS5 RecName: Full=Adenine phosphoribosyltransferase;       
    9::156     2e-14  36%  199 aa  APT_DICDI RecName: Full=Probable adenine phosphoribosyltransferase;
    1::175     1e-13  36%  190 aa  XPT_PSEU5 RecName: Full=Xanthine phosphoribosyltransferase;        
   26::177     1e-13  37%  193 aa  XPT_DEIRA RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     1e-13  39%  190 aa  XPT_PSEMY RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     1e-13  38%  198 aa  XPT_BACHD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     1e-12  36%  190 aa  XPT_PSEE4 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     1e-12  33%  194 aa  XPT_EXIS2 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     2e-12  38%  190 aa  XPT_PSEAE RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     2e-12  38%  190 aa  XPT_PSEAB RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     2e-12  38%  190 aa  XPT_PSEA8 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     2e-12  38%  190 aa  XPT_PSEA7 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     3e-12  36%  190 aa  XPT_PSEPK RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     3e-12  36%  190 aa  XPT_PSEPG RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     3e-12  36%  190 aa  XPT_PSEP1 RecName: Full=Xanthine phosphoribosyltransferase;        
   33::121     3e-12  42%  191 aa  APT_NOCFA RecName: Full=Adenine phosphoribosyltransferase;       
    1::175     4e-12  36%  189 aa  XPT_PSESM RecName: Full=Xanthine phosphoribosyltransferase;        
   46::167     6e-12  40%  193 aa  XPT_STRGC RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     6e-12  36%  189 aa  XPT_PSEU2 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     6e-12  35%  190 aa  XPT_PSEPF RecName: Full=Xanthine phosphoribosyltransferase;        
    2::167     8e-12  34%  193 aa  XPT_ENTFA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     1e-11  35%  190 aa  XPT_PSEFS RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     1e-11  33%  201 aa  XPT_BACSK RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     2e-11  36%  190 aa  XPT_PSEF5 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     3e-11  35%  189 aa  XPT_PSE14 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     5e-11  31%  193 aa  XPT_EXISA RecName: Full=Xanthine phosphoribosyltransferase;        
   31::164     7e-11  34%  188 aa  XPT_BACV8 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     9e-11  39%  193 aa  XPT_STRPN RecName: Full=Xanthine phosphoribosyltransferase;        
   31::160     9e-11  39%  162 aa  XPT_STRMT RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRZT RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRZP RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRZJ RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRR6 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRPS RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRPJ RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRPI RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRP7 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRP4 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  39%  193 aa  XPT_STRP2 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     1e-10  30%  192 aa  XPT_EUBR3 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     1e-10  36%  190 aa  XPT1_CLOBH RecName: Full=Xanthine phosphoribosyltransferase 1;     
   46::175     1e-10  36%  190 aa  XPT1_CLOB1 RecName: Full=Xanthine phosphoribosyltransferase 1;     
    1::167     1e-10  32%  194 aa  XPT_BACLD RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     3e-10  34%  190 aa  XPT_CLOB8 RecName: Full=Xanthine phosphoribosyltransferase;        
   45::174     4e-10  43%  192 aa  XPT_STRTR RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     4e-10  34%  190 aa  XPT1_CLOBL RecName: Full=Xanthine phosphoribosyltransferase 1;     
   31::167     7e-10  33%  197 aa  XPT_BACCN RecName: Full=Xanthine phosphoribosyltransferase;        
   46::165     1e-09  38%  193 aa  XPT_STRA5 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::165     1e-09  38%  193 aa  XPT_STRA3 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::165     1e-09  38%  193 aa  XPT_STRA1 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::170     1e-09  36%  193 aa  XPT_STRU0 RecName: Full=Xanthine phosphoribosyltransferase;        
   51::175     2e-09  39%  193 aa  XPT_STRSV RecName: Full=Xanthine phosphoribosyltransferase;        
   57::170     2e-09  34%  202 aa  XPT_DEIGD RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     5e-09  34%  193 aa  XPT_STAS1 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::166     5e-09  28%  190 aa  XPT_BACTN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::165     5e-09  30%  194 aa  XPT_BACA2 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     6e-09  33%  191 aa  XPT_ACIAD RecName: Full=Xanthine phosphoribosyltransferase;        
   73::247     6e-09  29%  275 aa  PURR_STRR6 RecName: Full=Pur operon repressor;
   73::247     6e-09  29%  275 aa  PURR_STRPN RecName: Full=Pur operon repressor;
   31::175     1e-08  34%  191 aa  XPT_ACIBT RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     1e-08  34%  191 aa  XPT_ACIBC RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     1e-08  34%  191 aa  XPT_ACIB5 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::175     1e-08  34%  191 aa  XPT_ACIB3 RecName: Full=Xanthine phosphoribosyltransferase;        
  105::244     1e-08  28%  285 aa  PURR_BACSU RecName: Full=Pur operon repressor;
   31::166     1e-08  28%  189 aa  XPT_BACFR RecName: Full=Xanthine phosphoribosyltransferase;        
   31::166     1e-08  28%  189 aa  XPT_BACFN RecName: Full=Xanthine phosphoribosyltransferase;        
  103::244     1e-08  29%  271 aa  PURR_LACLM RecName: Full=Pur operon repressor;
  103::244     1e-08  29%  271 aa  PURR_LACLA RecName: Full=Pur operon repressor;
   37::182     2e-08  33%  196 aa  XPT_MOOTA RecName: Full=Xanthine phosphoribosyltransferase;        
   46::162     2e-08  35%  196 aa  XPT_BREBN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     2e-08  32%  190 aa  XPT_AZOVD RecName: Full=Xanthine phosphoribosyltransferase;        
   40::160     3e-08  28%  187 aa  PYRE_METMA RecName: Full=Orotate phosphoribosyltransferase;        
   46::170     4e-08  34%  193 aa  XPT_STRS7 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::167     4e-08  31%  192 aa  XPT_STACT RecName: Full=Xanthine phosphoribosyltransferase;        
   46::167     4e-08  32%  197 aa  XPT_LACLS RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     4e-08  29%  197 aa  XPT_BACCZ RecName: Full=Xanthine phosphoribosyltransferase;        
   40::160     4e-08  29%  187 aa  PYRE_METAC RecName: Full=Orotate phosphoribosyltransferase;        
   46::171     5e-08  34%  194 aa  XPT_CLOPH RecName: Full=Xanthine phosphoribosyltransferase;        
   46::170     7e-08  34%  193 aa  XPT_STRE4 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::166     7e-08  27%  192 aa  XPT_LISMO RecName: Full=Xanthine phosphoribosyltransferase;        
   31::166     7e-08  27%  192 aa  XPT_LISMF RecName: Full=Xanthine phosphoribosyltransferase;        
   31::170     7e-08  28%  197 aa  XPT_BACWK RecName: Full=Xanthine phosphoribosyltransferase;        
   31::170     7e-08  28%  197 aa  XPT_BACCR RecName: Full=Xanthine phosphoribosyltransferase;        
   31::170     7e-08  28%  197 aa  XPT_BACC4 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::170     7e-08  28%  197 aa  XPT_BACC3 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::170     7e-08  28%  197 aa  XPT_BACC2 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::170     7e-08  28%  197 aa  XPT_BACC1 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::170     7e-08  28%  197 aa  XPT_BACAH RecName: Full=Xanthine phosphoribosyltransferase;        
   31::166     9e-08  27%  192 aa  XPT_LISMC RecName: Full=Xanthine phosphoribosyltransferase;        
   46::167     9e-08  32%  197 aa  XPT_LACLM RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     9e-08  28%  197 aa  XPT_BACHK RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     9e-08  28%  197 aa  XPT_BACCQ RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     9e-08  28%  197 aa  XPT_BACC7 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     9e-08  28%  197 aa  XPT_BACC0 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     9e-08  28%  197 aa  XPT_BACAN RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     9e-08  28%  197 aa  XPT_BACAC RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     9e-08  28%  197 aa  XPT_BACAA RecName: Full=Xanthine phosphoribosyltransferase;        
   46::167     2e-07  28%  192 aa  XPT_STAES RecName: Full=Xanthine phosphoribosyltransferase;        
   46::167     2e-07  28%  192 aa  XPT_STAEQ RecName: Full=Xanthine phosphoribosyltransferase;        
   51::167     2e-07  34%  197 aa  XPT_LACLA RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     2e-07  26%  192 aa  XPT_LACCB RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     2e-07  26%  192 aa  XPT_LACC3 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::161     2e-07  31%  194 aa  XPT_GEOTN RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     2e-07  28%  194 aa  XPT_MACCJ RecName: Full=Xanthine phosphoribosyltransferase;        
   39::171     3e-07  30%  206 aa  XPT_OENOB RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     3e-07  30%  194 aa  XPT_OCEIH RecName: Full=Xanthine phosphoribosyltransferase;        
    1::175     6e-07  33%  194 aa  XPT_BACSU RecName: Full=Xanthine phosphoribosyltransferase;        
  115::171     6e-07  42%  190 aa  XPT1_CLOPS RecName: Full=Xanthine phosphoribosyltransferase 1;     
  115::171     6e-07  42%  190 aa  XPT1_CLOPE RecName: Full=Xanthine phosphoribosyltransferase 1;     
  115::171     6e-07  42%  190 aa  XPT1_CLOP1 RecName: Full=Xanthine phosphoribosyltransferase 1;     
   57::171     8e-07  29%  190 aa  XPT_LARHH RecName: Full=Xanthine phosphoribosyltransferase;        
   46::164     8e-07  30%  190 aa  XPT_CLOTE RecName: Full=Xanthine phosphoribosyltransferase;        
    1::152     8e-07  29%  188 aa  APT_HALSA RecName: Full=Adenine phosphoribosyltransferase;       
    1::152     8e-07  29%  188 aa  APT_HALS3 RecName: Full=Adenine phosphoribosyltransferase;       
   20::171     1e-06  32%  195 aa  XPT_LACSS RecName: Full=Xanthine phosphoribosyltransferase;        
   46::176     1e-06  33%  193 aa  XPT_BIFLO RecName: Full=Xanthine phosphoribosyltransferase;        
   46::176     1e-06  33%  193 aa  XPT_BIFLD RecName: Full=Xanthine phosphoribosyltransferase;        
  115::176     1e-06  43%  193 aa  XPT_BIFAA RecName: Full=Xanthine phosphoribosyltransferase;        
   31::166     2e-06  26%  188 aa  XPT_PARD8 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::176     2e-06  33%  193 aa  XPT_BIFLI RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     2e-06  26%  191 aa  XPT_LACBA RecName: Full=Xanthine phosphoribosyltransferase;        
   67::156     2e-06  33%  210 aa  PYRE_PORGI RecName: Full=Orotate phosphoribosyltransferase;        
   42::163     2e-06  30%  193 aa  PYRE_CHLPD RecName: Full=Orotate phosphoribosyltransferase;        
   77::152     4e-06  33%  188 aa  APT_HALWD RecName: Full=Adenine phosphoribosyltransferase;       
   92::167     5e-06  33%  183 aa  APT_META3 RecName: Full=Adenine phosphoribosyltransferase;       
   46::175     6e-06  27%  192 aa  XPT_STAAW RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAAT RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAAS RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAAR RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAAN RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAAM RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAAE RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAAC RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAAB RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAA9 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAA8 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAA3 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAA2 RecName: Full=Xanthine phosphoribosyltransferase;        
   46::175     6e-06  27%  192 aa  XPT_STAA1 RecName: Full=Xanthine phosphoribosyltransferase;        
   31::167     1e-05  24%  192 aa  XPT_LACAC RecName: Full=Xanthine phosphoribosyltransferase;        
   57::163     1e-05  34%  195 aa  PYRE_SULTO RecName: Full=Orotate phosphoribosyltransferase;        
   81::185     1e-05  37%  225 aa  PYRE_ROSDO RecName: Full=Orotate phosphoribosyltransferase;        
   29::152     1e-05  26%  185 aa  APT1_METMP RecName: Full=Adenine phosphoribosyltransferase 1;      
   31::171     2e-05  24%  192 aa  XPT_LACH4 RecName: Full=Xanthine phosphoribosyltransferase;        
   83::147     2e-05  32%  201 aa  PYRE_SULNB RecName: Full=Orotate phosphoribosyltransferase;        
   42::145     2e-05  33%  190 aa  PYRE_PELTS RecName: Full=Orotate phosphoribosyltransferase;        
   46::175     2e-05  28%  190 aa  XPT_CLONN RecName: Full=Xanthine phosphoribosyltransferase;        
  115::166     2e-05  37%  190 aa  XPT2_CLOBL RecName: Full=Xanthine phosphoribosyltransferase 2;     
   56::151     2e-05  34%  185 aa  PYRE_PYRKO RecName: Full=Orotate phosphoribosyltransferase;        
   60::172     3e-05  32%  195 aa  PYREL_ARCFU RecName: Full=PyrE-like protein;
   34::128     3e-05  32%  187 aa  APT_METKA RecName: Full=Adenine phosphoribosyltransferase;       
   29::152     3e-05  27%  185 aa  APT1_METM7 RecName: Full=Adenine phosphoribosyltransferase 1;      
   30::165     4e-05  29%  188 aa  XPT_DESRM RecName: Full=Xanthine phosphoribosyltransferase;        
   81::184     4e-05  35%  226 aa  PYRE_SILST RecName: Full=Orotate phosphoribosyltransferase;        
   84::163     4e-05  32%  193 aa  PYRE_PROA2 RecName: Full=Orotate phosphoribosyltransferase;        
   60::140     4e-05  32%  193 aa  APT_METTH RecName: Full=Adenine phosphoribosyltransferase;       
   31::175     5e-05  28%  190 aa  XPT_FINM2 RecName: Full=Xanthine phosphoribosyltransferase;        
   21::108     5e-05  36%  162 aa  XGPT_CHRSD RecName: Full=Xanthine phosphoribosyltransferase;       
   46::167     7e-05  24%  193 aa  XPT_STAHJ RecName: Full=Xanthine phosphoribosyltransferase;        
   46::167     7e-05  29%  190 aa  XPT_CLOCE RecName: Full=Xanthine phosphoribosyltransferase;        
  108::147     7e-05  38%  191 aa  PYRE_CARHZ RecName: Full=Orotate phosphoribosyltransferase;        
   61::198     7e-05  27%  204 aa  PYEL2_METBF RecName: Full=PyrE-like protein 2;
   27::151     7e-05  26%  183 aa  APT_METJA RecName: Full=Adenine phosphoribosyltransferase;       
   29::152     7e-05  25%  185 aa  APT2_METM5 RecName: Full=Adenine phosphoribosyltransferase 2;      
   29::152     7e-05  24%  185 aa  APT1_METVS RecName: Full=Adenine phosphoribosyltransferase 1;      
   31::167     9e-05  24%  195 aa  XPT_LACPL RecName: Full=Xanthine phosphoribosyltransferase;        
  115::166     9e-05  35%  190 aa  XPT2_CLOBH RecName: Full=Xanthine phosphoribosyltransferase 2;     
  115::166     9e-05  35%  190 aa  XPT2_CLOB1 RecName: Full=Xanthine phosphoribosyltransferase 2;     
   29::142     9e-05  24%  193 aa  PYRE_PYRIL RecName: Full=Orotate phosphoribosyltransferase;        
   68::146     9e-05  33%  212 aa  PYRE_BACV8 RecName: Full=Orotate phosphoribosyltransferase;        
   31::162     1e-04  29%  190 aa  XPT_CLOD6 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::165     1e-04  25%  202 aa  XPT_ALKMQ RecName: Full=Xanthine phosphoribosyltransferase;        
   12::103     1e-04  31%  152 aa  XGPT_SERP5 RecName: Full=Xanthine phosphoribosyltransferase;       
  104::145     1e-04  38%  190 aa  PYRE_THETN RecName: Full=Orotate phosphoribosyltransferase;        
   67::167     1e-04  29%  212 aa  PYRE_LACJO RecName: Full=Orotate phosphoribosyltransferase;        
  202::230     1e-04  55%  280 aa  KPRS_PYRKO RecName: Full=Ribose-phosphate pyrophosphokinase;       
   31::167     2e-04  23%  192 aa  XPT_LACS1 RecName: Full=Xanthine phosphoribosyltransferase;        
   33::148     2e-04  28%  182 aa  PYRE_PYRAB RecName: Full=Orotate phosphoribosyltransferase;        
   82::147     2e-04  32%  202 aa  PYRE_SULDN RecName: Full=Orotate phosphoribosyltransferase;        
   26::148     2e-04  27%  182 aa  PYRE_PYRFU RecName: Full=Orotate phosphoribosyltransferase;        
   81::162     2e-04  38%  226 aa  PYRE_DINSH RecName: Full=Orotate phosphoribosyltransferase;        
  102::147     2e-04  35%  202 aa  PYRE_CAMHC RecName: Full=Orotate phosphoribosyltransferase;        
   86::201     2e-04  24%  207 aa  PYREL_UNCMA RecName: Full=PyrE-like protein;
   61::198     2e-04  27%  204 aa  PYEL1_METAC RecName: Full=PyrE-like protein 1;
   46::167     3e-04  24%  190 aa  XPT_PEDPA RecName: Full=Xanthine phosphoribosyltransferase;        
  102::141     3e-04  38%  187 aa  PYRE_THEMA RecName: Full=Orotate phosphoribosyltransferase;        
   81::184     3e-04  33%  225 aa  PYRE_SILPO RecName: Full=Orotate phosphoribosyltransferase;        
   81::185     3e-04  35%  232 aa  PYRE_RHOSK RecName: Full=Orotate phosphoribosyltransferase;        
   81::185     3e-04  35%  232 aa  PYRE_RHOS4 RecName: Full=Orotate phosphoribosyltransferase;        
   81::185     3e-04  35%  232 aa  PYRE_RHOS1 RecName: Full=Orotate phosphoribosyltransferase;        
   70::140     3e-04  40%  202 aa  PYRE_NITSB RecName: Full=Orotate phosphoribosyltransferase;        
   61::198     3e-04  28%  204 aa  PYREL_METMA RecName: Full=PyrE-like protein;
  204::232     3e-04  52%  287 aa  KPRS_PYRHO RecName: Full=Ribose-phosphate pyrophosphokinase;       
  113::141     4e-04  52%  189 aa  PYRE_THEGJ RecName: Full=Orotate phosphoribosyltransferase;        
  106::148     4e-04  33%  194 aa  PYRE_NOVAD RecName: Full=Orotate phosphoribosyltransferase;        
   34::156     4e-04  23%  185 aa  PYRE_METMP RecName: Full=Orotate phosphoribosyltransferase;        
  115::176     4e-04  30%  209 aa  PYRE_COXBU RecName: Full=Orotate phosphoribosyltransferase;        
   87::148     4e-04  34%  195 aa  PYRE_ACIF5 RecName: Full=Orotate phosphoribosyltransferase;        
  201::229     4e-04  52%  279 aa  KPRS_PYRFU RecName: Full=Ribose-phosphate pyrophosphokinase;       
   82::141     5e-04  30%  188 aa  PYRE_THEM4 RecName: Full=Orotate phosphoribosyltransferase;        
   66::156     5e-04  30%  209 aa  PYRE_STRSV RecName: Full=Orotate phosphoribosyltransferase;        
   66::156     5e-04  30%  209 aa  PYRE_STRGC RecName: Full=Orotate phosphoribosyltransferase;        
   68::146     5e-04  33%  212 aa  PYRE_BACTN RecName: Full=Orotate phosphoribosyltransferase;        
   68::146     5e-04  33%  212 aa  PYRE_BACFR RecName: Full=Orotate phosphoribosyltransferase;        
   68::146     5e-04  33%  212 aa  PYRE_BACFN RecName: Full=Orotate phosphoribosyltransferase;        
   89::197     5e-04  29%  203 aa  PYEL2_METAC RecName: Full=PyrE-like protein 2;
   39::103     6e-04  37%  153 aa  XGPT_PHOLL RecName: Full=Xanthine phosphoribosyltransferase;       
   41::164     6e-04  28%  216 aa  UPP_DICDI RecName: Full=Uracil phosphoribosyltransferase;       
   51::122     6e-04  39%  191 aa  PYRE_DESRM RecName: Full=Orotate phosphoribosyltransferase;        
  102::141     8e-04  35%  187 aa  PYRE_THESQ RecName: Full=Orotate phosphoribosyltransferase;        
  107::145     8e-04  38%  190 aa  PYRE_THEPX RecName: Full=Orotate phosphoribosyltransferase;        
  107::145     8e-04  38%  190 aa  PYRE_THEP3 RecName: Full=Orotate phosphoribosyltransferase;        
  102::141     8e-04  35%  187 aa  PYRE_THEP1 RecName: Full=Orotate phosphoribosyltransferase;        
  102::141     8e-04  35%  187 aa  PYRE_THENN RecName: Full=Orotate phosphoribosyltransferase;        
    1::214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPQILVYLGKASMERLKTKIRDIPDFPKPGVLFKDITPL
APT_NITOC       -------------------------------------------MERLKTKIRDIPDFPKPGVLFKDITPL
APT_METCA       -------------------------------------------MDKLRAKIRDIPDFPKPGILFRDITPL
APT_RHOBA       ----------------------------------------------LRHHVRDIPDYPKPGILFRDITPL
APT_THEFY       --------------------------------------------------VRDIPDYPQPGVVFKDITPL
APT_CARHZ       ----------------------------------------------LKKYIYDIPDFPSPGIIFRDITPL
APT_METNO       ------------------------------------------TLSALKDAIRSIPDYPKPGIVFRDITTL
APT_KOSOT       ----------------------------------------------LKDFIRDIPDFPKPGIIFKDVTPM
APT_DINSH       ----------------------------------------------LRDYIRTIPDFPHEGIMFRDVTTL
APT_METPB       ----------------------------------------------LKDSIRSIPDYPKPGIIFRDITTL
APT_METEP       ----------------------------------------------LKDSVRSIPDYPKPGIIFRDITTL
APT_METC4       ----------------------------------------------LKDSVRSIPDYPKPGIIFRDITTL
APT_METRJ       ----------------------------------------------LKESVRSIPDYPKPGIIFRDITTL
APT_FRAP2       ------------------------------------------NLDFIKDRIVAVPDFPKPGIVFRDITPL
APT_CHLAA       ----------------------------------------------LASLIRNIPDFPIPGIQFKDITTL
APT_CLOD6       ----------------------------------------------LKNFIRNIDDFPKPGIDFKDVTTL
APT_ACIC5       --------------------------------------------EPLKSLVRTVPDFPKPGILFYDITTL
APT_RUBXD       ------------------------------------------TIQVIRNRIRSVPDYPSPGVVFRDITPL
APT_RHIME       -----------------------------------------AVQSELISAIRSIPDYPKPGVMFRDITTL
APT_THELT       ----------------------------------------------LRKFIRDIPDFPFEGIIFRDVTPL
APT_HERA2       --------------------------------------------------VRNIPDFPIPGVQFKDITPL
APT_BRASO       ----------------------------------------------IKNTVRTIPDYPKPGILFRDITTL
APT_PELCD       -------------------------------------------VEDLRNVIRDIPDFPKKGIVFKDITTL
APT_BRASB       ----------------------------------------------IKNTVRTIPDYPKPGILFRDITTL
APT_STRSY       ----------------------------------------------LKDYIATIPNYPKEGIEFRDISPL
APT_STRS2       ----------------------------------------------LKDYIATIPNYPKEGIEFRDISPL
APT_SINMW       ----------------------------------------------LISAIRSIPDYPKPGVMFRDITTL
APT_METS4       ------------------------------------------TLSALKDAIRSIPDYPKPGIVFRDITTL
APT_JANSC       ------------------------------------------AQKSVRDYIRTIPDFPHDGILFRDVTTL
APT_ANAVT       ----------------------------------------------LKSLIRDIPDFPKPGILFRDITTL
APT_RHILW       --------------------------------------MDKNTTSELAASIRSIPDYPKPGIIFRDITTL
APT_RHILO       ----------------------------------------KPSLETLLASIRTIPDYPKPGILFRDITTL
APT_RALME       ----------------------------------------------LRDRIRTVPDWPQPGVMFRDITPL
APT_RALEH       ----------------------------------------------LRERIRTVPDWPMPGVMFRDITPL
APT_YERE8       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_CUPTR       ----------------------------------------------LRERIRTVPDWPQPGVMFRDITPL
APT_PECCP       --------------------------------------------ELIKNSIKSIPDYPKPGILFRDVTSL
APT_MESSB       ----------------------------------------KQSLETLLAAIRTIPDYPRPGILFRDITTL
APT_ERWCT       --------------------------------------------ELIKNSIKSIPDYPKPGILFRDVTSL
APT_DESMR       ----------------------------------------------LRQLIRDIPDYPKEGILFFDITPL
APT_GEOSM       -------------------------------------------MEDLKSIIRNIPDFPKKGILFKDITTL
APT_GEOSL       -------------------------------------------MDELKNIIRDVPDFPKKGIIFKDITTL
APT_RHIL3       ------------------------------------------TISELAASIRSIPDYPKPGIIFRDITTL
APT_RALEJ       ----------------------------------------------LRDRIRTVPDWPMPGVQFRDITPL
APT_NOSP7       ----------------------------------------------LKSLVRDIPDFPKPGILFRDITTL
APT_GRAFK       ----------------------------------------------LKSYVREIADFPKKGVSYKDITPL
APT_GEOBB       -------------------------------------------MEDLKSIIRNIPDFPKKGILFKDITTL
APT2_METVS      ----------------------------------------------LRKKIRIIDDFPKKGISFKDVTPI
APT_SYNY3       ----------------------------------------------LKALIRDIPDFPKPGIMFRDITTL
APT_SYMTH       -----------------------------------------------KSKIRTVDDFPKPGISFKDITTL
APT_STRZP       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_STRR6       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_STRPN       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_STRPJ       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_STRPI       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_STRP7       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_STRP2       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_RHOSK       --------------------------------------------------IRTIVDFPHEGILFRDVTTL
APT_GEOUR       -------------------------------------------MDELKNIIRDIPDFPKKGIIFKDITTL
APT_FLAJ1       ---------------------------------------------KIENYIRDIQGFPKEGILFKDITPL
APT_CLOPS       ----------------------------------------------LKDKIRVIEDFPKKGISFKDITTL
APT_CLOPE       ----------------------------------------------LKDKIRVIEDFPKKGISFKDITTL
APT_CLOP1       ----------------------------------------------LKDKIRVIEDFPKKGISFKDITTL
APT_ANASP       ----------------------------------------------LKSLIRDIPDFPKPGILFRDITTL
APT_STRZT       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_STRSV       ----------------------------------------------LKDYIATIENYPKEGVTFRDISPL
APT_RHOS4       --------------------------------------------------IRTIVDFPHEGILFRDVTTL
APT_GEOSF       -------------------------------------------MEELKSIIRDIPDFPKKGIIFKDITTL
APT_ENTFA       ----------------------------------------------LRDYIASIPDYPEKGIVFRDISPL
APT_SYNP2       ----------------------------------------------LKSLIRDIPDFPKPGILFRDITTL
APT_RHOS1       --------------------------------------------------IRTIVDFPHEGILFRDVTTL
APT_YERPY       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_YERPS       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_YERPB       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_YERP3       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_STRP4       ----------------------------------------------LKDYIATIENYPKEGITFRDISPL
APT_DESAD       ----------------------------------------------LRDYIRDIPDFPKEGIVYFDITPL
APT_YERPP       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_YERPN       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_YERPG       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_YERPE       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_YERPA       -------------------------------------------LKYIKDSIKTIPDYPKAGILFRDVTSL
APT_SHELP       ----------------------------------------------IKQSIKTIPDYPKPGIMFRDVTSL
APT_RALSO       ----------------------------------------------LRERIRTVPDWPQLGVMFRDITPL
APT_MARMM       ----------------------------------------------LKSAIRTIPDYPEPGIQFRDVTTL
APT_LACPL       ----------------------------------------------LKKYVASIPDYPEPGIIFRDISPL
APT_CLOTH       ----------------------------------------------LKAKLREVPDFPKEGINFIDITTV
APT_AGRT5       ----------------------------------------------LSAAIRSIPDYPKPGIIFRDITTL
APT_THEP3       ------------------------------------------TLEEIKMMIREIPDFPKKGIKFKDITPV
APT_STRGC       ----------------------------------------------LKDYIATIENYPKEGVTFRDISPL
APT_SHISS       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_SHIFL       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_SHIF8       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_SHIDS       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_SHIBS       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_SHIB3       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_RHOPB       ----------------------------------------------LKASVRTIPDYPKPGILFRDITTL
APT_NITHX       ----------------------------------------------LQASVRTIPDYPKPGVMFRDITTL
APT_ECOUT       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOSM       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOSE       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOLU       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOLI       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOLC       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOL6       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOL5       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOK1       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOHS       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECODH       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECOBW       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO8A       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO81       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO7I       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO55       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO45       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO27       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO24       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT1_RHIEC      ------------------------------------------TISELAASIRSIPDYPNPGIIFRDITTL
APT_RHIGA       ----------------------------------------------LATAIRSIPDYPKPGIIFRDITTL
APT_LACLA       ----------------------------------------------LKDYIATIENYPKEGVVFRDISPL
APT_STRS7       --------------------------------------------------IASIENYPKEGITFRDISPL
APT_STREM       --------------------------------------------------IASIENYPKEGITFRDISPL
APT_STRE4       --------------------------------------------------IASIENYPKEGITFRDISPL
APT_RHOS5       --------------------------------------------------IRTIVDFPHEGILFRDVTTL
APT_RHOP2       ----------------------------------------------LKASVRTIPDYPKPGIMFRDITTL
APT_CLOBA       ----------------------------------------------LKEKIRIIDGFPKEGISFKDITTL
APT1_WHEAT      -------------------------------------------VERIASSIRAIPNFPKPGILFQDITTL
APT_SYNP6       ----------------------------------------------LKTLIREIPDFPKPGILFRDYTTV
APT_SERP5       -------------------------------------------LQFIKDSIKTIPDYPKPGILFRDVTSL
APT_RHOPS       ----------------------------------------------LKASVRSIPDYPKPGIVFRDITTL
APT_NITWN       ----------------------------------------------LQASVRTIPDYPKPGVMFRDITTL
APT_LEPIN       -------------------------------------------MSIVKSKIRTIPDYPKPGILFRDITSL
APT_LEPIC       -------------------------------------------MSIVKSKIRTIPDYPKPGILFRDITSL
APT_LACLS       ----------------------------------------------LKDYIATIENYPKEGVVFRDISPL
APT_ESCF3       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ENT38       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_COPPD       -------------------------------------------VDDLRQYIRDIPNFPTEGVIFRDITPL
APT_THEPX       ------------------------------------------TLEEIKMMIREIPDFPKKGIKFKDITPV
APT_THENN       ----------------------------------------------LKQFIRDIPDFPQKGIIFRDITPL
APT_THEAB       ----------------------------------------------LRTFIRDIPDFPEKGIIFRDITPL
APT_SALAR       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_LACLM       ----------------------------------------------LKDYIATIENYPKEGVVFRDISPL
APT_ENTS8       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO5E       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_ECO57       -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
APT_CYAP7       ----------------------------------------------IKSLIRNIPDFPKPGIVFRDITTL
APT_CLOBB       ----------------------------------------------LKEKIRIIDGFPKEGISFKDITTL
APT_ACISJ       ----------------------------------------------LRQHIRTVPDWPAPGVQFRDITPL
APT_THETN       ------------------------------------------TLDDIKEMIREIPDFPKKGIRFKDITPV
APT_SALTY       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALSV       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALPK       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALPC       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALPB       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALPA       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALNS       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALEP       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALDC       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALCH       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALA4       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_RHOPT       ----------------------------------------------LKASVRAIPDYPKPGIIFRDITTL
APT_RHOPA       ----------------------------------------------LKASVRAIPDYPKPGIIFRDITTL
APT_HALOH       ----------------------------------------------LKKFIRDIPDFPKKGIIFKDITPL
APT_BORPD       --------------------------------------------ELIRRTIRSVPDWPRPGVVFRDITPL
APT2_METMP      ----------------------------------------------LRKKIRIVENFPIEGISFKDVTPI
APT_CYAA5       ----------------------------------------------LKGLIRDIPNFPKPGIVFRDITTL
APT1_METM5      ----------------------------------------------LRKKIRIVEDFPIEGISFKDVTPI
APT_SALTI       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_SALHS       -------------------------------------------LEFLKNSIKSIQDYPKPGILFRDVTSL
APT_KLEP3       -------------------------------------------LEYLKNSIQSIEDYPKPGILFRDVTSL
APT_FUSNN       ----------------------------------------------LKNYVASIENYPKEGIIFRDITPL
APT_CITK8       -------------------------------------------LEFLKNSIKSIHDYPKPGILFRDVTSL
APT_BACP2       ----------------------------------------------LKQYVTVVPDYPKEGVQFKDITTL
APT_SYNPW       ----------------------------------------------LRQYVRDIPDFPKPGILFRDITPL
APT_MACCJ       ----------------------------------------------LKQYITQVKDWPKPGVNFKDITTI
APT_GEOTN       ----------------------------------------------LKQYITIVPDFPKPGILFKDITTL
APT_BREBN       -----------------------------------------------KQYIRVIPDFPQPGIRFKDITTL
APT_BACA2       ----------------------------------------------LKKYVTIVPDYPKEGVQFKDITTL
APT_AZOC5       ----------------------------------------------LASVVRTIPDYPKPGVMFRDITTL
APT_RHOFD       ----------------------------------------------LRAHIRTVPDWPAPGVQFRDITPL
APT_LEPBL       -------------------------------------------MSIVKSKIRTIPDYPKPGILFRDITSL
APT_LEPBJ       -------------------------------------------MSIVKSKIRTIPDYPKPGILFRDITSL
APT_DIAST       ----------------------------------------------LRQHIRTVPDWPAPGVQFRDITPL
APT_DESOH       ----------------------------------------------LKATIRTLPNWPIEGVMFRDITTL
APT_BRAJA       ----------------------------------------------LKASVRTIPDYPKPGIMFRDITTL
APT_KLEP7       -------------------------------------------LEYLKNSIQSIEDYPKPGILFRDVTSL
APT_GEOKA       ----------------------------------------------LKQYITIVPDFPKPGIMFKDITTL
APT_BACSU       ----------------------------------------------LKQYVTIVPDYPKEGVQFKDITTL
APT_ACIAC       --------------------------------------------EYLRQYIRTVPDWPAAGVQFRDITPL
APT_PELPD       -------------------------------------------MEDLKSIIRDIPDFPKKGIVFKDITTL
APT_OCHA4       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_LACBA       --------------------------------------------------IASVPDYPEKGIMFRDISPL
APT_BRUSI       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_SHEPW       ------------------------------------------SLALIKNSIKTIPDYPKEGILFRDVTSL
APT_ROSDO       -------------------------------------------MKTVQDYIRTIVDFPHEGIMFRDVTTL
APT_PHOPR       ----------------------------------------------IRNSIKSISDYPKPGILFRDVTSL
APT_NITSB       --------------------------------------------EFLLSTIRDVPDFPKPGIVFKDITTL
APT_CLOB8       ----------------------------------------------LQEKIRVIENFPKEGISFKDITTL
APT_BORPA       --------------------------------------------ELVRRTIRSVPDWPTPGVTFRDITPV
APT_BORBR       --------------------------------------------ELVRRTIRSVPDWPTPGVTFRDITPV
APT_ACHLI       ----------------------------------------------LKAHIAAVKDFPKEGILFRDITPL
APT2_METM7      ----------------------------------------------LRKKIRIVEDFPIKGISFKDVTPI
APT_STRTD       ---------------------------------------------KLEDYIATIENYPKEGVTFRDISPL
APT_STRT2       ---------------------------------------------KLEDYIATIENYPKEGVTFRDISPL
APT_STRT1       ---------------------------------------------KLEDYIATIENYPKEGVTFRDISPL
APT_SHEPA       ------------------------------------------SLALIKNSIKTIPNYPKEGILFRDVTSL
APT_GEOSW       ----------------------------------------------LKQYVTIVPDFPKPGIMFKDITTL
APT_GEOLS       -------------------------------------------MEDLKLTIRDIPDFPKKGIIFKDITTL
APT_CLOK5       ----------------------------------------------LQDNIRIVEGFPKKGISFKDITTL
APT_CLOK1       ----------------------------------------------LQDNIRIVEGFPKKGISFKDITTL
APT_BRUSU       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_BRUO2       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_BRUME       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_BRUC2       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_BRUAB       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_BRUA2       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_BRUA1       ----------------------------------------------LKDAIRTIPDYPKPGVQFRDVTTL
APT_STAHJ       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_LACH4       --------------------------------------------------IASVKDFPNKGIVFRDITPI
APT_BORA1       --------------------------------------------EVVRRTIRSVPDWPVPGVTFRDITPV
APT_THESQ       ----------------------------------------------LKRFIRDIPDFPQKGIVFRDITPL
APT_THEP1       ----------------------------------------------LKRFIRDIPDFPQKGIVFRDITPL
APT_THEMA       ----------------------------------------------LKRFIRDIPDFPQKGIVFRDITPL
APT_STRU0       --------------------------------------------------IASIENYPKEGITFRDISPL
APT_STRA1       ----------------------------------------------LNNYIASIENYPQEGITFRDISPL
APT_MYXXD       ----------------------------------------------LNARLRDVPDFPKPGIVFKDITPV
APT_STRA5       ----------------------------------------------LNNYIASIENYPQEGITFRDISPL
APT_STRA3       ----------------------------------------------LNNYIASIENYPQEGITFRDISPL
APT_LACS1       ----------------------------------------------LRNYIASIENYPEEGIVFRDISPL
APT_BACLD       ----------------------------------------------LKKYVTIVPDYPKEGVQFKDITTL
APT_STRPZ       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRPM       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRPF       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRPD       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRPC       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRPB       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRP8       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRP6       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRP3       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRP1       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STAAB       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_SHEHH       ------------------------------------------SLALIKNSIKTIPNYPKEGILFRDVTSL
APT_METPP       ----------------------------------------------IRQTIRTVPDWPSPGVQFRDITPL
APT_STRGB       --------------------------------------------ELLASRIRDVADYPEPGVMFKDITPL
APT_ROSS1       --------------------------------------------------IRNIPDFPIPGIQFKDITPL
APT_CLOTE       ----------------------------------------------LKDKIRVIQGFPKEGISFKDVTTI
APT_CLOPH       -------------------------------------------MKKLEEYVRSIPDFPEEGIIFRDVTSV
APT_STAAW       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAAU       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAAT       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAAS       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAAR       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAAN       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAAM       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAAE       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAAC       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAA9       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAA8       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAA3       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAA2       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_STAA1       ----------------------------------------------LKQYVSEVQDWPKPGVSFKDITTI
APT_SHEWM       ------------------------------------------SLAIIKQSIKTIPDYPKPGILFRDVTSL
APT_NITEC       ----------------------------------------------IKSRIRTIPHYPREGIMFRDITTL
APT_FINM2       ----------------------------------------------LKEKIRVIDGFPKEGISFKDITTL
APT_CYAP8       ----------------------------------------------LKALIRDIPDFPKPGIMFRDITTL
APT_AERS4       ------------------------------------------TLKFIEASIKTIPDYPKPGILFRDITSL
APT_STRPG       ----------------------------------------------LTNYIASIKDYPKAGITFRDISPL
APT_STRMU       ----------------------------------------------LKNYIATIEDYPQEGVTFRDISPL
APT_STRCL       ------------------------------------------AQELLLSRIRDVPDYPQPGVVFKDITPL
APT_SALG2       -------------------------------------------LEFLKNSIKSIQDYPKLGILFRDVTSL
APT_LEPBA       -------------------------------------------MSIVKSKIRTIPDYPKPGILFRDITSL
APT_CYTH3       --------------------------------------------QTIKSTIRDIVDFPEPGIIFKDITPL
APT_BURP8       --------------------------------------------EYINSEIRTVPDWPQAGVQFRDITPL
APT_ACIBL       --------------------------------------------DSLKAYVREIPDYPKPGILFYDITTL
APT_PARL1       ----------------------------------------------VKDFIRTIPDYPKPGILFRDITTL
APT_LACAC       --------------------------------------------------IASVQDFPNKGIVFRDITPI
APT_BURM1       ----------------------------------------------IHSQIRTVPDWPQPGVMFRDITTL
APT_STAS1       ----------------------------------------------LKQYVSEVEDWPKPGVNFKDITTI
APT_SHESH       -----------------------------------MISMNNDTLAVIKQSIKTIPDYPKPGILFRDVTSL
APT_SHEB9       -----------------------------------MMAMNTETLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_SHEB8       -----------------------------------MMAMNTETLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_SHEB5       -----------------------------------MMAMNTETLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_SHEB2       -----------------------------------MMAMNTETLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_SHEAM       ------------------------------------------SLALIKQSIKTIPDYPKAGIMFRDVTSL
APT_NOCSJ       --------------------------------------------------IADVPDFPQPGILFKDITPX
APT_CHRVO       ----------------------------------------------LKGWIRTVPNWPQQGVMFRDITPL
APT_BURXL       ----------------------------------------------IKSHIRTVPDWPEPGVQFRDITPL
APT_AERHH       ------------------------------------------TLKFIEASIKTIPDYPKPGILFRDITSL
APT_PROAC       --------------------------------------------------IRDVPDFPEPGVTFKDITPL
APT_LACGA       -----------------------------------------------KEHIASVKDFPNKGIIFRDITPI
APT_ROSCS       --------------------------------------------------IRNVPDFPVPGIQFKDITPL
APT_LACJO       -----------------------------------------------KEHIASVQDFPNKGIVFRDITPI
APT_CORJK       ----------------------------------------------LRQRIRVVPDFPSRGIVFEDLTPV
APT_BORPE       --------------------------------------------ELVRRTIRSVPDWPTPGVTFRDITPV
APT_PETMO       ----------------------------------------------LKKWIRDIPDFPEKGVIFRDITPL
APT_CLOAB       ----------------------------------------------LKDSIRVIDGFPKEGISFKDVTTL
APT_BURPP       ----------------------------------------------IKSHIRTVPDWPQPGVQFRDITPL
APT_ALISL       ------------------------------------------TLELIKNSIKSVPDYPKAGIMFRDVTSL
APT_SULNB       --------------------------------------------------IRDIPDFPKPGIVFKDITTL
APT_NEIM0       ----------------------------------MLVHPEAMSVGALADKIRKIENWPQKGILFHDITPV
APT_NEIG1       ----------------------------------MLVHPEAMSVGALADKIRKIENWPQKGILFHDITPV
APT_EDWI9       -------------------------------------------LEFLKQNIKTIPDYPKPGILFRDVTSL
APT_VIBVY       ------------------------------------------TIAQIQASIKSIPDYPKPGILFRDVTSL
APT_VIBVU       ------------------------------------------TIAQIQASIKSIPDYPKPGILFRDVTSL
APT_STOLO       --------------------------------------MSEPELQLVARRIRSFPDFPVQGVLFRDISPL
APT_SHESW       -----------------------------------MMAMNTETLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_SHEPC       -----------------------------------MMAMNTETLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_BURS3       ----------------------------------------------IHSQIRTVPDWPQPGVMFRDITTL
APT_ALKMQ       ----------------------------------------------LDSKIRVIEDFPKKGISFKDITTL
APT_VIBF1       ----------------------------------------------IKNSIKSIPDYPKAGIMFRDVTSL
APT_PSEMY       ----------------------------------------------IKTLIRPVPDFPKPGVVFRDITPL
APT_NEIMF       ----------------------------------MLVHPEAMSVGALADKIRKIENWPQKGILFHDITPV
APT_LACSS       -----------------------------------------------KDYVASVPDFPEAGVTFRDISPL
APT_CLONN       ----------------------------------------------LKEKIRVIEGFPKEGISFKDITTV
APT_STACT       ----------------------------------------------LKQYVSEVQDWPKEGVDFKDITTI
APT_OCEIH       -----------------------------------------------KNYIEIVEDWPKEGIKFKDITPL
APT_BURCH       ----------------------------------------------IHSQIRTVPDWPQPGVQFRDITTL
APT_BURCA       ----------------------------------------------IHSQIRTVPDWPQPGVQFRDITTL
APT_BACCZ       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACCR       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACC4       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACC2       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_PROM3       ----------------------------------------------LRHLIQDIPDFPKPGILFRDISPL
APT_PHOLL       -------------------------------------------LQFIKDSIETIPDYPKPGVLFRDITTL
APT_MASHI       --------------------------------------MSEPELQLVARRIRSFPDFPIPGVLFRDISPL
APT_HAEIE       -------------------------------------------LDLIKSSIKSIPNYPKEGIIFRDITTL
APT_GEOMG       -------------------------------------------MDELKNIIRDIPDFPKKGIVFKDITTL
APT_BURCM       ----------------------------------------------IHSQIRTVPDWPQPGVQFRDITTL
APT_BURA4       ----------------------------------------------IHSQIRTVPDWPQPGVQFRDITTL
APT_BACHK       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACCQ       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACC7       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACC1       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACC0       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACAN       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACAH       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACAC       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACAA       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_STRAW       --------------------------------------------ELLLSRIRDVRDYPEPGVVFKDITPL
APT_PROMM       ----------------------------------------------LRHLIQDVPDFPKPGILFRDISPL
APT_CRIGR       --------------------------------------MAESELQLVAQRIRSFPDFPIPGVLFRDISPL
APT_BURCC       ----------------------------------------------IHSQIRTVPDWPQPGVQFRDITTL
APT_VIBSL       ------------------------------------------------------PDYPKAGILFRDVTSL
APT_STAES       ----------------------------------------------LKQYVSEVKDWPSAGVSFKDITTI
APT_STAEQ       ----------------------------------------------LKQYVSEVKDWPSAGVSFKDITTI
APT_RAT         --------------------------------------MSESELQLVARRIRSFPDFPIPGVLFRDISPL
APT_MUSPA       --------------------------------------MSESELKLVARRIRSFPDFPIPGVLFRDISPL
APT_LISW6       ----------------------------------------------LQDYVAIVNDWPKKGIVFKDITPL
APT_LISMO       ----------------------------------------------LQDYVAIVNDWPKKGIVFKDITPL
APT_LISMH       ----------------------------------------------LQDYVAIVNDWPKKGIVFKDITPL
APT_LISMF       ----------------------------------------------LQDYVAIVNDWPKKGIVFKDITPL
APT_LISMC       ----------------------------------------------LQDYVAIVNDWPKKGIVFKDITPL
APT_LISIN       ----------------------------------------------LQDYVAIVNDWPKKGIVFKDITPL
APT_IDILO       -------------------------------------------MESATTDIRDIPDYPKPGIIFRDITPL
APT_BURP6       -------------------------------------------VEFIHSRIRTVPDWPQPGVMFRDITPL
APT_SULDN       ----------------------------------------------IESAIRDIKDFPKPGIVFKDITTL
APT_MUSSI       --------------------------------------MSEPELKLVARRIRSFPDFPIPGVLFRDISPL
APT_METI4       -----------------------------------MTFVLSSSIERLKEKIRTIPDFPRPGVMFKDITPA
APT_CYAP4       ----------------------------------------------LKSLIREVPDFPKPGILFRDITTL
APT_BACWK       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_BACCN       -----------------------------------------------KQHIAIVPDYPKEGIVFKDITPL
APT_ACIC1       --------------------------------------------ELVAAHIRDIPDYPSPGIVFKDITPL
APT_VIBHB       ----------------------------------------------IRSSIKSIQDYPKPGILFRDVTSL
APT_SHEDO       --------------------------------------MNKDSLALIKQSIKTIADYPKPGIMFRDVTSL
APT_BUTFI       -------------------------------------------MKKVEDYIRTIPDFPEPGIMFRDVTSI
APT_BURVG       ----------------------------------------------IHSQIRTVPDWPQPGVMFRDITTL
APT_SHESM       ------------------------------------------TLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_SHESA       ------------------------------------------TLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_NEIMB       ----------------------------------MLVHPEAMSVGALADKIRKIENWPQKGILFHDITPV
APT_HAEIN       -------------------------------------------LDLIKSSIKSIPNYPKEGIIFRDITTL
APT_HAEIG       -------------------------------------------LDLIKSSIKSIPNYPKEGIIFRDITTL
APT_HAEI8       -------------------------------------------LDLIKSSIKSIPNYPKEGIIFRDITTL
APT_FRATW       ------------------------------------------NLDFIKSKIAAVPDFPKPGIMFRDITPL
APT_SILST       -----------------------------------------STSKTVKDYIRTIVDFPHEGIMFRDVTTL
APT_PSYIN       ------------------------------------------TLEEIKNCIKSIPDYPIPGIMFRDITSL
APT_NEIMA       ----------------------------------MLVHPEAMSVGALADKIRKIENWPQKGILFHDITPV
APT_MOUSE       --------------------------------------MSEPELKLVARRIRVFPDFPIPGVLFRDISPL
APT_FRATT       ------------------------------------------NLDFIKSKIAAVPDFPKPGIMFRDITPL
APT_FRATO       ------------------------------------------NLDFIKSKIAAVPDFPKPGIMFRDITPL
APT_FRATN       ------------------------------------------NLDFIKSKIAAVPDFPKPGIMFRDITPL
APT_FRATM       ------------------------------------------NLDFIKSKIAAVPDFPKPGIMFRDITPL
APT_FRATH       ------------------------------------------NLDFIKSKIAAVPDFPKPGIMFRDITPL
APT_FRATF       ------------------------------------------NLDFIKSKIAAVPDFPKPGIMFRDITPL
APT_FRAT1       ------------------------------------------NLDFIKSKIAAVPDFPKPGIMFRDITPL
APT_DESHY       --------------------------------------------------IRVIDDFPKPGISFKDITTL
APT_DESHD       --------------------------------------------------IRVIDDFPKPGISFKDITTL
APT_ACTSZ       -------------------------------------------LDLIKSSIKSIPNYPKEGIIFRDITSL
APT_VIBCM       ------------------------------------------------------PDYPKKGILFRDVTSL
APT_VIBCH       ------------------------------------------------------PDYPKKGILFRDVTSL
APT_VIBC3       ------------------------------------------------------PDYPKKGILFRDVTSL
APT_STRCO       --------------------------------------------ELLLSRIRDVADYPEPGVVFKDITPL
APT_SILPO       --------------------------------------------------IRTIVDFPHEGILFRDVTTL
APT_PSEA6       ----------------------------------------------IKSVIKTVPDYPKPGILFRDVTSI
APT_LACC3       -----------------------------------------------KDYIASVQDYPEPGIIFRDISPL
APT_ANASK       -------------------------------------------MDAVRARIRDVPDFPKKGIVFKDITPV
APT_ANAD2       -------------------------------------------MDAVRARIRDVPDFPKKGIVFKDITPV
APT_SODGM       ----------------------------------------------IKQSIKSVPDYPKPGILFRDVTSL
APT_SHESR       ------------------------------------------TLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_NITEU       ----------------------------------------------IKSRIRTIPHYPHEGIMFRDITTL
APT_BURPS       -------------------------------------------VEFIHSRIRTVPDWPQPGVMFRDITPL
APT_BURP1       -------------------------------------------VEFIHSRIRTVPDWPQPGVMFRDITPL
APT_BURP0       -------------------------------------------VEFIHSRIRTVPDWPQPGVMFRDITPL
APT_NITMU       ---------------------------------------------QIKSRIRTIAHYPHEGIMFRDITTL
APT_HUMAN       --------------------------------------MADSELQLVEQRIRSFPDFPTPGVVFRDISPV
APT_GERCA       --------------------------------------MAEPELQLVARRIRSFPDFPIPGVLFRDISPL
APT_LACDB       -----------------------------------------------KKYIASVKDFPNEGIIFRDITPI
APT_LACDA       -----------------------------------------------KKYIASVKDFPNEGIIFRDITPI
APT_CHRSD       ----------------------------------------------IKSVIRTVPDWPQPGVNFRDITPV
APT_ACTPJ       -------------------------------------------LDLIKSSIKSIPDYPKAGIIFRDITSL
APT_ACTP7       -------------------------------------------LDLIKSSIKSIPDYPKAGIIFRDITSL
APT_ACTP2       -------------------------------------------LDLIKSSIKSIPDYPKAGIIFRDITSL
APT_ACAM1       ----------------------------------------------LKSLIRDIPDFPKPGILFRDITTL
APT_TOLAT       --------------------------------------MNRNTLDFIQSCIATIPDYPKPGIIFRDVTSL
APT_PSEPF       ----------------------------------------------IKSLIRPVIDFPKPGVIFRDITPL
APT_PSEFS       ----------------------------------------------IKSLIRPVIDFPKPGVIFRDITPL
APT_PSEF5       ----------------------------------------------IKSLIRPVIDFPKPGVIFRDITPL
APT_MANSM       -------------------------------------------LQLIKSSIKSIPNHPKEGIIFRDITSL
APT_HELHP       --------------------------------------------QKIADSIRAVYNY-KPGVIFRDITTL
APT_THEM4       ----------------------------------------------LKKFIRDIPDFPEKGIIFRDITPL
APT_SHEFN       --------------------------------------MNQDSLALIKQSIKTIPDYPIPGIMFRDVTSL
APT_FERNB       ----------------------------------------------LKNFIRDIPDFPQKGVMFRDITPL
APT_BACHD       -----------------------------------------------KQHITIVENFPKEGIRFKDITTL
APT_PSEHT       ----------------------------------------------IKNSITTIADYPKAGIMFRDVTTL
APT_CLOCE       ----------------------------------------------LKDKLRHVMDFPKEGIDFIDITTV
APT_PEDPA       --------------------------------------------------VASIQDFPEKGVTFRDISPL
APT_BRAHW       ----------------------------------------------LKDYIRNIQDYPKKGILFRDITTL
APT_BURTA       -------------------------------------------VEFIHSRIRTVPNWPQPGVMFRDITPL
APT_SOLUE       -------------------------------------------MPDLKSLIREVPDFPKPGILFYDITTL
APT_EXIS2       -----------------------------------------------KQHIKEVENWPKEGISFKDITSL
APT_VIBPA       -------------------------------------------------------DYPKPGILFRDVTSL
APT_LYSSC       ----------------------------------------------LKQYVTTVENWPKEGITFRDITTI
APT_LEUMM       --------------------------------------------------VATVEDYPEPGVSFRDISPL
APT_CLOBM       ----------------------------------------------LKEHIRVIENFPKEGISFKDVTTI
APT_BIFLI       --------------------------------------VGRQDAEYLVSLVRSIPGFPKEGIIFRDFIPV
APT1_ARATH      ---------------------------------------------KIASSIRVIPDFPKPGIMFQDITTL
APT_MYCMO       -------------------------------------------LNELKKYIQDVKDFPIKGIVFKDISPL
APT_CLOBL       ----------------------------------------------LKEHIRVIENFPKEGISFKDVTTI
APT_CLOBK       ----------------------------------------------LKEHIRVIENFPKEGISFKDVTTI
APT_CLOBH       ----------------------------------------------LKEHIRVIENFPKEGISFKDVTTI
APT_CLOB1       ----------------------------------------------LKEHIRVIENFPKEGISFKDVTTI
APT_MARAV       --------------------------------------------ESIKKAIRTVPDWPKPGVSFRDITTV
APT_PASMU       ----------------------------------------------IKSSIKSIPNHPKEGIIFRDITSL
APT_GRABC       ----------------------------------------------LKKYIRDIPDFPKPGILFHDISTL
APT_LEUCK       --------------------------------------------------VATVENFPEPGVNFRDISPL
APT_PSE14       -----------------------------------------------KSLIRPVIDFPKPGVVFRDITPL
APT_PROMH       -------------------------------------------LQFIKDSIETIPDYPKEGILFRDITTL
APT_MICAN       ----------------------------------------------LKSLIRDIPDFPKPGIVFRDITTL
APT_HAES2       -------------------------------------------LELIKSSIKSIPNHPKEGIIFRDITSL
APT_HAES1       -------------------------------------------LELIKSSIKSIPNHPKEGIIFRDITSL
APT_BACSK       -----------------------------------------------KQYITIVEDWPQEGIRFKDITTL
APT_ALKOO       ----------------------------------------------LKSKIRQIEGFPKEGISFKDITTV
APT_TRIEI       ----------------------------------------------LKNLIREIPNFPKSGIIFRDITTL
APT_RENSM       --------------------------------------------EQIQRLCATVPDYPEPGITFRDLTPV
APT_BOVIN       -------------------------------------------LQLVARRIRSFPNFPIPGVLFRDISPV
APT_BIFAA       --------------------------------------VGAEDAAYLVSKIRTIPGFPKEGILFRDFMPV
APT_UREPA       ------------------------------------------NIDYIKSKIRDVPDFPKKGIVFKDITPL
APT_UREP2       ------------------------------------------NIDYIKSKIRDVPDFPKKGIVFKDITPL
APT_PSESM       -----------------------------------------------KSLIRPVVDFPKPGVVFRDITPL
APT_PSEU2       -----------------------------------------------KSLIRPVVDFPKPGVVFRDITPL
APT_BLOPB       -------------------------------------------LELIKKSIQFVPNYPKKGILFRDITEL
APT_MYCHJ       ----------------------------------------------LEKYIRTVEDFPKKGISFKDISPL
APT_MYCH7       ----------------------------------------------LEKYIRTVEDFPKKGISFKDISPL
APT_MYCH2       ----------------------------------------------LEKYIRTVEDFPKKGISFKDISPL
APT_PELPB       ----------------------------------------------IKSRIRSIPDYPKKGILFRDITTL
APT_ERWT9       -------------------------------------------LEFLKNSIQSIPDYPKPGILFRDVTSL
APT_DESRM       ------------------------------------------------SKIRLIKDFPKPGINFRDITTL
APT_CHLCH       ----------------------------------------------IKSRIRSIPDYPKKGIMFRDITTL
APT_ANADE       -------------------------------------------MDAVRARIRDVPDFPKKGIVFKDITPV
APT_CHLPB       ----------------------------------------------IKSRIRTIPDYPKKGIMFRDITTL
APT_THEEB       ----------------------------------------------LKSLIRDVPDFPKPGILFRDLTTL
APT_BACFN       ------------------------------------------SKEKLIKSIREVPDFPIPGILFYDVTTL
APT_OENOB       --------------------------------------------------IATTPDFPEKGVMFRDINPL
APT_EXISA       -----------------------------------------------KQHIKEVADYPKEGISFKDITSL
APT_ANADF       -----------------------------------------AAMEAVRARIRDVPDFPQKGIVFKDITPV
APT_DICNV       -----------------------------------------------KNLIINIPDYPKAGINFKDITPL
APT_CHLTE       ----------------------------------------------IKSRIRTVPDYPKKGIMFRDITTL
APT_PSEAE       ----------------------------------------------LKSQIRAVPDFPKPGVVFRDITPL
APT_PSEAB       ----------------------------------------------LKSQIRAVPDFPKPGVVFRDITPL
APT_PSEA8       ----------------------------------------------LKSQIRAVPDFPKPGVVFRDITPL
APT_PELUB       ----------------------------------------------LKDYIRSIPDYPKKGILFRDITTL
APT_EUBR3       -------------------------------------------MKTVKDYIRTIPDFPEKGIMFRDVTSV
APT_BLOFL       ----------------------------------------------IKENIKFIPNYPKQGILFRDITAL
APT_BIFA0       --------------------------------------------------IRTVPDFPREGILFRDFMPV
APT_BEII9       ----------------------------------------------LKSAIRTISNYPKPGIEFRDITTL
APT_BACTN       ------------------------------------------SKETLIKSIREIPDFPIPGILFYDVTTL
APT_RHORT       ----------------------------------------------LKDHIREVPDFPKPGILFYDISTL
APT_ACICJ       ----------------------------------------------LKDHIRGIPDFPKPGILFYDISTL
APT_RHOCS       ----------------------------------------------IRSHIRTVPDFPKPGILFYDISTL
APT_PSEU5       ----------------------------------------------IKTLIRPVPDFPRPGVIFRDITPL
APT_PSEA7       ----------------------------------------------LKSQIRAVPDFPKAGVVFRDITPL
APT_NATTJ       -------------------------------------------MLKLRDYIRDIPDFPKKGVVFKDITTA
APT_CAMFF       --------------------------------------LSKFDKEYLLGTIRDIKNFPKPGIIFKDITTL
APT_PARDP       --------------------------------------------------IRTIVDFPHEGILFRDVTTL
APT_CORK4       --------------------------------------------------VRRVPGFPSEGVVFEDLTPV
APT_WOLSU       ----------------------------------------------LLDSIRNIPDFPKPGIQFKDITTL
APT_PSEST       ----------------------------------------------IKTLIRPVQDFPRPGVVFRDITPL
APT_PELLD       ----------------------------------------------IKSRIRAIPDYPKKGIMFRDITTL
APT_MARMS       ----------------------------------------------VKSLIQTIEDWPKQGISFRDITPI
APT_TREDE       --------------------------------------------------IRRVPDFPKKGILFYDITGI
APT_BACFR       ------------------------------------------SKEKLIKSIREIPDFPIPGILFYDVTTL
APT_PROA2       ----------------------------------------------IKSRIRTIPDYPKKGIMFRDITTL
APT_SORC5       ------------------------------------------ALRYLKAHLRNVPDFPKPGILFKDITPL
APT_RHOSR       -------------------------------------------------------DFPQPGVRFADLTPV
APT_GLUDA       ----------------------------------------------LKQHIRGIPDFPKPGILFYDISTL
APT_CAMJE       -----------------------------------MIKLTQEEQKYLLDSIRIIPDFPKKGIIFRDITTL
APT_CAMC1       --------------------------------------LDQKGKEFLLNSIRCINDFPKPGIVFRDITTL
APT_BIFLO       --------------------------------------VGQQDAEYLVSLVRSVPGFPKEGIIFRDFMPV
APT_PSEE4       ----------------------------------------------LKALIRPVVDFPKPGVIFRDITPL
APT_METFK       ----------------------------------------------IKSLIRTIPDYPKPGIQFRDITTL
APT_CAMHC       ----------------------------------------------LLSTIRDVKDFPKPGIIFKDITTL
APT_MYCSS       --------------------------------------------------MREVPDFPEPGIQFKDLTPL
APT_MYCSK       --------------------------------------------------MREVPDFPEPGIQFKDLTPL
APT_MYCSJ       --------------------------------------------------MREVPDFPEPGIQFKDLTPL
APT_BIFLD       --------------------------------------VGQQDAEYLVSLVRSVPGFPKEGIIFRDFMPV
APT_GLUOX       ----------------------------------------------LKNYIREIPDFPKRGILFYDISTL
APT_CAMJR       -----------------------------------MIKLTQEEQKYLLDSIRIIPDFPKKGIIFRDITTL
APT_CAMJD       -----------------------------------MIKLTQEEQKYLLDSIRIIPDFPKKGIIFRDITTL
APT_CAMJ8       -----------------------------------MIKLTQEEQKYLLDSIRIIPDFPKKGIIFRDITTL
APT_CAMJJ       -----------------------------------MIKLTQEEQKYLFDSIRIIPDFPKKGIIFRDITTL
APT_CALS8       ----------------------------------------------LKEKFRHVLNFPKEGIDFIDITTV
APT_COLP3       --------------------------------------MNKTQQQLLINAIHTIPDYPVEGIMFRDVTSL
APT_MAGSA       ----------------------------------------------IKDHIRGVPDFPKPGILFYDISTL
APT_ANATD       ----------------------------------------------LKEKFRHVLNFPKEGIDFIDITTV
APT_RHOOB       -------------------------------------------------------DFPQPGVRFADLTPV
APT_PSEPW       ----------------------------------------------LKALIRPVVDFPKPGVIFRDITPL
APT_PSEPK       ----------------------------------------------LKALIRPVVDFPKPGVIFRDITPL
APT_PSEPG       ----------------------------------------------LKALIRPVVDFPKPGVIFRDITPL
APT_PSEP1       ----------------------------------------------LKALIRPVVDFPKPGVIFRDITPL
APT_ASHGO       --------------------------------------------KELKAALAQYPNFPKEGVLFEDFLPI
APT_DEBHA       --------------------------------------------KEIRASLKQFPNFPSEGILFEDFLPV
APT_CANAL       -----------------------------------------ALAKELKANLKQFPNFPKEGILFEDFLPI
APT_SCHPO       ----------------------------------------------LKNKLVQYPDFPKKGILFEDIMPI
APT_CHLPD       ----------------------------------------------IKSRIRSIPDYPKKGIMFRDITTL
APT_CHLL2       ----------------------------------------------IKSRIRSIPDYPKKGIMFRDITTL
APT_BDEBA       ----------------------------------------------LKSLIRDVPDFPKPGIIFRDMSPL
APT_MYCCT       ----------------------------------------------LKEFVVDVKDFPQKGIIFKDITPL
APT_PROVI       ----------------------------------------------IKSRIRAIPDYPKKGIMFRDITTL
APT_SYNJA       ----------------------------------------------LRAFIRLVPDFPKPGILFRDITPL
APT_MYCMS       ----------------------------------------------LKEFVVDVKDFPKQGIVFKDITPL
APT2_RHIEC      --------------------------------------------------LREFPNFPIGGILFKDIAPM
APT_SACEN       --------------------------------------------------VREVPDFPEPGVLFRDISPM
APT_CHLP8       ----------------------------------------------IKSRIRTVPDYPKKGIMFRDITTL
APT_CORGL       --------------------------------------------EALDKKTRYVQDFPEKGVLFEDLTPV
APT_CAMC5       --------------------------------------------------IRAIKDFPKPGIVFRDITTL
APT_MESFL       ----------------------------------------------LKKHILNVKDFPIDGIDFKDVTPL
APT_SYNSC       ----------------------------------------------LQSHIRSIPDFPKPGILFRDINPL
APT_FRASN       ----------------------------------------------LGAHVRDVMDFPKPGVVFKDITPL
APT_BACV8       ------------------------------------------SKETLKANLREIPDFPIPGILFYDVTTL
APT_MYCPU       ----------------------------------------------LEKFIKDVKDFPKQGINFKDISPL
APT_GLOVI       ----------------------------------------------LKDYIRTVPDFPEPGILFRDITTL
APT_FRAAA       ----------------------------------------------LRGHIRDIQDWPQPGVVFKDITPL
APT_HAEDU       -------------------------------------------LDLIKSSIKSIPNYPKVGIIFRDITSL
APT_SYNPX       ----------------------------------------------LQTYIRSIPDFPKPGILFRDINPL
APT_CAEEL       ---------------------------------------------KIEQHIREVKDFPKKGINFRDIMPL
APT_SYNR3       --------------------------------------------QQLRALVRDVPDFPKPGILFRDLTPV
APT_CORGB       --------------------------------------------EALDKKTRYVQDFPEKGVLFEDLTPV
APT2_YEAST      --------------------------------------ISESYAKEIKTAFRQFTDFPIEGEQFEDFLPI
APT_SYNS3       --------------------------------------------------VQDIPDFPKPGILFRDISPM
APT_MYCAP       ----------------------------------------------LKKYIRDVKNFPKPGILFKDISPL
APT_ARCB4       --------------------------------------LDENSKNILLDSIRTINDYPKPGIIFKDITTL
APT_PROM0       --------------------------------------------KNLKNTIKSYPDFPKKGILFRDILPV
APT_MYCPE       --------------------------------------------EEIKNTIATIEDFPKKGISFKDITPL
APT_BORBU       --------------------------------------------------ISKIPNFPKKGVLFYDITSV
APT_POLSQ       -----------------------------------------------------VPDFPKPGILFRDISPL
APT_BORBZ       --------------------------------------------------ISKIPNFPKKGVLFYDITSV
APT_ARTS2       -----------------------------------------------------VPDYPKPGIIFKDLTPV
APT_SYNJB       ----------------------------------------------LRALIRLVPDFPRPGILFRDMTPL
APT_MYCGI       --------------------------------------------EVIRSLMREVPDFPEPGVHFKDLTPV
APT_SALAI       ---------------------------------------GRAVAERVASRVLDVPDFPKPGVMFKDLMPL
APT_CORDI       --------------------------------------------EAIACKTRFVPDFPVPGVIFEDLTPV
APT_TREPS       ---------------------------------------GHAALDRA---IRKRIDFPKKGILYYDITGV
APT_TREPA       ---------------------------------------GHAALDRA---IRKRIDFPKKGILYYDITGV
APT1_YEAST      --------------------------------------------QELKLALHQYPNFPSEGILFEDFLPI
APT_POLNS       -----------------------------------------------------VPDFPKPGVLFRDISPL
APT2_ARATH      ---------------------------------------GDPRLKAISDAIRVIPHFPKTGIMFQDITTL
APT_BURMS       ----------------------------------------------------------------------
APT_BURM9       ----------------------------------------------------------------------
APT_CENSY       ----------------------------------------------LEAMLASYPDFPKKGVLFKDIGPI
APT_SHEON       ------------------------------------------TLSLIKQSIKTIPNYPKEGILFRDVTSL
APT_HELPJ       --------------------------------------------EELLQSIREVKDYPKKGILFKDITTL
APT_XANCP       -------------------------------------------------RIRDIADFPKPGIVFKDITPL
APT_XANCB       -------------------------------------------------RIRDIADFPKPGIVFKDITPL
APT_XANC8       -------------------------------------------------RIRDIADFPKPGIVFKDITPL
APT_HELPY       --------------------------------------------EELLQSIREVKDYPKKGILFKDITTL
APT_HELPS       --------------------------------------------EELLQSIREVKDYPKKGILFKDITTL
APT_HELPH       --------------------------------------------EELLQSIREVKDYPKKGILFKDITTL
APT_HELP2       --------------------------------------------EELLQSIREVKDYPKKGILFKDITTL
APT_XANAC       -------------------------------------------------RIRDIVDFPKPGIVFKDITPL
APT_SPHAL       ----------------------------------------------LASLVRTIPDFPRPGIQFRDITTL
APT_NITMS       ----------------------------------------------LRDKIAEYPNFPKKGILFRDFSPI
APT_MYCUA       -----------------------------------LVVTGRGSADLISSLTRDVADFPKPGIQFKDLTPL
APT_MYCS2       ----------------------------------------------IATLTREVADFPEPGIQFKDLTPL
APT_HELPG       --------------------------------------------EELLQSIREVKDYPKKGILFKDITTL
APT_ERYLH       ------------------------------------------TVEELKALIRTVPDFPAPGIQFRDITTL
APT_DROME       -------------------------------------------LDYVKSKIGEYPNFPKEGILFRDIFGA
APT_MYCMM       -----------------------------------LVVTGRGSADLISSLTRDVADFPKPGIQFKDLTPL
APT_SALTO       ---------------------------------------GRETAELVASRVLDVPDFPKPGVMFKDLMPL
APT_MYCFE       ----------------------------------------------LKKYIRDIENFPKTGIMFKDISPL
APT_XANC5       -------------------------------------------------RIRDIADFPKQGIVFKDITPL
APT_KINRD       ---------------------------------------------------RDVVDFPQPGVVFKDITPL
APT_SYNS9       ----------------------------------------------LASYIRTIPDFPKPGILFRDINPM
APT_NOVAD       ----------------------------------------------LKRLVRTVPDFPSPGILFRDITTL
APT_YARLI       ----------------------------------------------LKAKLRQYQDFPSKGIVFEDILPI
APT_MYCGA       ---------------------------------------------QLKKTIITVKDFPKPGILFYDITPI
APT_HELAH       --------------------------------------------QELLQNIREVKDYPKKGILFKDITTL
APT_XANOR       -------------------------------------------------RIRDIVDFPKPGIVFKDITPL
APT_XANOP       -------------------------------------------------RIRDIVDFPKPGIVFKDITPL
APT_XANOM       -------------------------------------------------RIRDIVDFPKPGIVFKDITPL
APT_PROMA       ---------------------------------------------KLKEAIRSYSDFPKKGILFHDISPI
APT_MYCVP       ----------------------------------------------IRSLMREVPDFPEPGVHFKDLTPV
APT_PROM2       --------------------------------------------DKLKDKIGNYQDFPTTGILFRDITPI
APT_DROPS       -------------------------------------------LDYVKSKIGEYPNFPKEGILFRDIFGA
APT_PROMT       -------------------------------------------MDHLKKYITEINDYPKKGIVFKDLNPI
APT_PELTS       ----------------------------------------------LKKKIREVPDFPREGINYKDISTL
APT_MYCBP       ---------------------------------------------------RDVADFPVPGVEFKDLTPL
APT_MYCBO       ---------------------------------------------------RDVADFPVPGVEFKDLTPL
APT_BORGA       --------------------------------------------------IAKVPDFPKKGVLFYDITSV
APT_PROMS       -------------------------------------------MKKLEDLILTYKDFPKKGIEFKDVLEI
APT_PROM4       -------------------------------------------------------DFPKKGIVFKDVLPL
APT_KLULA       ----------------------------------------------LKGALRQYPNFPQEGILFEDFLPI
APT_FRASC       -----------------------------------------AVAEVLRGHIRDIPDWPQPGVVFKDITPL
APT_MYCTU       ---------------------------------------------------RDVADFPVPGVEFKDLTPL
APT_MYCTA       ---------------------------------------------------RDVADFPVPGVEFKDLTPL
APT_THICR       -----------------------------------------------------VPDFPKEGILFQDISPL
APT_BORAP       --------------------------------------------------IAKVPNFPKKGILFYDITSV
APT_MYCA9       --------------------------------------------ELVASLTREVADFPEPGVQFKDLTPL
APT_MYCPN       ----------------------------------------KQKLQALDRAIKRFNDFPTPGILFYDITPI
APT_COREF       ---------------------------------------------------RYVHDFPAEGVLFEDLTPX
APT_PROMP       -------------------------------------------MEILNELISTYKDHPKEGIDFKDVLEI
APT_PROM9       -------------------------------------------MEKLEKLISTYENYPKAGVSFKDVIEI
APT_PROM1       -------------------------------------------MDHLKKYITEINDYPKKGIVFKDLNPI
APT_MYCGE       ----------------------------------------------LDQAIKRFENFPNQGTLFYDITPV
APT_CLAMS       -----------------------------------------SASDLVRSLLLTVPDFPQPGILFRDLTPV
APT_MYCA1       --------------------------------------------ELIASLTRQVPDFPKPGIQFKDLTPL
APT_MYCPA       --------------------------------------------ELIASLTRQVPDFPKPGIQFKDLTPL
APT_CLAM3       ----------------------------------------------VRSLLLTVPDFPQPGILFRDLTPV
APT_PROM5       -------------------------------------------------------DFPRKGIEFKDVLGI
APT_MYCS5       ---------------------------------------------QLKDYVKDVLDFPKKGIVFKDISPL
APT_DICDI       --------------------------------------LQKQAEKSVKESMTLFQDWPNKGVGFQDISNL
XPT_PSEU5       -------------------------------------------MEQLKDKIRS------HGIVLSDRVLK
XPT_DEIRA       ----------------------------------------------------------------------
XPT_PSEMY       ----------------------------------------------------------------------
XPT_BACHD       -------------------------------------------MESLKQAIRERGNVLSDTVLKVDLNHQ
XPT_PSEE4       -------------------------------------------MEALQQKIRE------EGIVLSDQVLK
XPT_EXIS2       ----------------------------------------------------------------------
XPT_PSEAE       ----------------------------------------------------------------------
XPT_PSEAB       ----------------------------------------------------------------------
XPT_PSEA8       ----------------------------------------------------------------------
XPT_PSEA7       ----------------------------------------------------------------------
XPT_PSEPK       -------------------------------------------MEALHQKIRE------EGIVLSDQVLK
XPT_PSEPG       -------------------------------------------MEALHQKIRE------EGIVLSDQVLK
XPT_PSEP1       -------------------------------------------MEALHQKIRE------EGIVLSDQVLK
APT_NOCFA       -------------------------------------------------------DFPTPGVRFADLTPV
XPT_PSESM       -------------------------------------------MEALHKKIRE------EGIVLSDQVLK
XPT_STRGC       ----------------------------------------------------------------------
XPT_PSEU2       -------------------------------------------MEALHKKIRE------EGIVLSDQVLK
XPT_PSEPF       -------------------------------------------MEALHQKIRE------QGIVLSDQVLK
XPT_ENTFA       ----------------------------------------KELVERIKNDGRVLGE----GVLKVDITHQ
XPT_PSEFS       -------------------------------------------MEALHKKIRE------EGIVLSDQVLK
XPT_BACSK       -------------------------------------------MELLKEAIRKRGSVLSSGVLKVDQFLN
XPT_PSEF5       -------------------------------------------MEALHKKIRE------EGIVLSDQVLK
XPT_PSE14       -------------------------------------------MEALHKKIRE------EGIVLSDQVLK
XPT_EXISA       ----------------------------------------------------------------------
XPT_BACV8       ----------------------------------------------------------------------
XPT_STRPN       ----------------------------------------------------------------------
XPT_STRMT       ----------------------------------------------------------------------
XPT_STRZT       ----------------------------------------------------------------------
XPT_STRZP       ----------------------------------------------------------------------
XPT_STRZJ       ----------------------------------------------------------------------
XPT_STRR6       ----------------------------------------------------------------------
XPT_STRPS       ----------------------------------------------------------------------
XPT_STRPJ       ----------------------------------------------------------------------
XPT_STRPI       ----------------------------------------------------------------------
XPT_STRP7       ----------------------------------------------------------------------
XPT_STRP4       ----------------------------------------------------------------------
XPT_STRP2       ----------------------------------------------------------------------
XPT_EUBR3       ----------------------------------------------------------------------
XPT1_CLOBH      ----------------------------------------------------------------------
XPT1_CLOB1      ----------------------------------------------------------------------
XPT_BACLD       -------------------------------------------MEKLKRKIAEQGTVLSDEVLKVDLNHQ
XPT_CLOB8       ----------------------------------------------------------------------
XPT_STRTR       ----------------------------------------------------------------------
XPT1_CLOBL      ----------------------------------------------------------------------
XPT_BACCN       ----------------------------------------------------------------------
XPT_STRA5       ----------------------------------------------------------------------
XPT_STRA3       ----------------------------------------------------------------------
XPT_STRA1       ----------------------------------------------------------------------
XPT_STRU0       ----------------------------------------------------------------------
XPT_STRSV       ----------------------------------------------------------------------
XPT_DEIGD       ----------------------------------------------------------------------
XPT_STAS1       ----------------------------------------------------------------------
XPT_BACTN       ----------------------------------------------------------------------
XPT_BACA2       -------------------------------------------MEALKRKIAE------DGIVLSDQVLK
XPT_ACIAD       ----------------------------------------------------------------------
PURR_STRR6      --------------------------------PSISSQDAKEMVEDLRTKLSESDRILPGGYIY--LSDL
PURR_STRPN      --------------------------------PSISSQDAKEMVEDLRTKLSESDRILPGGYIY--LSDL
XPT_ACIBT       ----------------------------------------------------------------------
XPT_ACIBC       ----------------------------------------------------------------------
XPT_ACIB5       ----------------------------------------------------------------------
XPT_ACIB3       ----------------------------------------------------------------------
PURR_BACSU      ------------------------------------------------------------------LTDI
XPT_BACFR       ----------------------------------------------------------------------
XPT_BACFN       ----------------------------------------------------------------------
PURR_LACLM      ------------------------------------------------------------------LSDI
PURR_LACLA      ------------------------------------------------------------------LSDI
XPT_MOOTA       ----------------------------------------------------------------------
XPT_BREBN       ----------------------------------------------------------------------
XPT_AZOVD       -------------------------------------------MEQLKRKIREHGSVLSEQVLKVDLNHQ
PYRE_METMA      ----------------------------------------------------------KKSKYYIDIKKA
XPT_STRS7       ----------------------------------------------------------------------
XPT_STACT       ----------------------------------------------------------------------
XPT_LACLS       ----------------------------------------------------------------------
XPT_BACCZ       ----------------------------------------------------------------------
PYRE_METAC      ----------------------------------------------------------KKSKYYIDIKKA
XPT_CLOPH       ----------------------------------------------------------------------
XPT_STRE4       ----------------------------------------------------------------------
XPT_LISMO       ----------------------------------------------------------------------
XPT_LISMF       ----------------------------------------------------------------------
XPT_BACWK       ----------------------------------------------------------------------
XPT_BACCR       ----------------------------------------------------------------------
XPT_BACC4       ----------------------------------------------------------------------
XPT_BACC3       ----------------------------------------------------------------------
XPT_BACC2       ----------------------------------------------------------------------
XPT_BACC1       ----------------------------------------------------------------------
XPT_BACAH       ----------------------------------------------------------------------
XPT_LISMC       ----------------------------------------------------------------------
XPT_LACLM       ----------------------------------------------------------------------
XPT_BACHK       ----------------------------------------------------------------------
XPT_BACCQ       ----------------------------------------------------------------------
XPT_BACC7       ----------------------------------------------------------------------
XPT_BACC0       ----------------------------------------------------------------------
XPT_BACAN       ----------------------------------------------------------------------
XPT_BACAC       ----------------------------------------------------------------------
XPT_BACAA       ----------------------------------------------------------------------
XPT_STAES       ----------------------------------------------------------------------
XPT_STAEQ       ----------------------------------------------------------------------
XPT_LACLA       ----------------------------------------------------------------------
XPT_LACCB       ----------------------------------------------------------------------
XPT_LACC3       ----------------------------------------------------------------------
XPT_GEOTN       ----------------------------------------------------------------------
XPT_MACCJ       ----------------------------------------------------------------------
XPT_OENOB       ----------------------------------------------------------------------
XPT_OCEIH       ----------------------------------------------------------------------
XPT_BACSU       -------------------------------------------MEALKRKIEE------EGVVLSDQVLK
XPT1_CLOPS      ----------------------------------------------------------------------
XPT1_CLOPE      ----------------------------------------------------------------------
XPT1_CLOP1      ----------------------------------------------------------------------
XPT_LARHH       ----------------------------------------------------------------------
XPT_CLOTE       ----------------------------------------------------------------------
APT_HALSA       -------------------------------------------MDRLKQSLLDAPIIEKDGYHYSDGVPM
APT_HALS3       -------------------------------------------MDRLKQSLLDAPIIEKDGYHYSDGVPM
XPT_LACSS       ----------------------------------------------------------------------
XPT_BIFLO       ----------------------------------------------------------------------
XPT_BIFLD       ----------------------------------------------------------------------
XPT_BIFAA       ----------------------------------------------------------------------
XPT_PARD8       ----------------------------------------------------------------------
XPT_BIFLI       ----------------------------------------------------------------------
XPT_LACBA       ----------------------------------------------------------------------
PYRE_PORGI      ----------------------------------------------------------------------
PYRE_CHLPD      ----------------------------------------------------------------------
APT_HALWD       ----------------------------------------------------------------------
APT_META3       ----------------------------------------------------------------------
XPT_STAAW       ----------------------------------------------------------------------
XPT_STAAT       ----------------------------------------------------------------------
XPT_STAAS       ----------------------------------------------------------------------
XPT_STAAR       ----------------------------------------------------------------------
XPT_STAAN       ----------------------------------------------------------------------
XPT_STAAM       ----------------------------------------------------------------------
XPT_STAAE       ----------------------------------------------------------------------
XPT_STAAC       ----------------------------------------------------------------------
XPT_STAAB       ----------------------------------------------------------------------
XPT_STAA9       ----------------------------------------------------------------------
XPT_STAA8       ----------------------------------------------------------------------
XPT_STAA3       ----------------------------------------------------------------------
XPT_STAA2       ----------------------------------------------------------------------
XPT_STAA1       ----------------------------------------------------------------------
XPT_LACAC       ----------------------------------------------------------------------
PYRE_SULTO      ----------------------------------------------------------------------
PYRE_ROSDO      ----------------------------------------------------------------------
APT1_METMP      -----------------------------------------------------------------DGVPL
XPT_LACH4       ----------------------------------------------------------------------
PYRE_SULNB      ----------------------------------------------------------------------
PYRE_PELTS      ----------------------------------------------------------------------
XPT_CLONN       ----------------------------------------------------------------------
XPT2_CLOBL      ----------------------------------------------------------------------
PYRE_PYRKO      ----------------------------------------------------------------------
PYREL_ARCFU     ----------------------------------------------------------------------
APT_METKA       ----------------------------------------------------------------------
APT1_METM7      -----------------------------------------------------------------DGVPL
XPT_DESRM       ----------------------------------------------------------------------
PYRE_SILST      ----------------------------------------------------------------------
PYRE_PROA2      ----------------------------------------------------------------------
APT_METTH       ----------------------------------------------------------------------
XPT_FINM2       ----------------------------------------------------------------------
XGPT_CHRSD      ----------------------------------------------------------------------
XPT_STAHJ       ----------------------------------------------------------------------
XPT_CLOCE       ----------------------------------------------------------------------
PYRE_CARHZ      ----------------------------------------------------------------------
PYEL2_METBF     ----------------------------------------------------------------------
APT_METJA       -----------------------------------------------------------------DGVPV
APT2_METM5      -----------------------------------------------------------------DGVPL
APT1_METVS      -----------------------------------------------------------------DGVPL
XPT_LACPL       ----------------------------------------------------------------------
XPT2_CLOBH      ----------------------------------------------------------------------
XPT2_CLOB1      ----------------------------------------------------------------------
PYRE_PYRIL      -----------------------------------------------------------------DLRNV
PYRE_BACV8      ----------------------------------------------------------------------
XPT_CLOD6       ----------------------------------------------------------------------
XPT_ALKMQ       -------------------------------------------MELLKEQIREVARVEKGNVLKVDLNHQ
XGPT_SERP5      ----------------------------------------------------------------------
PYRE_THETN      ----------------------------------------------------------------------
PYRE_LACJO      ----------------------------------------------------------------------
KPRS_PYRKO      ----------------------------------------------------------------------
XPT_LACS1       ----------------------------------------------------------------------
PYRE_PYRAB      -----------------------------------------------------------------DIKSL
PYRE_SULDN      ----------------------------------------------------------------------
PYRE_PYRFU      ----------------------------------------------------------KESSYYIDIKKL
PYRE_DINSH      ----------------------------------------------------------------------
PYRE_CAMHC      ----------------------------------------------------------------------
PYREL_UNCMA     ----------------------------------------------------------------------
PYEL1_METAC     ----------------------------------------------------------------------
XPT_PEDPA       ----------------------------------------------------------------------
PYRE_THEMA      ----------------------------------------------------------------------
PYRE_SILPO      ----------------------------------------------------------------------
PYRE_RHOSK      ----------------------------------------------------------------------
PYRE_RHOS4      ----------------------------------------------------------------------
PYRE_RHOS1      ----------------------------------------------------------------------
PYRE_NITSB      ----------------------------------------------------------------------
PYREL_METMA     ----------------------------------------------------------------------
KPRS_PYRHO      ----------------------------------------------------------------------
PYRE_THEGJ      ----------------------------------------------------------------------
PYRE_NOVAD      ----------------------------------------------------------------------
PYRE_METMP      ----------------------------------------------------------KQSKYYVDIKKA
PYRE_COXBU      ----------------------------------------------------------------------
PYRE_ACIF5      ----------------------------------------------------------------------
KPRS_PYRFU      ----------------------------------------------------------------------
PYRE_THEM4      ----------------------------------------------------------------------
PYRE_STRSV      ----------------------------------------------------------------------
PYRE_STRGC      ----------------------------------------------------------------------
PYRE_BACTN      ----------------------------------------------------------------------
PYRE_BACFR      ----------------------------------------------------------------------
PYRE_BACFN      ----------------------------------------------------------------------
PYEL2_METAC     ----------------------------------------------------------------------
XGPT_PHOLL      ----------------------------------------------------------------------
UPP_DICDI       ----------------------------------------------------------------------
PYRE_DESRM      ----------------------------------------------------------------------
PYRE_THESQ      ----------------------------------------------------------------------
PYRE_THEPX      ----------------------------------------------------------------------
PYRE_THEP3      ----------------------------------------------------------------------
PYRE_THEP1      ----------------------------------------------------------------------
PYRE_THENN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEY
APT_NITOC       VGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEY
APT_METCA       VKDPAALRLAIHQLVHPFVGEDITAVAGMEARGFIFGALAAWELGVGFVPLRKPGKLPYNVQSIDYDLEY
APT_RHOBA       LAHPEALTASVEEMAKPFLDQKIDVVAAAEARGFIFGTPLAMRLNAGFVPIRKPGKLPFDLHSFAYELEY
APT_THEFY       LSHPTALRTAIDALAEPLLGSEIDLVAGLEARGFIFAAPVAVRLGAGFVPLRKAGKLPAETLAESYDLEY
APT_CARHZ       LQNPETFRRTVELLAEKVVDLRPTHVVAIESRGFMFGAPLAYKLGLGFVPVRKEGKLPRESISVSYDLEY
APT_METNO       LGDPGAFRRAVDALVHPFAGGRIDQVAGIEARGFILGGAVAHQLSSGFVPIRKKGKLPHTTVSIAYALEY
APT_KOSOT       LKDPGAFKVCISSLKELVKDFEFNLIVAPEARGFIFAAPLALELEKGFVPIRKPGKLPYKTVSVEYSLEY
APT_DINSH       FADPRGFRIAVDQLLDPFVDVKIDKVAGLEARGFILGGAVAHQLSVGFVPIRKKGKLPGKTIAQDYVLEY
APT_METPB       LSDPRSFRRAVDSLVHPYAGGRIDQVAGIEARGFILGGAVAHQLSSGFVPIRKKGKLPHKTVSTAYALEY
APT_METEP       LSDPRSFRRAVDSLVHPYAGGRIDQVAGIEARGFILGGAVAHQLSSGFVPIRKKGKLPHKTVSTAYALEY
APT_METC4       LSDPRSFRRAVDSLVHPYAGGRIDQVAGIEARGFILGGAVAHQLSSGFVPIRKKGKLPHKTVSTAYALEY
APT_METRJ       LSDPRAFRRAVDALVHPYAGGQIHQVAGIEARGFILGGAIAHQLSCGFVPIRKKGKLPHKTVSMAYALEY
APT_FRAP2       LADPQGLKMTAKAMAEELKSKGITVIAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRETYKVSYQLEY
APT_CHLAA       IGNGQAFSEVIDRLHERYQNQQIDAVVGIESRGFIFSAPLAYRLGVGLVPIRKPGKLPAATYQIEYQLEY
APT_CLOD6       FKDGDAFKYAVDSIVEELKDKDVDLVIGPEARGFLMGTPVAYALGVGFVPIRKPGKLPGEVESYEYGLEY
APT_ACIC5       LKDRQGFAKLIDALAEHYIGKNIDLVLGIEARGFIFGPALAYRLNAGFVPVRKPRKLPARTVRVTYDLEY
APT_RUBXD       MEDGPSLHAAVDALAEATRSLDYDRVISAEARGFVFGTALAYRSRKGLVLARKPGKLPREVISVSYELEY
APT_RHIME       LGNPRAFRRAIDELVHPYAGTKVDKVAGIEARGFILGGAIAHQLSAGFIPIRKKGKLPHDTVRIAYSLEY
APT_THELT       LKNPQAFQAAIDKMAETVSDIDFDLIVAPEARGFIFGSALAYKLHKGFIPVRKPGKLPYETTSIEYDLEY
APT_HERA2       LGNAQAFDAAIEHFAQRYANQQLQAIVGIESRGFIFGAPLALRLGIGFVPIRKPGKLPAQTIGVDYSLEY
APT_BRASO       LADARAFRRAVDELVHPWAGSKIDKVAGIEARGFILGGAVAHQLSAGFVPIRKKGKLPHKTVSMSYALEY
APT_PELCD       LADAKSFHRMVDLIAHRYIGQKIDQIVGVEARGFILGAALAYKLGTGITLVRKPGKLPYKTIQKTYQLEY
APT_BRASB       LADARAFRRAVDELVHPWAGSKIDKVAGIEARGFILGGAVAHQLSAGFVPIRKKGKLPHKTVSMSYALEY
APT_STRSY       MADGNAYSYAVREIVQYATDKQIDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_STRS2       MADGNAYSYAVREIVQYATDKQIDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_SINMW       LGNPRAFRRAIDELVHPYAGTKVDKVAGIEARGFILGGAIAHQLSAGFIPIRKRGKLPHDTVRIAYSLEY
APT_METS4       LGDPGAFRRAVDALVHPFAGGRIDRVAGIEARGFILGGAVAHQLSSGFVPIRKKGKLPHTTVSIAYALEY
APT_JANSC       FQDPRGFRLAVDQLLSPFVGETIDAVAGLEARGFILGGAVAHQLSKGFVSVRKKGKLPAATIEQAYKLEY
APT_ANAVT       LRDRQGLRYTIDFLAEKCFEADIDYVIGMESRGFIFGTPLAYKLGAGFIPVRKKGKLPAAVHSIEYELEY
APT_RHILW       LGNPRAFRRAVDELVQPYAGTKIDKIAGMEARGFILGGAVAHQLSSGFVPIRKKGKLPHETVRIAYSLEY
APT_RHILO       LGNARAFRRAIDELVHPYAGQKVDKIAGIEARGFILGGAVAHQLSAGFVPIRKKGKLPFDTVRVAYSLEY
APT_RALME       LQNPKTLRVLIDVFVHRYMDQNLDLVAGIDARGFILGSIIAYELNLGFVPIRKKGKLPFQTVAEEYELEY
APT_RALEH       LQNPKTLRVLIDVFVHRYMDAQLDLVAGIDARGFILGAIVAYELNLGFVPIRKKGKLPFQTVAEEYELEY
APT_YERE8       LEDPLAYAASIELLTERYLDKGVTKVVGTEARGFLFGAPVALSLGVGFVPVRKPGKLPRATISESYELEY
APT_CUPTR       LQDPKTLRVLIDVFVHRYMDAQLDLVAGIDARGFILGAIVAYELNLGFVPIRKKGKLPFQTVAEEYELEY
APT_PECCP       LEDPVAYAASIEMLANRYRNSGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRPTISESYELEY
APT_MESSB       LGDARAFRRAVDELVHPYAGAKIDKIAGIEARGFILGGAIAHQLSSGFIPIRKKGKLPHETVRVAYSLEY
APT_ERWCT       LEDPVAYAASIDMLANRYRNTGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRPTISESYELEY
APT_DESMR       LGDPDGFRRAIDLLAERFADSGATKIVAAEARGFIFGAALAYKMGLGFVPVRKPGKLPYKTVSVSYDLEY
APT_GEOSM       LGDAKSFQRMVDLLSHRYVGQKIDKVVGVEARGFIIGAALAYKLGAGIVLVRKPGKLPSQTRSKTYDLEY
APT_GEOSL       LADAPSFQRMVDLIAHRYVGKKISKVVVVEARGFVIGAALAYKLGAGVVLVRKPGKLPSETYSKTYQLEY
APT_RHIL3       LGNPRAFRRAVDELVQPYAGTKIDKIAGMEARGFILGGAVAHQLSSGFVPIRKKGKLPHETVRIAYSLEY
APT_RALEJ       LQNPKTLRVLIDVFVHRYMDAQLDLVAGIDARGFILGAIVAYELNLGFVPIRKKGKLPFQTVAEEYELEY
APT_NOSP7       LRDPEGLRYTIDFLTQKCKEAEIKPVIGIESRGFIFGSPLAYQLGAGFIPIRKRGKLPAAVHSIEYDLEY
APT_GRAFK       LLDPEAMRLAVKLFMKNLPHGKIDKVVGIESRGFFFATMLAEKLNAGFIPVRKPGKLPHRTHKENYDLEY
APT_GEOBB       LGDAKSFQRMVDLLSHRYVGQKIDKVVGVEARGFIIGAALAYKLGAGIVLVRKPGKLPSKTRSKTYDLEY
APT2_METVS      LKDPKSMKHTTKEITKYLEDKNIDVIVGPEARGFLFGILVAQELDLGFVPVRKPGKLPFKTFSVDYALEY
APT_SYNY3       LNSPEGLRYTIDSLVEQCESQELVPVVGMESRGFLFGMPLAYQMNAGFIPVRKPGKLPAPVHRVEYDLEY
APT_SYMTH       LKDGEAFHAAIETMAAHFEPLGINMVTGPEARGYIFASALAFRLRAGFVPIRKPGKLPWKTRSISYQLEY
APT_STRZP       MADGNAYSYAVREIVQYATDKKVDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_STRR6       MADGNAYSYAVREIVQYATDKKVDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_STRPN       MADGNAYSYAVREIVQYATDKKVDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_STRPJ       MADGNAYSYAVREIVQYATDKKVDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_STRPI       MADGNAYSYAVREIVQYATDKKVDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_STRP7       MADGNAYSYAVREIVQYATDKKVDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_STRP2       MADGNAYSYAVREIVQYATDKKVDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_RHOSK       FADPRGFRIAIDQLLAPYAGMRFDKVAGLEARGFILGGAVAHQLSTGFVPIRKKGKLPGRTISVSYQLEY
APT_GEOUR       LADAASYQRMVDLLSHRYIGKKIDKVVGVEARGFIIGAALAYKLGAGIVLVRKPGKLPSETFKKSYELEY
APT_FLAJ1       LNNVEARQECLSILVNSLKGQKIDKVVGAESRGFFFGMLLAQELKAGFIPVRKPKKLPFDIISASYELEY
APT_CLOPS       IADGEGLRDSVDQMAEFFKDKNIDVVVGPEARGFIFGVPVAYALGVGFIPVRKPGKLPGDTVRVEYDLEY
APT_CLOPE       IADGEGLRDSVDQMAEFFKDKNIDVVVGPEARGFIFGVPVAYALGVGFIPVRKPGKLPGDTVRVEYDLEY
APT_CLOP1       IADGEGLRDSVDQMAEFFKDKNIDVVVGPEARGFIFGVPVAYALGVGFIPVRKPGKLPGDTVRVEYDLEY
APT_ANASP       LRDRQGLRYTIDFLAEKCSEANLNIVIGMESRGFIFGTPLAYKLGAGFIPVRKKGKLPAAVHSIEYELEY
APT_STRZT       MADGNAYSYAVREIVQYATDKKIDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVIFADYEKEY
APT_STRSV       MADGNAYSYAVREIVQYATDKKIDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_RHOS4       FADPRGFRIAIDQLLAPYAGMRFDKVAGLEARGFILGGAVAHRLSTGFVPIRKKGKLPGRTISVSYQLEY
APT_GEOSF       LSDAASYQRMIDLLSHRYIGKRIDKVVGVEARGFIIGAALAYKLGAGIVLVRKPGKLPSETFKKTYDLEY
APT_ENTFA       MANGDAYREATKQIVDYAKEKRIDMVVGPEARGFIVGCPVAYELGVGFAPVRKKGKLPRETIEVTYDLEY
APT_SYNP2       LNHPEGMRYTMDALVQLCLEANLKPVVGMESRGFIFGPTLAYNLNAGFVPVRKPGKLLAAVHTVEYELEY
APT_RHOS1       FADPRGFRIAIDQLLAPYAGMRFDKVAGLEARGFILGGAVAHQLSTGFVPIRKKGKLPGRTISVSYQLEY
APT_YERPY       LENPKAYSASIELLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_YERPS       LENPKAYSASIELLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_YERPB       LENPKAYSASIELLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_YERP3       LENPKAYSASIELLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_STRP4       MADGNAYSYAVREIVQYATDKKVDMIVGPEARGFIVGCPVAFELGXGFAPVRKPGKLPREVISADYEKEY
APT_DESAD       LAEPKAFQYTIDQLAERFADYKIDKIAAAEARGFIFGAPLATKLDIGFVPIRKPGKLPYETISVSYDLEY
APT_YERPP       LENPKAYSASIKLLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_YERPN       LENPKAYSASIKLLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_YERPG       LENPKAYSASIKLLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_YERPE       LENPKAYSASIKLLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_YERPA       LENPKAYSASIKLLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEY
APT_SHELP       MEDPAAYQATIALFVERYKDLGVTKVVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRETISESYELEY
APT_RALSO       LQDPKSLRVLVDVFVHRYMGQGLNLVAGIDARGFILGSIVAYELNLGFVPIRKKGKLPFTTVAEEYMLEY
APT_MARMM       IGDARAFRVAIDRMVQPWAGAKIDKVAGTEARGFILGGAVAHQLSVGFVPVRKRGKLPWRTLREDYELEY
APT_LACPL       MADGEAYREATDQIVQFARDKHVDMIVGPEARGFIVGCPVAYELGVGFAPARKKGKLPRETVKATYDLEY
APT_CLOTH       LQDPEALKECIDSMVESFGEFDI--IVGAESRGFIFGAPLAYALGKGFVPIRKKGKLPYKTISVEYELEY
APT_AGRT5       LGNPRAFRRAVDELVQPYAGTKIDKIAGMEARGFILGGAVAHQLSAGFVPIRKKGKLPHTTVRVAYSLEY
APT_THEP3       LKDAKAFNYSIEMLAKALEGRKFDLIAAPEARGFLFGAPLAYRLGVGFVPVRKPGKLPAETLSYEYELEY
APT_STRGC       MADGNAYSYAVREIVQYATDKKIDMVVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEY
APT_SHISS       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_SHIFL       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISENYDLEY
APT_SHIF8       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISENYDLEY
APT_SHIDS       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_SHIBS       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_SHIB3       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_RHOPB       LGDARSFRCAIDELVQPWAGSKIDKVAGIEARGFIIGGAIAHQVSSGFVPIRKKGKLPHTTVSMSYALEY
APT_NITHX       LGDARAFRRAVDQLVHPWAGSKIDKVAGIEARGFILGGAVAHQLSAGFVPIRKKGKLPHQTVRMAYALEY
APT_ECOUT       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOSM       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOSE       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOLU       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOLI       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOLC       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOL6       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOL5       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOK1       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOHS       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECODH       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECOBW       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECO8A       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECO81       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECO7I       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECO55       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECO45       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECO27       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECO24       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT1_RHIEC      LGNPRAFRRAVDELVQPYAGTKVDKIAGMEARGFILGGAVAHQLSSGFVPIRKKGKLPHDTVRIAYSLEY
APT_RHIGA       LGDAAAFRLAVDELVKPYEGLGVDKIAGMEARGFILGGAMAHQLSAGFVPIRKKGKLPYRTVSMAYALEY
APT_LACLA       MADGNAYNYAATEIVQYARDKEIDMVVGPEARGFIIGCPVAFALGVGFAPVRKPGKLPREVIEATYEKEY
APT_STRS7       MASGKAYSYAIREIVQYACDKDIDMIVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPREVISASYEKEY
APT_STREM       MASGKAYSYAIREIVQYACDKDIDMIVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPREVISASYEKEY
APT_STRE4       MASGKAYSYAIREIVQYACDKDIDMIVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPREVISASYEKEY
APT_RHOS5       FADPRGFRIAIDQLLAPYAGMRFDKVAGLEARGFILGGAVAHQLSTGFVPIRKKGKLPGRTVSVSYQLEY
APT_RHOP2       MGDPRSFRRAVDELVQPWAGSKIDKVAGIEARGFIIGGAIAHQVSSGFVPIRKKGKLPHTCVSMEYTLEY
APT_CLOBA       IGDGEGLKASIDMFVEYLKDKEIDLIVGPEARGFIFGVPVAYALGAGFVPVRKPGKLPGETISVNYDLEY
APT1_WHEAT      LLDPQAFRDTTDLFVERYKDKDITVVAGVEARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYSLEY
APT_SYNP6       LKDPQGWRYSIDRLTELIKPLEPTAIVGIESRGFILGAPLAYQLGLGFVPVRKPGKLPADTHSVEYELEY
APT_SERP5       LENPLAYAASIELLVERFREAGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRATLSESYELEY
APT_RHOPS       LGDPRAFRRAVDELVQPWAGSKVDKVAGIEARGFIIGGAVAHQVSSGFVPIRKKGKLPHTCVSMEYALEY
APT_NITWN       LGDARAFRRAVDQLVHPWAGSKIDKVAGIEARGFILGGAVAHQVSAGFVPIRKKGKLPHQTVRMAYALEY
APT_LEPIN       LLDPEGLALTIGTFVNRYQGKGITKVAGIEARGFLTGAPLAFQLGVGFIPIRKKGKLPSETVSEEYDLEY
APT_LEPIC       LLDPEGLALTIGTFVNRYQGKGITKVAGIEARGFLTGAPLAFQLGVGFIPIRKKGKLPSETVSEEYDLEY
APT_LACLS       MADGNAYNYAATEIVQYARDKEIDMVVGPEARGFIIGCPVAFALGVGFAPVRKPGKLPREVIEATYEKEY
APT_ESCF3       LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ENT38       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALEMGVGFVPVRKPRKLPRETIAESYELEY
APT_COPPD       LKNPDAFATTVDLMAEAVSSLNVTAVAAVEARGFIWGGTLAYRLGVGFIPIRKPGKLPFEVVEKEFELEY
APT_THEPX       LKDAQAFNYSIEMLAKALEGRKFDLIAAPEARGFLFGAPLAYRLGVGFVPVRKPGKLPAETLSYEYELEY
APT_THENN       LKDSRAFREAIDRMCDLVSDRDFDLVVAPEARGFILGAAMAYKLGKGFVPVRKPGKLPYRTVYEEYQLEY
APT_THEAB       LKDKEAFKHAIDMLAEKLSEIDFDLIVAPEARGFIFGGALSYKLNKGFIPVRKPGKLPYEVISEKYTLEY
APT_SALAR       LEDPKAYTLSIELLVERYKKAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_LACLM       MADGNAYNYAATEIVQYARDKEIDMVVGPEARGFIIGCPVAFALGVGFAPVRKPGKLPREVIEATYEKEY
APT_ENTS8       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALALGVGFVPVRKPRKLPRETIAESYELEY
APT_ECO5E       LEDPKAYALSIDLLVERYKNAGINKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_ECO57       LEDPKAYALSIDLLVERYKNAGINKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
APT_CYAP7       LGHPEGLRYTIDTLTQKCIELNLRPVIGMESRGFLFGVPLAYQLGAGFIPVRKPGKLPAAVHTIEYDLEY
APT_CLOBB       IGDGEGLKASIDMFVEYLKDKNVDLIVGPEARGFIFGVPVAYALGAGFVPVRKPGKLPGETISVNYDLEY
APT_ACISJ       LQNPKVFRVLIDAFVHRYMDRALRVVAGLDARGFILGAVVAYELNVGFVPIRKKGKLPFTTVEETYELEY
APT_THETN       LKDAKAFNYSIEMLAKALEGRKFDLIAAPEARGFLFGAPLAFRLGVGFVPVRKPGKLPAETLSYEYELEY
APT_SALTY       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALSV       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALPK       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALPC       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALPB       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALPA       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALNS       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALEP       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALDC       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALCH       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALA4       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_RHOPT       LGEPRAFRRAIDELVQPWAGSKIDKVAGIEARGFIIGGAIAHQVSSGFVPIRKKGKLPHTCVSMEYALEY
APT_RHOPA       LGEPRAFRRAIDELVQPWAGSKIDKVAGIEARGFIIGGAIAHQVSSGFVPIRKKGKLPHTCVSMEYALEY
APT_HALOH       LKDKEAFNLAIEKMXXXXXXXXXXXXVGIEARGFIIGTPLALALNKGFIPIRKPGKLPAERISTSYELEY
APT_BORPD       LQDPRTFRVLIDLFVYRYMRQRLDLVAGVDARGFIIGSVLAYELNLGFVPVRKQGKLPYRTVAESYTLEY
APT2_METMP      LKDPKAMKHTTKEIAKYLEDKNVDVVVGPEARGFLFGVPVAHELDIGFVPVRKPGKLPYKTFSVDYALEY
APT_CYAA5       LSDAEGLRYTIDTLTEKCKAANLSPIVGMESRGFLFGVPLAYQLNAGFVPVRKPGKLPAAVHQVEYELEY
APT1_METM5      LKDPKAMKHTTKEITKYLEDKNVDVIVGPEARGFLFGIPVAHELDIGFVPVRKPGKLPYKTFSVDYALEY
APT_SALTI       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_SALHS       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYALEY
APT_KLEP3       LEDPKAYALSIELLTERYKDAGITKVVGTEARGFLFGAPVALALGVGFVPVRKPRKLPRETIAESYELEY
APT_FUSNN       MNDGEAYKYATEKIVEFAKDHHIDIVVGPEARGFIFGCPVSYALGVGFVPVRKPGKLPREVIEYAYDLEY
APT_CITK8       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAESYELEY
APT_BACP2       MDKGEVYRYATDQIVEYAKERDIDLIVGPEARGFIIGCPVAYALGVGFAPVRKEGKLPREVVKVEYGLEY
APT_SYNPW       LRDPAGWHEVIQRLVAVCDRWQPDLIVGIESRGFIVGTALATQLGKGFVPVRKPGKLPGEVIGIDYTLEY
APT_MACCJ       MDNGAAYKYATDQIVEYAKEKQVDIVVGPEARGFIIGCPVAYAMNIGFAPVRKKGKLPREVISYEYELEY
APT_GEOTN       MDNGEAYKYATDQIVEYAREKQIDIVVGPEARGFIIGCPVAYALGVGFAPVRKEGKLPREVVRVEYGLEY
APT_BREBN       LKDGPAYKAAIQDLAVFAREVQADVIAGPEARGFVVGAPLSYEMGIGFVPIRKSGKLPYESIKANYDLEY
APT_BACA2       MDKGDVYRYATDQIVEYAKEKEIDLVVGPEARGFIIGCPVAYALGVGFAPVRKEGKLPREVIKVDYGLEY
APT_AZOC5       LGNPQAFRRTVDELVQPWAGAKIDKVAGIEARGFIVGGAVAHQLSAGFVPIRKKGKLPHQTVRMAYALEY
APT_RHOFD       LQDAKVFRVLIDAFIHRYMDPSIRVVAGLDARGFILGAVVAYELNVGFVPIRKKGKLPFTTVEETYELEY
APT_LEPBL       LLDPEGLALTIGTFVNRYQDKGITKVAGIEARGFLTGAPLAFQLGVGFIPIRKKGKLPAETVSEEYDLEY
APT_LEPBJ       LLDPEGLALTIGTFVNRYQDKGITKVAGIEARGFLTGAPLAFQLGVGFIPIRKKGKLPAETVSEEYDLEY
APT_DIAST       LQNPKVFRVLIDAFVHRYMDRALRVVAGLDARGFILGAVVAYELNVGFVPIRKKGKLPFTTVEETYELEY
APT_DESOH       LQDPAAFKEAINRFYDRYRTMKIDKIVGIDARGLIFGAPLAYKLEVGFVPVRKKGKIPFRTIGAAYSLEY
APT_BRAJA       LADARAFRRAVDELVNPWAGNKIDKVAGMEARGFIIGGAVAHQLSAGFVPIRKKGKLPHTTVRIAYSLEY
APT_KLEP7       LEDPKAYALSIELLTERYKDAGITKVVGTEARGFLFGAPVALALGVGFVPVRKPRKLPRETIAETYELEY
APT_GEOKA       MDNGPAYKYATDQIVQYAREKQIEIVVGPEARGFIIGCPVAYALGVGFAPVRKEGKLPREVVRVEYGLEY
APT_BACSU       MDKGDVYRYATDQIVEYAKEKQIDLVVGPEARGFIIGCPVAYALGVGFAPVRKEGKLPREVIKVDYGLEY
APT_ACIAC       LQDPKVFRVLIDAFVHRYMDRALRVVAGLDARGFILGAVVAYELNVGFVPIRKKGKLPFTTVEETYELEY
APT_PELPD       LQDAQSYQRMIDLIAHRYVGQRVDKVVGVEARGFIIGAALAYKLCAGVVLVRKPGKLPSETFSKTYSLEY
APT_OCHA4       MGDAQAFRRSVDELVYPYAGNKVDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEY
APT_LACBA       MADGQAFHAATDEIVAYAKDKDVEMVVGPEARGFIVGCPVAYEMGIGFAPARKEGKLPRETVKASYDLEY
APT_BRUSI       MGNAQAFRRAVDELVYPYAGNRIDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTARIAYSLEY
APT_SHEPW       LEDPQAYKLTIGLLVEHYKEQGFTKVVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRETISESYELEY
APT_ROSDO       FADPRGFRIAIDQMLHPYAGLQIDKVVGLEARGFILGGAIAHQLSKGFVPIRKKGKLPGKTISEAYTLEY
APT_PHOPR       MEDPEAYRATMQVLIERYSNTGITKVIGTEARGFLFGAPLALELGVGFVPVRKPGKLPREVISESYELEY
APT_NITSB       LNNASAFTMLMEHLEERYKEKNIDFVAGIESRGFIFGAALATRLGIGFVPVRKKGKLPYTTISEKYALEY
APT_CLOB8       IADGEALRETINRIVKHLEDKKIDLIVGPEARGFIFGVPVAYALGVGFIPVRKPGKLPGETISVNYGLEY
APT_BORPA       LQDPRTFRVLIDLFVYRYMRQRLDLVAGVDARGFIVGAVLAHELNLGFVPVRKKGKLPYRTVAEEYSLEY
APT_BORBR       LQDPRTFRVLIDLFVYRYMRQRLDLVAGVDARGFIVGAVLAHELNLGFVPVRKKGKLPYRTVAEEYSLEY
APT_ACHLI       MLDGKAFKYASDQFTEFARSKKADLIVGPEARGFIFGCPVAVNLGVGFAPVRKPGKLPRASVTVSYDLEY
APT2_METM7      LKDPKAMKHTTKEITKYLEDKNIDIIVGPEARGFLFGVPVAHELDIGFVPVRKPGKLPFKTFSVDYALEY
APT_STRTD       MADGNAYSYAIREIVQYATDKKIDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPRKVISVDYEKEY
APT_STRT2       MADGNAYSYAIREIVQYATDKKIDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPRKVISVDYEKEY
APT_STRT1       MADGNAYSYAIREIVQYATDKKIDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPRKVISVDYEKEY
APT_SHEPA       LEDPQAYKLTIGLLVEHYKDQGFTKVVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRETISESYELEY
APT_GEOSW       MDKGEVYKYATDQIVEYAREKKIDIVVGPEARGFIIGCPVAYALGVGFAPVRKEGKLPREVVRVEYGLEY
APT_GEOLS       LQDAKSFTRMIDMIANRYIGQRIDKVVGVEARGFLIGAALAYRLGAGVVLVRKPGKLPSETFSKTYDLEY
APT_CLOK5       IRDKDAFKYAVDKIAGYLKDKNIDVVVGPEARGFLFGAPIAYTLGAGFVPVRKQGKLPYDTLSIKYDLEY
APT_CLOK1       IRDKDAFKYAVDKIAGYLKDKNIDVVVGPEARGFLFGAPIAYTLGAGFVPVRKQGKLPYDTLSIKYDLEY
APT_BRUSU       MGNAQAFRRAVDELVYPYAGNRIDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEY
APT_BRUO2       MGNAQAFRRAVDELVYPYAGNRIDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEY
APT_BRUME       MGNAQAFRRAVDELVYPYAGNRIDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEY
APT_BRUC2       MGNAQAFRRAVDELVYPYAGNRIDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEY
APT_BRUAB       MGNAQAFRRAVDELVYPYAGNRIDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEY
APT_BRUA2       MGNAQAFRRAVDELVYPYAGNRIDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEY
APT_BRUA1       MGNAQAFRRAVDELVYPYAGNRIDKVAGIEARGFILGGAIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEY
APT_STAHJ       MDNGEAYGYATDQIVKYAKDRDVDVVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_LACH4       LQDGELYRIATHELAEYAKSRKADVIVGPEARGFIVGCPVATELGLGFVPARKPHKLPREVERASYDLEY
APT_BORA1       LQDPRTFRALVDLFVYRYMRQRLDLVAGVDARGFILGSVLAYELNLGFVPVRKKGKLPYRTVAEEYSLEY
APT_THESQ       LRNQEAFKEAIDRMCELVFDKEFDLVVAPEARGFILGAAMAYKLGKGFVPVRKPGKLPYKTVYEEYQLEY
APT_THEP1       LRNQEAFKEAIDRMCELVSDRDFDLVVAPEARGFILGATMAYKLGKGFVPVRKPGKLPYKTVYEEYQLEY
APT_THEMA       LRNQEAFKEAIDRMCELVFDREFDLVVAPEARGFILGAAMAYKLGKGFVPVRKPGKLPYKTVYEEYQLEY
APT_STRU0       MADGKAYSYAIREICQYAADKEIDMIVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPREVVSADYEKEY
APT_STRA1       MADGKAYSYAVREIVQYAADKDIDMIVGPEARGFIVGCPVAYALGIGFAPVRKPGKLPREVISANYEKEY
APT_MYXXD       LADPRLFGRVIDAMSAPFRGQHVTKVVGVEARGFLLGAPIALALNAGFVPARKPGKLPHRSVVERYSLEY
APT_STRA5       MADGKAYSYAVREIVQYAADKDIDMIVGPEARGFIVGCPVAYALGIGFAPVRKPGKLPREVISADYEKEY
APT_STRA3       MADGKAYSYAVREIVQYAADKDIDMIVGPEARGFIVGCPVAYALGIGFAPVRKPGKLPREVISADYEKEY
APT_LACS1       MADGEAYRQATDRIVQFAKDKGVEMIVGPEARGFIVGCPVAYELGVGFAPARKKGKLPRETVKADYSLEY
APT_BACLD       MDKGDVYRYATDQIVTYAKEKEIDLVVGPEARGFIIGCPVAYALGVGFAPVRKEGKLPREVIKVDYGLEY
APT_STRPZ       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRPM       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRPF       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRPD       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRPC       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRPB       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRP8       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRP6       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRP3       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRP1       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STAAB       MDNGEAYGYATNKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_SHEHH       LEDPQAYKLTIGLLVEHYKDQGFTKVVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRETISESYELEY
APT_METPP       LQSPKVFRVLIDQFVHRYFDLRPDAIAGLDARGFIIGSVLAYELNIGFVPIRKKGKLPYTTVEESYELEY
APT_STRGB       LADPVAFTALTDTLAAGRRRHPRTKVVGLEARGFILGAPVAVRAGLGFIPVRKAGKLPGATLSQAYDLEY
APT_ROSS1       LQNGAAFKEVIDTLAARYEGRALDAIVGIESRGFIFSAPLAYRLGVGMIPIRKPGKLPWETFAVEYDLEY
APT_CLOTE       LQEKEAFKYTIDTLVEELKDKNVDVVVGPEARGFLFGAPLAYALGAGFVPVRKKGKLPSTTISSKYELEY
APT_CLOPH       LQDKDSLKMSIDQMQENLNGLDFDVIVGPESRGFIFGVPIAYNLNKAFIPVRKKGKLPCETVEMEYALEY
APT_STAAW       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAAU       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAAT       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAAS       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAAR       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAAN       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAAM       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAAE       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAAC       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAA9       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAA8       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAA3       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAA2       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_STAA1       MDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_SHEWM       LEDHTAYKATMDILVQHYKDHGFTKIVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRETISESYELEY
APT_NITEC       LKDPVGLRITIDEIAERYRAEKIDKVVGIESRGFIFAAPVAYALGAGFVPIRKQGKLPAETISCDYQLEY
APT_FINM2       LNDKDAYKYAVDLMVDDLKDKGITAIAAPEARGFLFGSAVAYALGVRFIPVRKPGKLPGEVSEYSYDLEY
APT_CYAP8       LSHGEGLRYTIDTLTEKCQTAGLIPVVGMESRGFLFGVPLAYQLQAGFVPVRKPGKLPAAVHQVEYELEY
APT_AERS4       IENAEAFKATIDLLAEHYRDQGITKIVGTEARGFIFGAPVAFAMGLGFVPVRKPGKLPRAVIEESYALEY
APT_STRPG       MADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEY
APT_STRMU       MANGNAYSYAIREIVQYATDKKIDMIVGPEARGFIVGCPVAYELGVGFAPVRKPGKLPREVIEAHYEKEY
APT_STRCL       LADPEAFSVLTEALAEVCVRHGATKVVGLEARGFILGAPVAVRAGLGFIPIRKAGKLPGATLSQAYALEY
APT_SALG2       LEDPKAYALSIELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
APT_LEPBA       LIDPEGFQLTIGMFVERYQNAKLNKIAAIDARGFIPGAALAFQLGVGFVPIRKKGKLPGNTISESYALEY
APT_CYTH3       LKDPQLCKAIVQSITDQLRPLQPDALACLDSRGFWFGLSIAMELGIPMIPIRKKGKLPYETVYEEYALEY
APT_BURP8       LQKPKSLRVLIDLFVQRYIDQKLDYVAGLDARGFIIGPILAYELNLGFIPIRKIGKLPFRTVSESYELEY
APT_ACIBL       IKEPVGLARTIDGITEHFLNKNIDLVVGMEARGFIFGPAVAYRLNAGFIPIRKPRKLPGETVKHTYKLEY
APT_PARL1       LSDPEGFRGAVDALVSLHKGAKFDVVAGIEARGFILGGAVAHQLGLGFIPVRKKGKLPFTTIGQEYDLEY
APT_LACAC       LQNGELYRAATHELAEYAKSRNADVIVGPEARGFIVGCPVATELGLGFVPARKPHKLPREVERASYDLEY
APT_BURM1       LQSPKALRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTRSESYELEY
APT_STAS1       MDNGEAYGYATDQIVEYAKLRDVDIIVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_SHESH       LEDHTAYKATMDILVEKYKDQGFTKVVGTEARGFLFGAPLALELGLGFVPVRKPGKLPRETISESYELEY
APT_SHEB9       LENAAAYKATIDLLVEHYRGQGFTKIVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRATISQSYELEY
APT_SHEB8       LENAAAYKATIDLLVEHYRGQGFTKIVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRATISQSYELEY
APT_SHEB5       LENAAAYKATIDLLVEHYRGQGFTKIVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRATISQSYELEY
APT_SHEB2       LENAAAYKATIDLLVEHYRGQGFTKIVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRATISQSYELEY
APT_SHEAM       LEDHTAYQTAMKLLVERYKDSGFTKVVGTESRGFLFGAPLALELGVGFVPVRKPGKLPRETISESYELEY
APT_NOCSJ       XXXXXXXXXXXXXXXXPGRDQTVDKVLGMESRGFILGAPVALALGVGFVPVRKAGKLPRATYAVSYALEY
APT_CHRVO       LQNPKTFRMLIDIYVHRYMMEKVDLVAGLDARGFIIGSVLAYELNVGFVPIRKKGKLPFTTVEEEYELEY
APT_BURXL       LQEPKSLRVLIDLFVQRYIDAKLDYIAGLDARGFIIGPILAYELNLGFIPIRKAGKLPYNRLAQSYELEY
APT_AERHH       IENADAFKATIDLLANHYRDQGITKIVGTEARGFIFGAPVAYAMGLGFVPVRKPGKLPRAVIEESYALEY
APT_PROAC       LANPNGYAAAISELVDT-ASRDVDVVLGMEARGFMFAGPVALSLGAGFVPVRKPGKLPGDVYSQSFVLEY
APT_LACGA       LQDGKLYRAATHELAEYAKSRGAEVIVGPEARGFIVGCPVATELGIGFVPARKPHKLPREVESASYDLEY
APT_ROSCS       LQHGAAFKQVIDTLAARYEGRSLDAVVGVESRGFIFSAPLAYRLGIGLVPIRKPGKLPWETFAVEYDLEY
APT_LACJO       LQDGKLYRAATHELADYAKSRGAEVIVGPEARGFIVGCPVATELGVGFVPARKPHKLPREVESASYDLEY
APT_CORJK       LADPHSFKLLVQDLANHCRNFDIDLIGGLDARGFLLGSAVAYELGVGILAVRKGGKLPPPVHHVDYSLEY
APT_BORPE       LQDPRTFRVLIDLFVYRYMRQRLDLVAGVDARGFIVGAVLAHELNLGFVPVRKKSKLPYRTVAEEYSLEY
APT_PETMO       LKNPEVFKYSVEKIAELIKEWDFDCIVSPESRGFIFATPLAYLMNKEFVPIRKPGKLPYKTYSISYELEY
APT_CLOAB       IQDKEAYKYSVDKIGEYLKDKNVDLIVAPEARGFLFGAPVAYKIGAGFIPVRKKGKLPCETVEVTYELEY
APT_BURPP       LQEPKSLRVLIDLFVQRYIDAKLDYIAGLDARGFIIGPILAYELNLGFIPIRKAGKLPYKRVAQSYELEY
APT_ALISL       MEDPKAYQATIQLLVEKYKQGGFTKIVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRPTIAQTYDLEY
APT_SULNB       LNNPKALSTLMDHLTERYLGYDLDYIAGIDARGFIFGSILADRLGVGFVPVRKKGKLPYTTVAEKYSLEY
APT_NEIM0       LQSAEYFRLLVDLLVYRYMDQKIDIVAGLDARGFIIGAALAYQLNVGFVPIRKKGKLPFETVSQSYALEY
APT_NEIG1       LQSAEYFRLLVDLLVYRYMDQKIDIVAGLDARGFIIGAALAYQLNVGFVPIRKKGKLPFETVSQSYALEY
APT_EDWI9       LEKPDAYALSIELLAARYRAAGITKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRATLAESYALEY
APT_VIBVY       LEDAQAYQATIQLLVDKYKDMGFTKVVGTEARGFLFGAPLALQLGVGFVPVRKPGKLPRNTIAQSYELEY
APT_VIBVU       LEDAQAYQATIQLLVDKYKDMGFTKVVGTEARGFLFGAPLALQLGVGFVPVRKPGKLPRNTIAQSYELEY
APT_STOLO       LKDPVSFRASIHLLLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKRGKLPGPTLSASYALEY
APT_SHESW       LENAAAYKAAIDLLVEHYRGQGFTKIVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRATISQSYELEY
APT_SHEPC       LENAAAYKAAIDLLVEHYRGQGFTKIVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRATISQSYELEY
APT_BURS3       LQSPKALRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTRSESYDLEY
APT_ALKMQ       LKDKEAFRSMXXXXXXXXXXXXXXXXXGPEARGFLVGAPVAYKIGAGFVPIRKPGKLPGETISYEYELEY
APT_VIBF1       MEDPKAYQATIQSLVEKYKQGGFTKIVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRPTIAQTYDLEY
APT_PSEMY       FQSPRALRMVADSFIQRYVEAEFSHIGAMDARGFLIGSIIAYELNKPLILFRKQGKLPADVLSESYQTEY
APT_NEIMF       LQSAEYFRLLVDLLVYRYMDQKIDIVAGLDARGFIIGAALAYHLNVGFVPIRKKGKLPFETVSQSYALEY
APT_LACSS       MSDGEAYAAATDKIVEYAKNKGVEMIVGPEARGFIVGCPVAYKLGVGFAPARKKGKLPRETVSASYGLEY
APT_CLONN       LNDKEALKYTVDAIVEHLKDKNVDVVVGPEARGFLFGTPVAYALGAAFVPVRKKGKLPCETISSEYDLEY
APT_STACT       MDNGEAYGYATDQIVEFAREKEVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEY
APT_OCEIH       MADGKAFKSAVDEIVDYANTKEIDLVVGPEARGFIVGCPVSYALEVGFAPVRKEGKLPREVIKVDYGLEY
APT_BURCH       LQSPKALRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTRSESYDLEY
APT_BURCA       LQSPKALRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTRSESYDLEY
APT_BACCZ       MNDGKAYKAATDAIVEYAKERDIDVVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACCR       MNDGKAYKAATDAIVEYAKERDIDVVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACC4       MNDGKAYKAATDAIVEYAKERDIDVVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACC2       MNDGKAYKAATDAIVEYAKERDIDVVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_PROM3       LRDPDGWGEVMRQLGDLCTEFKPDLIVGIESRGFIVGTALATNRKIGFVPVRKPGKLPGDVLGIDYSLEY
APT_PHOLL       LDNPLAYQATIDLLVERYQGKGITKIVGTEARGFLFGAPVALRLGVGFIPVRKAGKLPRETLSETYNLEY
APT_MASHI       LKDPDSFRASIRLLLKSLHGGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKRGKLPGPTLSASYALEY
APT_HAEIE       LEVPAAFKATIDLIVEQYRDKGITKVLGTESRGFIFGAPVALALGLPFELVRKPKKLPRETISQSYQLEY
APT_GEOMG       LADAKSFQRMVDLLAHRYVGEKIDKVVGVEARGFIXXXXXXXXXXXXXXXXRKPGKLPSETFSKTYQLEY
APT_BURCM       LQSPKALRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTRSESYDLEY
APT_BURA4       LQSPKALRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTRSESYDLEY
APT_BACHK       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACCQ       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACC7       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACC1       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACC0       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACAN       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACAH       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACAC       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACAA       MNDGKAYKAATDAIVEYAKERDIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_STRAW       LADPAAFTALTGALAELTVRHGATKIVGLEARGFILGAPAAVQAGVGFIPVRKAGKLPGATLSQSYDLEY
APT_PROMM       LRDPDGWDEVMRQLGDLCTELKPDLIVGIESRGFIVGTALATNRKIGFVPVRKPGKLPGDVLGIDYSLEY
APT_CRIGR       LKDPASFRASI-RLLASHLKSTIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTVSASYALEY
APT_BURCC       LQSPKALRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTRSESYDLEY
APT_VIBSL       MEDPAAYKATIDLLVDTYKGMGFTKIVGTEARGFLFGAPLALELGVGFIPVRKPGKLPRQTVAQSYELEY
APT_STAES       MDNGEAYGYATDQIVEYAKEKNIDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYNLEY
APT_STAEQ       MDNGEAYGYATDQIVEYAKEKNIDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYNLEY
APT_RAT         LKDPDSFRASI-RLLAGHLKSTIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKRGKLPGPTVSASYSLEY
APT_MUSPA       LKDPDSFRASIRLLLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTISASYALEY
APT_LISW6       MNDGEAYRFATDKIVEYAKELKIDIIVGPEARGFIIGCPVAYALGIGFAPVRKPGKLPRETIEMEYDLEY
APT_LISMO       MNDGEAYRFATDKIVEYAKELKIDIIVGPEARGFIIGCPVAYALGIGFAPVRKPGKLPRETIEMEYDLEY
APT_LISMH       MNDGEAYRFATDKIVEYAKELKIDIIVGPEARGFIIGCPVAYALGIGFAPVRKPGKLPRETIEMEYDLEY
APT_LISMF       MNDGEAYRFATDKIVEYAKELKIDIIVGPEARGFIIGCPVAYALGIGFAPVRKPGKLPRETIEMEYDLEY
APT_LISMC       MNDGEAYRFATDKIVEYAKELKIDIIVGPEARGFIIGCPVAYALGIGFAPVRKPGKLPRETIEMEYDLEY
APT_LISIN       MNDGEAYRFATDKIVEYAKELKIDIIVGPEARGFIIGCPVAYALGIGFAPVRKPGKLPRETIEMEYDLEY
APT_IDILO       LQNPDAFRLTINTLKQRYAGQGITQIAAVEARGFIFGSALAYAMGCGVTLLRKPGKLPGKVTRQNYELEY
APT_BURP6       LQSAKALRVLVDLFVERYVDANLDYIAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYATQRESYALEY
APT_SULDN       LNNGKAFGVTMNHLYEKYKEYNLDYIAGIDARGFIFGAALAQMLGVGFVPIRKKGKLPYTTISEKYSLEY
APT_MUSSI       LKDPDSFRASIRLLLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLEY
APT_METI4       IGEGQFFRLILTIFIARYQXXXXXXXXXXXXRGFIFAGALAHALGVGIIPIRKKGKLPYKTYELHYKSEY
APT_CYAP4       LQNEQGLRYTIDRLTQAFSDQAIDYVAGIESRGFIFGAPLAYKLGAGFVPIRKAGKLCAEVHTVEYALEY
APT_BACWK       MNDGKAYKAATDAIVEYANKRDIDVVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEY
APT_BACCN       MNNGKAYKAATDEIVAYAKERNIDLVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREIIKVDYGKEY
APT_ACIC1       LAEPAVFAAVVDALVRDYQHGTVDKVVGIEARGFIVAAPVAYHLGAGFVPMRKKGKLPYRTLETSYALEY
APT_VIBHB       LEDAKAYQATINLLVDRYKDMGFTKVVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRPTIAQSYELEY
APT_SHEDO       LEDASAYQATIALFVEKYQGMGFTKVVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRKTIAQSYELEY
APT_BUTFI       LQDAEGFKLAIDEMIKLLDGVDCDVIAGAESRGFIFGAPLAYALGKPSVLVRKKGKLPCETIEKTYDLEY
APT_BURVG       LQSPKALRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTCSESYDLEY
APT_SHESM       LENAAAYKATIDLLVEQYRNKGFTKIVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRATISQSYELEY
APT_SHESA       LENAAAYKATIDLLVEQYRNKGFTKIVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRATISQSYELEY
APT_NEIMB       LQSAEYFRLLVDLLVYRYMDQKIDIVAGLDARGFIIGAALAYQLNVGFVPIRKKGKLPFETVSQSYALEY
APT_HAEIN       LEVPAAFKATIDLIVEQYRDKGITKVLGTESRGFIFGAPVALALGLPFELVRKPKKLPRETISQSYQLEY
APT_HAEIG       LEVPAAFKATIDLIVEQYRDKGITKVLGTESRGFIFGAPVALALGLPFELVRKPKKLPRETISQSYQLEY
APT_HAEI8       LEVPAAFKATIDLIVEQYRDKGITKVLGTESRGFIFGAPVALALGLPFELVRKPKKLPRETISQSYQLEY
APT_FRATW       LADPQGLRKTAEAMAQELKNKGITIVAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEY
APT_SILST       FADPRGFRMAVDQMLHPYAGQRIDKVVGLEARGFILGGAIAHQLGTGFVPVRKKGKLPGATISQEYKLEY
APT_PSYIN       IENGAAFSATINLLVERYKDQNISKVVGTEARGFIFGAPLAAAIGAGFVPVRKPGKLPRTTVHENYELEY
APT_NEIMA       LQSAEYFRLLVDLLVYRYMDQKIDIVAGLDARGFIIGAALAYQLNVGFVPIRKKGKLPFETVSQSYALEY
APT_MOUSE       LKDPDSFRASIRLLLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLEY
APT_FRATT       LADPQGLRKTAEAMAQELKNKGITIVAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEY
APT_FRATO       LADPQGLRKTAEAMAQELKNKGITIIAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEY
APT_FRATN       LADPQGLRKTAEAMAQELKNKGITIVAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEY
APT_FRATM       LADPQGLRKTAEAMAQELKNKGITIVAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEY
APT_FRATH       LADPQGLRKTAEAMAQELKNKGITIIAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEY
APT_FRATF       LADPQGLRKTAEAMAQELKNKGITIIAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEY
APT_FRAT1       LADPQGLRKTAEAMAQELKNKGITIVAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEY
APT_DESHY       LKDGEAYRAAVDAIVERVRESQPDLIVGPEARGFLLGAPVAYALGIGFVPVRKPGKLPGKTVSETYELEY
APT_DESHD       LKDGEAYRAAVDAIVERVRESQPDLIVGPEARGFLLGAPVAYALGIGFVPVRKPGKLPGKTVSETYELEY
APT_ACTSZ       TEIPEAFTATVNLIAEAFRHKGITKIIGTESRGFIFGAPVAVALGLPFILVRKPGKLPREVISQSYQLEY
APT_VIBCM       LEDAQAYQATIQLLVEKYKDMGFTKVVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRQTVAQSYELEY
APT_VIBCH       LEDAQAYQATIQLLVEKYKDMGFTKVVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRQTVAQSYELEY
APT_VIBC3       LEDAQAYQATIQLLVEKYKDMGFTKVVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRQTVAQSYELEY
APT_STRCO       LADPGXXXXXXXXXXXXXGRTGATKVVGLEARGFILGAPVALRAGLGFIPVRKAGKLPGATLSQAYDLEY
APT_SILPO       FADPRGFRIAIDQMLHPYAGERIDKVVGLEARGFILGGAIAHQLSVGFVPIRKKGKLPGTTISQDYKLEY
APT_PSEA6       LEDHKAYTTSIELLVKEFAPYNFDKVAGTEARGFLFGAPLAIELGIGFIPVRKPNKLPRKVISESYDLEY
APT_LACC3       MADGKXXXXXXXXXXXXXQDKGVEMIVGPEARGFIVGCPVAYKLGIGFAPARKKGKLPRPTVKASYDLEY
APT_ANASK       LSDPHTFREVIDAFVERWKGERVDKVIGIESRGFIFAAPIAYALGAGFTIVRKPGKLPWETIREVYALEY
APT_ANAD2       LSDPHTFREVIDAFVERWKGERVDKVIGIESRGFIFAAPIAYALGAGFTIVRKPGKLPWETIREVYALEY
APT_SODGM       LENSRAYAASIALLADRFRDAGLTKIVGTEARGFLFGTPVALALGLGFVPVRKPGKLPRETISENYVLEY
APT_SHESR       LENAVAYKATIDLLVEQYRNKGFTKIVGTEARGFLFGAPLALELGIGFVPVRKPGKLPRATISQSYELEY
APT_NITEU       LKDPAGLRSTIDGIVQRYQTEKIDKVVGIESRGFIIAAPVAYALSAGFVPVRKQGKLPAETIGCDYQLEY
APT_BURPS       LQSAKALRVLVDLFVERYVDAKLDYIAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYATQRESYALEY
APT_BURP1       LQSAKALRVLVDLFVERYVDAKLDYIAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYATQRESYALEY
APT_BURP0       LQSAKALRVLVDLFVERYVDAKLDYIAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYATQRESYALEY
APT_NITMU       LKDPVGLRATIQEIASRYKSMKIDKVAGIESRGFIIGAPVAYELGVGFVPVRKKGKLPAETRGRDYQLEY
APT_HUMAN       LKDPASFRAAIGLLARHLKATHIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEY
APT_GERCA       LKDPDSFRASIRLLANHLKSKHIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTVSASYALEY
APT_LACDB       LQDGEAFAAATHEIAEYAKSRQADVIVGPEARGFLVGTPVAIELGIGFVPARKPHKLPREVEAAAYDLEY
APT_LACDA       LQDGEAFAAATHEIAEYAKSRQADVIVGPEARGFLVGTPVAIELGIGFVPARKPHKLPREVEAAAYDLEY
APT_CHRSD       LQNSAAFRKLIDSFVHRYQELNLDAIAAIDARGFIIGAPVAYELGCSFVPVRKKGKLPFKTISETYTLEY
APT_ACTPJ       LEVPEAFKATVDAIVAEFKDKGITKVVGTESRGFIFGAPVALALGVPFVLVRKPKKLPRAVISQSYALEY
APT_ACTP7       LEVPEAFKATVDAIVAEFKDKGITKVVGTESRGFIFGAPVALALGVPFVLVRKPKKLPRAVISQSYALEY
APT_ACTP2       LEVPEAFKATVDAIVAEFKDKGITKVVGTESRGFIFGAPVALALGVPFVLVRKPKKLPRAVISQSYALEY
APT_ACAM1       LQNPDGLRYVIDQFTEDYREQSIDYVVGIESRGFIFGAPLAYQLGAGFVPVRKPGKLPAAIHAQEYELEY
APT_TOLAT       VEHPQGFHQTIELLKEHYQSMSFDKVVGTEARGFIFGAPLAYALQLGFIPVRKPGKLPRSVLEQSYQLEY
APT_PSEPF       FQSPKALRLVMDSFAHRYVEADFTHIGAMDARGFLIGSVLAYQLNKPLVLFRKQGKLPADVLAEGYATEY
APT_PSEFS       FQSPRALRLVADSFAQRYVEADFTHIGAMDARGFLIGSIIAYQLNKPLILFRKQGKLPADVLAEGYQTEY
APT_PSEF5       FQSPRALRLVADSFAQRYVEEDFSHIGAMDARGFLIGSIIAYQLNKPLILFRKQGKLPADILAEGYRTEY
APT_MANSM       IEVPEAFQATVDLIVGNYKNQGITKVVGTESRGFIFGAPVALALGLPFVLVRKPRKLPRETISQSYQLEY
APT_HELHP       IGDAEVFKEVINILRSRYENQSIDFIAAIEARGFIFGSALAYALGIGFVPIRKKGKLPYNTISEKYTLEY
APT_THEM4       LKNPEAFNFAIDQLVNKLKEIEFNTIVAPEARGFIFXXXXXXXXXXXXVPVRKPGKLPYKVISEKYSLEY
APT_SHEFN       LENAEAYKATIAILVAHYQSKGFTKVVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRKTISQTYDLEY
APT_FERNB       VKNPEAFKYAIDTIAEELGKYDFDLIVCPEARGFIIAAPLAYKLDKGLVPVRKPGKLPYKTISDVYELEY
APT_BACHD       MQNGEVYKRAIDEMARFAKEKEVDLVVGPEARGFVVGCPIAYAIGKGFVPVRKAGKLPREVISVDYGLEY
APT_PSEHT       MANPDAFKATIDAFIAAYKDQGFTKIIGTESRGFIFGAPLSYALGIPFIPVRKPGKLPREVVRQDYLLEY
APT_CLOCE       LQDPEAFRECMESF-KTLAEKDFDLIVGSESRGFIFGAPLAYRMEKGFVPVRKKGKLPYKTVREEYDLEY
APT_PEDPA       MENGEAYRQATNAIIKFARDKGVEMIVGPEARGFIVGCPVAYEMGIGFAPARKKGKLPRETVKATYGLEY
APT_BRAHW       LQNKDAFKYAIDKMAEQISSEKIDYIVGAESRGFLIGSALAYKLNCGFIPVRKKGKLPYKTISEEYALEY
APT_BURTA       LQSAKAMRVLVDLFVERYVDAKLDYIAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTQRESYALEY
APT_SOLUE       LKDPSGFHGVIDGLKDHYRDIKVDTVLGIEARGFIFAPALAYALGAGFVPVRKPKKLPAECVRITYDLEY
APT_EXIS2       MQNGPAYKQSVDALIDYARKQGADVIAGPEARGFVVGCPAAYAMEIGFVPVRKEGKLPRETVRVEYGLEY
APT_VIBPA       LEDAKAYQATIGLLVERYKDMGFTKVVGTEARGFLFGAPLALELGVGFVPVRKPGKLPRPTIAQSYELEY
APT_LYSSC       MDHGPAYKYATDQIVEYAKELGAEIVVGPEARGFIIGCPVAYALEIGFAPVRKPGKLPRKVISADYGLEY
APT_LEUMM       MGDGVAYKQAVDAIADFAKHLNVDLIAGPESRGFIVGSPLAYAMNIGFVPARKGGKLPREAVSASYTLEY
APT_CLOBM       LQDGKVLNYTVDKLAENLKDKKIDKIVGPEARGFLFGTPLAYKLGVGFVPVRKKGKLPYETISCKYDLEY
APT_BIFLI       FADPKGLRIXXXXXXXXXXXSEFDSIAGLESRGFLFGPALAARMGKGFIAVRKAGKLPPETIGESYDLEY
APT1_ARATH      LLDTEAFKDTIALFVDRYKDKGISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEY
APT_MYCMO       LANGEIFRIVVEKMAEKVREVDV--IIGPDARGFIFGAAVASYLKKPFVMIRKEGKLPHNTIKIDYKLEY
APT_CLOBL       LQDGKVLNYTIDKLAENLKDKKIDKIVGPEARGFLFGTPLAYKLGVGFVPVRKKGKLPYETISCKYDLEY
APT_CLOBK       LQDGKVLNYTIDKLAENLKDKKIDKIVGPEARGFLFGTPLAYKLGVGFVPVRKKGKLPYETISCKYDLEY
APT_CLOBH       LQDGKVLNYTIDKLAENLKDKKIDKIVGPEARGFLFGTPLAYKLGVGFVPVRKKGKLPYETISCKYDLEY
APT_CLOB1       LQDGKVLNYTIDKLAENLKDKKIDKIVGPEARGFLFGTPLAYKLGVGFVPVRKKGKLPYETISCKYDLEY
APT_MARAV       LQDKTAFRKLIDAFVHRYHGQHIDAVAAVDARGFIIGSALAYELNASLVLVRKKGKLPFDTLVEDYELEY
APT_PASMU       LEVPAAFQTVVDLFVTRYKEKGITKVLGTESRGFIFGAPVALALNVPFVLVRKPGKLPRETISQTYQLEY
APT_GRABC       LADADAWQVTMGRLANRVRVHHPDILAGVESRGFLLAAPLALKLGCGFVMLRKRGKLPGKTIGLDYALEY
APT_LEUCK       MGDGVAYKQAVDAIADFAKDLNVDLIAGPESRGFIVGSPLAYALNIGFVPARKGGKLPRAAVSAAYSLEY
APT_PSE14       FQSPKATRQVIDSFVQRYIEADFSHIGVMDARGFLIGSVVAYQLNKPLVLFRKQGKLPADVLSEAYQTEY
APT_PROMH       LDNPAAYQATIDLLVEHYQGQGITKVVGTEARGFLFGAPVALRLGVGFVPVRKKGKLPRETLSETYDLEY
APT_MICAN       LNHPQGLRYTIDTLTAKCRDYGLSPIVGMESRGFLFGVPLAYQLEAGFIPVRKPGKLPAAVHSIEYDLEY
APT_HAES2       TEVPEAFQATIDLIIERYKSKGITKVIGTESRGFIFGAPVALALNVPFILVRKPGKLPRETIAQSYQLEY
APT_HAES1       TEVPEAFQATIDLIIERYKSKGITKVIGTESRGFIFGAPVALALNVPFILVRKPGKLPRETIAQSYQLEY
APT_BACSK       MQNGTAYKRAVEELAVYAKEKQADVIVGPEARGFVVGCPIATELEIGFVPVRKKGKLPREVIEANYGLEY
APT_ALKOO       LKEGEALQYVTDQLTEQLKDLNIDIIVGPEARGFLVGTPVAYKLGVGFVPVRKPGKLPAXXXXXXXXXXX
APT_TRIEI       LSNTDGLHYTIDILTEKCLEFKPDYVVGIESRGFIFGMPLAYQLNVGFIPVRKPGKLPAEVYSVSYDLEY
APT_RENSM       FADGAALRAVVDALVEPFAGQ-FDAVAGVEARGFLLXXXXXXXTGTGVITVRKAGKLPRAVYTEHYSLEY
APT_BOVIN       LKDPTSFRASINLLANHLKKAHIDYIAGLDSRGFLFGPSLAQELGLGCILIRKRGKLPGPTVCASYALEY
APT_BIFAA       LADARAFGILMGALALPVDVDDFDMVVGLEARGFLFGPALAARLGKGFIAVRKAGKLPPETMSQSYDLEY
APT_UREPA       FLEPKIIEKIVDDFADFAKSLNIDAIIGAESRGFLFAAPLSIKLNKPFILVRKPNKLPNDVYSAEYTLEY
APT_UREP2       FLEPKIIEKIVDDFADFAKSLNIDAIIGAESRGFLFAAPLSIKLNKPFILVRKPNKLPNDVYSAEYTLEY
APT_PSESM       FQSPKATRQVIDSFVQRYIDADFSHIGVMDARGFLIGSVVAYQLNKPLVLFRKQGKLPADVLSEAYQTEY
APT_PSEU2       FQSPKATRQVIDSFVQRYIDAEFSHIGVMDARGFLIGSVVAYQLNKPLVLFRKQGKLPADVLSEAYQTEY
APT_BLOPB       LKNPQAYSASITLLAYYYRNHKLTKVVGIEARGFLFSAPLALILKLGFIPARKSGRLPRDTIREPYILEY
APT_MYCHJ       LADGKALNYTIVEMAS--LAKDVDIIVGPDARGFLFGTPTAAFLSKPFIMIRKAGKLPGEVEEFAYELEY
APT_MYCH7       LADGKALNYTIVEMAS--LAKDVDIIVGPDARGFLFGTPTAAFLSKPFIMIRKAGKLPGEVEEFAYELEY
APT_MYCH2       LADGKALNYTIVEMAS--LAKDVDIIVGPDARGFLFGTPTAAFLSKPFIMIRKAGKLPGEVEEFAYELEY
APT_PELPB       IKDPVGFRLVIDSLTQHYLQEDFDVIVGIEARGFIIGGALSYALGKGFIPVRKPGKLPADVVSQEYQLEY
APT_ERWT9       LEDPKAYALSIELLVERYRHAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRKTFAEDYALEY
APT_DESRM       LQDAKAFKQAVDAMVGLCKDFDVDVIACPEARGFVLGAPMAYAMGKGLVLLRKPGKLPGKAVSHSYQLEY
APT_CHLCH       IKDPVGFRLVIDHLTQHYLEMDFDVIVGIEARGFIIGGALSYTLGKGFVPVRKPGKLPADVVSQEYELEY
APT_ANADE       LSDPHTFREVIDAFVGRWKGERVDKVIGIESRGFIFAAPIAYALGAGFTIVRKPGKLPWETIREVYALEY
APT_CHLPB       LKDPVGFRLVIDQLSQHYIENDFDMIVGMEARGFIIGGALSYTLGKGFVPIRKPGKLPGEVVDQEYQLEY
APT_THEEB       LQNQAGLRYVIDQLVEKHANAGIDYVAGIESRGFIFGAPLAYRLGAGFIPLRKPGKLCAPVYAVEYELEY
APT_BACFN       FKDSERLQELSDIMYEMYKDKGITKVVGIESRGFIMGPILATRLGAGFIPIRKPGKLPAETMEESYDKEY
APT_OENOB       IGNGPAYRQAINELIDFARPLKPDIIAGPEARGFVVGSPMAYALGIGFVPARKYGKLPRKSVSSSYSLEY
APT_EXISA       MQNGEVYKKSVDELVAYARERGAELIAGPEARGFVVGCPAAYALELGFVPVRKEGKLPRETVRVSYGLEY
APT_ANADF       LADPTTFREVIDAFVARWKDERISKVVGIESRXXXXXXXXXXXXXXXXTIARKPGKLPWETIREVYSLEY
APT_DICNV       LANGAGFKAAIEEMAMICERQNAIVLACPEARGFIFAAALAHRLGIGFIPLRKPHKLPREVAHINYGLEY
APT_CHLTE       IKDPVGFRLVIDNMTQHYLSNDFDAIVGIESRGFILGGALAYTLGKGFVPVRKPGKLPADVVQLEYELEY
APT_PSEAE       FQSPRALRMTVDSFVQRYIEADFSHIGAMDARGFLIGSAVAYALNKPLVLFRKQGKLPADVLAEGYQTEY
APT_PSEAB       FQSPRALRMTVDSFVQRYIEADFSHIGAMDARGFLIGSAVAYALNKPLVLFRKQGKLPADVLAEGYQTEY
APT_PSEA8       FQSPRALRMTVDSFVQRYIEADFSHIGAMDARGFLIGSAVAYALNKPLVLFRKQGKLPADVLAEGYQTEY
APT_PELUB       IKDADAFEECINQIIERSKNYKIDKIAAIESRGFVFASAVSYLLKKPFIMFRKKNKLPAETHSVDFELEY
APT_EUBR3       IQDADGLKLAIDEMIKRLDGLDFDVIAGAESRGFVFGMPIAYALHKPFVMVRKAGKLPCETVSKTYDLEY
APT_BLOFL       LENPHAYSACIKLLADHYKNHQLTKIVGVEARGFLFGSPLALILKLGFIPARKAGRLPRNTISESYVLEY
APT_BIFA0       FADSRXXXXXXXXXXXPVHTDEFDAVAGLEARGFLFGPALAAQLGKGFIAIRKAGKLPPPVHACSYALEY
APT_BEII9       LGDARAFRRAVDELVQPWAGTKVDKIAGMEARGFILGGAVAHQLSAGFVPIRKKGKLPHTTVSIAYSLEY
APT_BACTN       FKDPWCLQELSNIMFEMYKDKGITKVVGIESRGFIMGPILATRLNAGFIPIRKPGKLPAEVIEESYDKEY
APT_RHORT       LADPDAWQVTMGRMAKVVAPRLPDVLAGIESRGFLVAAPLALKLGLGFVMVRKKGKLPGATVRHEYALEY
APT_ACICJ       IRHADAWQVAMGRLAKVVRAHHPDLLAGVESRGFILAAPLALKLGCGFIMLRKRGKLPGATVGYDYDLEY
APT_RHOCS       LAHAEAWKATVEKLAEAVAPHKPDLLVGIESRGFLVAAPLSLALGCGFAMVRKKGKLPGQTIRYTYDLEY
APT_PSEU5       FQSPKALRMVADSFIQRYVEADFTHIGALDARGFLVGSILAYELNKPLVLFRKQGKLPADVLSQAYCTEY
APT_PSEA7       FQSPRALRMTVDSFVQRYIEADFSHIGAMDARGFLIGSAVAYALNKPLILFRKQGKLPADVLAEAYQTEY
APT_NATTJ       LKDPELLAEIIINLSSHYEKEVPDKIVGIESRGFILGPAIAKELGAGFVPARKGGKLPSKTASQEYNTEY
APT_CAMFF       LGNAKAFKFLLDHLEDRYKDENLDFIVGIESRGFILGAALSARLNLGFVPVRKPNKLPYITISQKYSLEY
APT_PARDP       FADARGFRMAVDQLLAAYAGEDIDKVVGLEARGFILGGAVAHQLSVGFVPIRKKGKLPGAVISQAYALEY
APT_CORK4       LADAGAFRLIVDELAEAARSYHADIIGGLDARGFLLGSAVAYQLGLGILAVRKEGKLPPPVFHRGYDLEY
APT_WOLSU       LNDPKAFGFLIDFLTDRYARFELDYVAGIESRGFIFGAALAAKLEVGFVPIRKKGKLPSTTIAEKYSLEY
APT_PSEST       FQSPKALRMVADSLIQRYVEADFTHIGALDARGFLVGSILAYELNKPLVLFRKQGKLPADVLSQAYSTEY
APT_PELLD       IKDPVGFRLVIDNLTQRYLENDFDVIVGIEARGFIIGSALAYALGKGFVPVRKPGKLPADTVSQEYALEY
APT_MARMS       FSDPKGMRMVVDAYVHRYIATDITHIACIDARGFLIAAVLAYELQKPLILVRKKGKLPGKTISQKYALEY
APT_TREDE       LVNPEVFSYCLDKMTEMYKDKKVDAVAAIEARGFIFAAPFAYKMGIPLILIRKKGKLPGETYSASYDLEY
APT_BACFR       FKDSERLQELSDIMYEMYKDKGITKV