[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA56724.1

[Show Plain Result]


## Summary of Sequence Search
    1::270
    5::271     2e-61  44%  271 aa  THTR_AZOVI RecName: Full=Thiosulfate sulfurtransferase;       
   35::280     5e-32  37%  286 aa  THTR_DEIRA RecName: Full=Thiosulfate sulfurtransferase;       
    1::275     1e-31  32%  277 aa  THTR_MYCTU RecName: Full=Putative thiosulfate sulfurtransferase;   
    1::275     1e-31  32%  277 aa  THTR1_MYCBO RecName: Full=Putative thiosulfate sulfurtransferase 1;
    1::275     3e-30  30%  277 aa  THTR_MYCLE RecName: Full=Putative thiosulfate sulfurtransferase;   
   26::289     6e-30  35%  301 aa  THTR_CORGL RecName: Full=Thiosulfate sulfurtransferase;       
   10::278     2e-28  29%  281 aa  THTM_ECOLI RecName: Full=3-mercaptopyruvate sulfurtransferase;     
   10::278     2e-28  29%  281 aa  THTM_ECO57 RecName: Full=3-mercaptopyruvate sulfurtransferase;     
   48::314     3e-28  35%  320 aa  THTR_SYNE7 RecName: Full=Putative thiosulfate sulfurtransferase;   
    1::274     8e-28  31%  281 aa  THTR_SACER RecName: Full=Putative thiosulfate sulfurtransferase;   
   52::279     1e-26  30%  297 aa  THTM_HUMAN RecName: Full=3-mercaptopyruvate sulfurtransferase;     
   41::280     2e-26  36%  297 aa  THT2_MYCBO RecName: Full=Putative thiosulfate sulfurtransferase
   52::279     4e-26  30%  297 aa  THTM_RAT RecName: Full=3-mercaptopyruvate sulfurtransferase;       
   41::285     5e-26  35%  296 aa  THT2_MYCLE RecName: Full=Putative thiosulfate sulfurtransferase
   41::280     9e-26  35%  297 aa  THT2_MYCTU RecName: Full=Putative thiosulfate sulfurtransferase
   44::279     2e-25  30%  297 aa  THTR_HUMAN RecName: Full=Thiosulfate sulfurtransferase;       
   52::279     2e-25  29%  297 aa  THTM_MOUSE RecName: Full=3-mercaptopyruvate sulfurtransferase;     
   44::279     4e-25  30%  297 aa  THTR_BOVIN RecName: Full=Thiosulfate sulfurtransferase;       
    1::249     4e-25  31%  320 aa  THTR2_MYCBO RecName: Full=Putative thiosulfate sulfurtransferase 2;
   44::279     5e-24  28%  297 aa  THTR_RAT RecName: Full=Thiosulfate sulfurtransferase;       
   44::279     7e-24  28%  297 aa  THTR_MOUSE RecName: Full=Thiosulfate sulfurtransferase;       
   44::279     1e-23  28%  297 aa  THTR_CRIGR RecName: Full=Thiosulfate sulfurtransferase;       
   38::278     4e-23  31%  286 aa  THTR_METTH RecName: Full=Putative thiosulfate sulfurtransferase;   
   43::285     6e-23  26%  289 aa  THTR_CHICK RecName: Full=Thiosulfate sulfurtransferase;       
   45::284     2e-17  27%  298 aa  THTM_SCHPO RecName: Full=Putative 3-mercaptopyruvate
  176::424     9e-16  27%  435 aa  YNJE_ECOLI RecName: Full=Putative thiosulfate sulfurtransferase
   18::280     9e-16  29%  284 aa  THTM_PSEAE RecName: Full=Probable 3-mercaptopyruvate
   32::279     3e-15  29%  284 aa  THT3_MYCTU RecName: Full=Putative thiosulfate sulfurtransferase
   50::290     2e-14  26%  304 aa  THTR_YEAST RecName: Full=Putative thiosulfate sulfurtransferase;   
   51::153     9e-08  33%  328 aa  THT2_CAEEL RecName: Full=Putative thiosulfate sulfurtransferase
   38::129     2e-06  36%  139 aa  YO285_YEAST RecName: Full=Putative thiosulfate sulfurtransferase
   57::168     3e-06  30%  277 aa  THT1_CAEEL RecName: Full=Putative thiosulfate sulfurtransferase
   73::166     2e-05  32%  171 aa  YAY7_SCHPO RecName: Full=Uncharacterized protein C4H3.07c;
   14::105     1e-04  37%  111 aa  HS6B_DROME RecName: Full=Heat shock protein 67B2;
 1182::1258    3e-04  36% 1404 aa  AKNA_MOUSE RecName: Full=AT-hook-containing transcription factor;
  327::444     4e-04  27%  455 aa  MOCS3_PIG RecName: Full=Adenylyltransferase and sulfurtransferase
    8::95      0.001  27%  106 aa  GLPE_PSE14 RecName: Full=Thiosulfate sulfurtransferase glpE;       
    1::270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAMFSLLLQPDELVRRLDEKNLLLIDLGSEESYLARHVPGAVHLDYTHIVAARPPVMGLLPDEHRLSRVL
THTR_AZOVI      -ASLPLVIEPADLQARLSAPELILVDLTSAARYAEGHIPGARFVDPKRTXXXXXXXXXXXXXREQLESLF
THTR_DEIRA      --------------------------------YETGHLPGAVKLDWQ--TDLWHPVERDFIEPQQVSELL
THTR_MYCTU      MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRHIAGAIKLDWR--TDLQDPVKRDFVDAQQFSKLL
THTR1_MYCBO     MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRHIAGAIKLDWR--TDLQDPVKRDFVDAQQFSKLL
THTR_MYCLE      MARSDVLVSADWAESNLDSANIVFVEVDEDTSYDGDHIAGAIKLDWR--ADLQDPIKRDFIDTQQFSKLL
THTR_CORGL      ------------LSARLGSPGLKVVE-SNEDSLLIGHLPGAVRIDWAKDL--NDPLTRDFIDGEAFAELM
THTM_ECOLI      ----------DWLAEHIDDPEIQIIDAGQEDEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAM
THTM_ECO57      ----------DWLAEHIDDPEIQIIDAGQEDEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAM
THTR_SYNE7      ---------PTWAAERLNNKQLKILDVRTNPAYIEGHLPGAVNIADA---AYRGP-NGFLPDPEKLASLF
THTR_SACER      MSREEVLVSTDWAEQNLNTDGVVFAEVDEDTTYDGGHIPGAIKLDWKNEL--QDHVRRDFVNREGFEKLL
THTM_HUMAN      -----------------------------------RHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYA
THT2_MYCBO      ------------------DEDVLLYDVG--------HIPGAVKIDW-HTDLNDPRVRDYINGE-QFAELM
THTM_RAT        -----------------------------------RHIPGAAFFDIDRCSDHTSPYDHMLPSATHFADYA
THT2_MYCLE      ------------------DENVLLYDVG--------HIPGAVKVDW-HTDLNDPKVRDYITGE-QFADLM
THT2_MYCTU      ------------------DEDVLLYDVG--------HIPGAVKIDW-HTDLNDPRVRDYINGE-QFAELM
THTR_HUMAN      ----------------------------ARKEYLERHVPGASFFDIEECRDTASPYEMMLPSEAGFAEYV
THTM_MOUSE      -----------------------------------RHIPGAAFFDIDRCSDHTSPYDHMLPNATHFADYA
THTR_BOVIN      ----------------------------ARKEYLERHVPGASFFDIEECRDKASPYEVMLPSEAGFADYV
THTR2_MYCBO     MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRHIAGAIKLDWR--TDLQDPVKRDFVDAQQFSKLL
THTR_RAT        ----------------------------ARKEYQERHVPGASFFDIEECRDTTSPYEMMLPSEAHFGDYV
THTR_MOUSE      ----------------------------ARKEYQERHVPGASFFDIEECRDTTSPYEMMLPSEAHFGDYV
THTR_CRIGR      ----------------------------ARKEYQERHVPGASFFDIEECRDTTSPYEMMLPSEAHFADYV
THTR_METTH      --------------------------------YILEHIPGAVYLNEGLFREPRGKAPAMYIPEGAVELIF
THTR_CHICK      ----------------------------ARQEFKERHIPGASFFNIEECRDKSSPYDFMLPSEAHFADYV
THTM_SCHPO      -----------------------------KKEYLESRLPGAQYFDIDEAKDHKNPLPHMLPPADEFASYV
YNJE_ECOLI      ---------------------------GAPKLYLISHIPGADYIDTNEVESE--PLWNKVSDE-QLKAML
THTM_PSEAE      ------------------EPDLLVLDCREDPSYGARHIPGAHFADLERDLSARKGVTGRLPDPAELALKL
THT3_MYCTU      ---------------RLDEPD-------GHAAYLQGHLPGAVFVDHTIAGRGRHP----LPSGASLQATV
THTR_YEAST      -------------------------------------IPNSIFFDIDAISDKKSPYPHMFPTKKVFDDAM
THT2_CAEEL      -----------------DFKNLMAEPSPSRNLYLAGHIPEAVHVD---LDIATYPSRYQRFQQYRFEEYA
YO285_YEAST     ----------------------------------------------------------------------
THT1_CAEEL      --------------------------------YLAEHINGAAHFNFDIAYYPSEDERFTLYTPEEFSSYV
YAY7_SCHPO      ----------------------------------------------------------------------
HS6B_DROME      ----------------------------------------------------------------------
AKNA_MOUSE      ----------------------------------------------------------------------
MOCS3_PIG       ------LLSPEERVSVIDYKRLLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLGEAIREGKQG
GLPE_PSE14      ---------PPEQAQALREQGAVLVDVRDAQTFQSNHIPDSVHL-----------------DNHSIADFI


                         .         .         *         .         .         .         .:140
query           SQLGFTPESHVVAYDAEGNGRASRLLWTLEELGHKHFSLLDGGLKAWLVEECPVKEGRESRQPSHFHGRY
THTR_AZOVI      GELGHRPEAVYVVYDDEGGGWAGRFIWLLDVIGQQRYHYLNGGLTAWLAEDRPLS--RELPAPAGGPVAL
THTR_DEIRA      GKLGIKADDTIVLYGDKSNWWASYAYWFLTYSGVSNLKIMNGGRQKW------VAEGREMXXXXXXXXXX
THTR_MYCTU      SERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASP
THTR1_MYCBO     SERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASP
THTR_MYCLE      GDRGISNDNTVILYGGNNNWFAAYAYWYFKLYRHDKVKLLDGGRKKWELDGRPLSTDTVTRPATSYAAAA
THTR_CORGL      NRKGIARDDTVVVYGDKSNWWAAFTLWVFELFGHSDVRLLNGGRDAWMAEEYVVPEYPSANYP--VVERV
THTM_ECOLI      RELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAF
THTM_ECO57      RELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAF
THTR_SYNE7      GRAGVSNNDTVLVY-SDGNDGATLVAYLLERSGVQNIAVLDGGYKGYKDAGLPVTKEYPRYQAARFAPKD
THTR_SACER      SAKGIGNDDTVILYGGNNNWFAAYAYWYFKLYGHSDVKLLDGGRKKWELD------GREKEEPNRAATAY
THTM_HUMAN      GRLGVGAATHVVIYDASDQGSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQL
THT2_MYCBO      DRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHADVRLLNGGRDLWLAEETTLDVPTKTCTGYPVVQRN
THTM_RAT        GSLGVSAATHVVIYDGSDQGSAPRVWWMFRAFGHHSVSLLDGGFRYWLSQNLPISSGKSPSEPAEFCAQL
THT2_MYCLE      NRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPNRN
THT2_MYCTU      DRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHADVRLLNGGRDLWLAEETTLDVPTKTCTGYPVVQRN
THTR_HUMAN      GRLGISNHTHVVVYDGEGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATL
THTM_MOUSE      GSLGVSAATHVVIYDGSDQGSAPRVWWMFRAFGHHSVSLLDGGFRHWLNQNLPISSGKSHSEPAEFSAQL
THTR_BOVIN      GSLGISNDTHVVVYDGDGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATL
THTR2_MYCBO     SERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASP
THTR_RAT        GNLGISNDTHVVVYDGDGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATL
THTR_MOUSE      GNLGISNDTHVVVYDGDGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATL
THTR_CRIGR      GSLGISNDTHVVVYDGDNLGSAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATL
THTR_METTH      QQAGIENRPXXXXXXXXXXXXXXXXLYSLARFGHENILVLNGGLAEWLTKVFPEVEGFSAVTKEDFYIEY
THTR_CHICK      GRLGVSNDTHVVVYDGDGTFYAPRAWWMFRAFGHREVSVLNGGFKNWVKEGHPVTAEPSQPAEAVFKAKL
THTM_SCHPO      GKLGIDRNTNVIIYDRKGFFSSPRVFWTFKVFGHEHVFLFPNAFNAWKTEGLELETGERTPKPVVYEGKL
YNJE_ECOLI      AKHGIRHDTTVILYGRDVYA-AARVAQIMLYAGVKDVRLLDGGWQTWSDAGLPVERGTPPKVKAEFGVKI
THTM_PSEAE      QAWGLRQDSQVVLYDDGPGAFAARAWWLLHWLGKRDVYXXXXXXXXXXXXXXXXTNGESSLRPGDFQGQP
THT3_MYCTU      RRCGIRHDVPVVVYDDWNRAGSARAWWVLTAAGIANVRILDGGLPAWRSAGGSIETGQVSPQLGNVTVLH
THTR_YEAST      SNLGVQKDDILVVYDRVGNFSSPRCAWTLGVMGHPKVYLLN-NFNQYREFKYPLDSSKVAAFSPYPKSHY
THT2_CAEEL      QMVGLNNKEHFIFYGKGAFGGASKVAWIFKSYGHENISLVDGGFDSW-----------------------
YO285_YEAST     ----------------------------------------------------------------------
THT1_CAEEL      KRLGVFNGDHLVIYGRGKDGAASRAYWTFRYYGYTTVSVLNGGIEAFVVQSDSKAEGIRCKDAIHF----
YAY7_SCHPO      ----------------------------------------------------------------------
HS6B_DROME      ----------------------------------------------------------------------
AKNA_MOUSE      ------------------------------------------------------------RERVSFRGQY
MOCS3_PIG       TQEGASLPIYVICKLGNDSQKAVKILQSLPDLDSLLVQDVVGGLMAW-----------------------
GLPE_PSE14      AKADLDKPLVVVCY--HGNSSQSAAAYLVGQ-GFSDVYSVDGGFELW-----------------------


                         +         .         .         .         .         *         .:210
query           QGHQAADKEYILAHLLDPKVVILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMDEL
THTR_AZOVI      SLHDTASRDYLLGRLGAADLAIWDARSPQEYRGEKVLAAKGGHIPGAVNFEWTAAMDPSRALRIRT--DI
THTR_DEIRA      XXXXLAYRDEVRAHLENGQGAMVDVRSPDEFSGKVTHMPRGGHIPGARNIPWAKATNEDGT--FKSADEL
THTR_MYCTU      PDNTRAFRDEVLAAINVKN--LIDVRSPDEFSGKILQSQRPGHIPGAINVPWSRAANEDGT--FKSDEEL
THTR1_MYCBO     PDNTRAFRDEVLAAINVKN--LIDVRSPDEFSGKILQSQRPGHIPGAINVPWSRAANEDGT--FKSDEEL
THTR_MYCLE      PDNTRAFRDEVIASIKIKNLV--DVRSPDEFSGKLLQSQRPGHIPSAINIPWSKAANEDGT--FKSDEQL
THTR_CORGL      DENQRAFVAEVLGSLTQSGMTLVDVRTPSEFSGSNTGVLRGGHIPGAINLDWSDAVLPNGNFRTRELDKL
THTM_ECOLI      NPEAVVKVTDVLLASHENTAQIIDARPAARFNAEVDEPRPGGHIPGALNVPWTELV---REGELKTTDEL
THTM_ECO57      NPEAVVKVTDVLLASHENTAQIIDARPAARFNAEVDEPRPGGHIPGALNVPWTELV---REGELKTTDEL
THTR_SYNE7      NRAFRVDIKQV--EQLTGKSTFVDPRPPALFSGEQQVFIRNGHIPGARNIPWTEANNANESLKLKPLSEL
THTR_SACER      KAQEPAFRDEVVDAIGNKNLV--DVRSPDEFAGKLLAAQRAGHIPSAINVPWSKAANEDGT--FKSDEEL
THTM_HUMAN      DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGGHIPGTVNIPFTDFLSQE-GLEKSP-EEI
THT2_MYCBO      DAPIRAFRDDVLA-ILDAQPLI-DVRSPEEYTGKRTHALRAGHIPTAVHIPWGKAADESG--RFRSREEL
THTM_RAT        DPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGGHIPGSVNIPFTEFLTSE-GLEKSP-EEI
THT2_MYCLE      DAPIRAFKDDVLAILGTQPLI--DVRSLDEYTGKCTEMPRAGHIPTARSIPWEMTVDKSG--RFRSSEEL
THT2_MYCTU      DAPIRAFRDDVLAIL--GAQPLIDVRSPEEYTGKRTHALRAGHIPTAVHIPWGKAADESG--RFRSREEL
THTR_HUMAN      DRSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDASGHIRGAVNMPFMDFLTEDG--FEKGPEEL
THTM_MOUSE      DPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGGHIPGSVNIPFTEFLTNE-GLEKSP-EEI
THTR_BOVIN      NRSLLKTYEQVLENLESKRFQLVDSRAQGRYLGTQPEPDASGHIRGSVNMPFMNFLTEDG--FEKSPEEL
THTR2_MYCBO     PDNTRAFRDEVLAAINVKN--LIDVRSPDEFSGKILQSQRPGHIPGAINVPWSRAANEDGT--FKSDEEL
THTR_RAT        NRSLLKTYEQVLENLQSKRFQLVDSRAQGRYLGTQPEPDASGHIRGSVNVPFMNFLTEDG--FEKSPEEL
THTR_MOUSE      NLSLLKTYEQVLENLQSKRFQLVDSRAQGRYLGTQIVGLDSGHIRGSVNMPFMDFLTKDG--FEKSPEEL
THTR_CRIGR      DRSLLKTYEQVLENLQSKRFQLVDSRAQGRYLGTEIVGLDSGHIRGSANMPFMNFLTEDG--FEKSPEEL
THTR_METTH      PEFKRIKD--------DEDVLLLDARPAEVYEGQGPWI-KPGHIPGAVNLPWADLMDPENRTLLKPEDEI
THTR_CHICK      DKTLLKTFEQAMENVGSKKFQVVDSRPAGRFQGELDQGLESGHIPGAVNMPFSTFLTESGH--EKSIEEI
THTM_SCHPO      NKDLVASFDDIVKVIESPDVHIVDARAHERFLGNVPESRPGGHIPTSINIPFTETTAAGITAP-KPEEDL
YNJE_ECOLI      QPQLMLDMEQARGLLHRQDASLVSIRSWPEFIGTYSYIKPKGEIAGA---RWGHAGSDSTHMEMRSADDI
THTM_PSEAE      DASLLIDXXXXXXXXXXXXXXXXXXRAQPRFRGEVEPIDPAGHIPGAQCAAFTDNLGSDG--RFLPPEQL
THT3_MYCTU      DDLYAGQRLTLTAQQAGAGVTLLDARVPERFRGDVEPVDAAGHIPGAINVPSGSVLADDGT--FLGNGAL
THTR_YEAST      ESSESQDKELVKSGELAKKFNAFDARSLGRFEGTEPEPRSSGHIPGTQPLPYGSLLDPETKTYPEAGEAI
THT2_CAEEL      ----------------------------------------------------------------------
YO285_YEAST     ----------------DPNVVLVDVREPSEYSIV--------HIPASINVPYRSHPDAFA------LDPL
THT1_CAEEL      ----------------------------------------------------------------------
YAY7_SCHPO      ----------------DKSTVLIDVREPDEFKQGAIETSY--NLPVGKIEEAMKLSDEEFSKTYKPVFE-
HS6B_DROME      -----------------PDVYLIDVRRKEEL-------QQTGFIPASINI---------------PLDEL
AKNA_MOUSE      TG-----QEY---HILSPKAILKDSGTPSCPHCHPIRTQDTG---SAVSRDTTRGSSAADTLRCALCGEV
MOCS3_PIG       ----------------------------------------------------------------------
GLPE_PSE14      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RSSLEALGITPDKEVICYCQTHHRSAHTCMVLKYLGYPKIKGYPGSWSEWGNAPDTPIKV
THTR_AZOVI      AGRLEELGITPDKEIVTHCQTHHRSGLTYLIAKALGYPRVKGYAGSWGEWGNHPDTPVEL
THTR_DEIRA      KALYEGEGVTADKDVIAYCRIAERSSHSWFVLRLLGYPKVRNYDGSWTEWGNGVGLPIE-
THTR_MYCTU      AKLYADAGLDNSKETIAYCRIGERSSHTWFVLRLLGHQNVKNYDGSWTEYGSLVGAPIEL
THTR1_MYCBO     AKLYADAGLDNSKETIAYCRIGERSSHTWFVLRLLGHQNVKNYDGSWTEYGSLVGAPIEL
THTR_MYCLE      AKLYADAGLDRLKETIVYCRIGERSSHTWFVLRLLGYQNVKNYDGSWTEYGSLVGVPIEL
THTR_CORGL      YADL-----NPADDTVVYCQVGDRAAHTWFVLKYLGFNNVRNYDGSWAEWGNMVRMPIE-
THTM_ECOLI      DAIFFGRGVSYDKPIIVSCGSGXXXXXXXXXXXXXXXPNVKLYDGAWSEWGARADLPVE-
THTM_ECO57      DAIFFGRGVSYDKPIIVSCGSGXXXXXXXXXXXXXXXPNVKLYDGAWSEWGARADLPVE-
THTR_SYNE7      KAILEAKGVTPDKDVIVTCSTGREASLQYLVLKHLKYPKVRIYEGSWTEY-SASNLPVE-
THTR_SACER      KQVYGEAGLDTDKDTIAYCRIGERSSHTWFVLRLLGHTNVKNYDGSWTEYGSLVGVPIE-
THTM_HUMAN      RHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEW----------
THT2_MYCBO      ERLYDF--INPDDQTVVYCRIGERSSHTWFVLTHLGKADVRNYDGSWTEWGNA-------
THTM_RAT        QRLFQEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKPDVPVYDGSWVEW----------
THT2_MYCLE      ERLYDF--ITPNDKTIVYCRIGERSSHTWFVLTHLGKPGVRNYDGSWTEWGNTVRVPI--
THT2_MYCTU      ERLYDF--INPDDQTVVYCRIGERSSHTWFVLTHLGKADVRNYDGSWTEWGNA-------
THTR_HUMAN      RALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEW----------
THTM_MOUSE      KRLFKEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKSDVPVYDGSWVEW----------
THTR_BOVIN      RAMFEAKKVDLTKPLIATCRKGVTACHIALAAYLCGKPDVAIYDGSWFEW----------
THTR2_MYCBO     AKLYADAGLDNSKETIAYCRIGERSSHTWFVLREL-------------------------
THTR_RAT        RAIFQDKKVDLSQPLIATCRKGVTACHIALAAYLCGKPDVAVYDGSWSEW----------
THTR_MOUSE      RAIFQDKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEW----------
THTR_CRIGR      RAIFQDKKVDLSQPLIATCRKGVTACHIALAAYLCGKPDVAVYDGSWSEW----------
THTR_METTH      LELVNSVGATPDRKIICSCGTGREATNEFLLFRYLGYPDVRIYEGSFTEWTQIEDNP---
THTR_CHICK      QQMFREKKVDLSKPLTATCRKGVTACHIALAAYLCGKPDVAVYDGSWSEWFHRAPPQYKV
THTM_SCHPO      EKVFSSHGLT-DKSVITSCGSGVTASVLFAALKECGFKDVRVYDESWSGYG---------
YNJE_ECOLI      TAMWKAWNIKPEQQVSFYCGTGWRASETFMYARAMGWKNVSVYDGGWYEWSSDPKNPV--
THTM_PSEAE      HQRFSALRGRPVDELVAYCGSGVTACHNLFALSLAGFPLPRLYAGSWSEWITDPRRPV--
THT3_MYCTU      NALLSDHGIDHGGRVGVYC-XXXXXXXXXXXXXXXXXQDAELFPGSWSEWSSDPTRPV--
THTR_YEAST      HATLEKCTLDPSKPTICSCGTGVSGVIIKTALELAGVPNVRLYDGSWTEW----------
THT2_CAEEL      ------------------------------------------------------------
YO285_YEAST     EFEKQIGIPKPDKELIFYCASGKRGGEAQKVASSHGYSNTSLYPGSMNDW----------
THT1_CAEEL      ------------------------------------------------------------
YAY7_SCHPO      ------------DNVVVYCRSGRRSTTASDILTKLGYKNIGNYTGSWLEWSD--------
HS6B_DROME      DKALNLDGSAPEKQIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEW----------
AKNA_MOUSE      KSSAEADG----------------------------------------------------
MOCS3_PIG       ------------------------------------------------------------
GLPE_PSE14      ------------------------------------------------------------