[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA56789.1

[Show Plain Result]


## Summary of Sequence Search
    1::307
   59::286     2e-32  36%  292 aa  MPTN_METMP RecName: Full=Tetrahydromethanopterin:alpha-L-glutamate
   57::291     5e-28  36%  291 aa  MPTN_METJA RecName: Full=Tetrahydromethanopterin:alpha-L-glutamate
    6::320     4e-23  31%  324 aa  MPTN_METMA RecName: Full=Tetrahydromethanopterin:alpha-L-glutamate
    6::313     7e-22  31%  324 aa  MPTN_METAC RecName: Full=Tetrahydromethanopterin:alpha-L-glutamate
    5::283     6e-18  32%  302 aa  RIMK_LEGPL RecName: Full=Ribosomal protein S6 modification protein;
    5::283     6e-18  32%  302 aa  RIMK_LEGPH RecName: Full=Ribosomal protein S6 modification protein;
    5::283     6e-18  32%  302 aa  RIMK_LEGPC RecName: Full=Ribosomal protein S6 modification protein;
    5::283     6e-18  32%  302 aa  RIMK_LEGPA RecName: Full=Ribosomal protein S6 modification protein;
    1::282     8e-16  31%  301 aa  RIMK_VIBVY RecName: Full=Ribosomal protein S6 modification protein;
    1::282     8e-16  31%  301 aa  RIMK_VIBVU RecName: Full=Ribosomal protein S6 modification protein;
   54::285     1e-15  35%  304 aa  RIMK2_HAHCH RecName: Full=Ribosomal protein S6 modification protein
    1::279     2e-15  32%  301 aa  RIMK_VIBSL RecName: Full=Ribosomal protein S6 modification protein;
   96::281     2e-15  35%  302 aa  RIMK_HAEIN RecName: Full=Ribosomal protein S6 modification protein;
    5::288     4e-15  29%  301 aa  RIMK_CELJU RecName: Full=Ribosomal protein S6 modification protein;
   84::286     5e-15  33%  313 aa  RIMK_PASMU RecName: Full=Ribosomal protein S6 modification protein;
    1::291     5e-15  28%  301 aa  RIMK1_SHEAM RecName: Full=Ribosomal protein S6 modification protein
   96::281     6e-15  35%  302 aa  RIMK_HAEIG RecName: Full=Ribosomal protein S6 modification protein;
   91::301     6e-15  30%  305 aa  RIMK_HAEDU RecName: Full=Ribosomal protein S6 modification protein;
    1::284     8e-15  31%  301 aa  RIMK_TERTT RecName: Full=Ribosomal protein S6 modification protein;
    1::299     8e-15  29%  300 aa  RIMK_SERP5 RecName: Full=Ribosomal protein S6 modification protein;
   92::279     8e-15  35%  298 aa  RIMK_HAEIE RecName: Full=Ribosomal protein S6 modification protein;
    1::282     1e-14  31%  301 aa  RIMK_SHELP RecName: Full=Ribosomal protein S6 modification protein;
    1::282     1e-14  31%  301 aa  RIMK_VIBPA RecName: Full=Ribosomal protein S6 modification protein;
   76::282     1e-14  31%  301 aa  RIMK_THISH RecName: Full=Ribosomal protein S6 modification protein;
  246::452     1e-14  31%  466 aa  RIMK_SYNPX RecName: Full=Ribosomal protein S6 modification protein;
    1::302     1e-14  29%  303 aa  RIMK_PECCP RecName: Full=Ribosomal protein S6 modification protein;
   96::283     1e-14  35%  302 aa  RIMK_HAEI8 RecName: Full=Ribosomal protein S6 modification protein;
    5::286     1e-14  30%  298 aa  RIMK_AERS4 RecName: Full=Ribosomal protein S6 modification protein;
    5::287     2e-14  31%  301 aa  RIMK_SACD2 RecName: Full=Ribosomal protein S6 modification protein;
   76::282     2e-14  32%  301 aa  RIMK_ALHEH RecName: Full=Ribosomal protein S6 modification protein;
   63::271     2e-14  28%  275 aa  LYSX_SULSO RecName: Full=Lysine biosynthesis protein lysX;
    1::299     2e-14  29%  300 aa  RIMK_ECO24 RecName: Full=Ribosomal protein S6 modification protein;
    5::286     2e-14  29%  298 aa  RIMK_AERHH RecName: Full=Ribosomal protein S6 modification protein;
   83::296     3e-14  31%  299 aa  RIMK_MANSM RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-14  30%  299 aa  RIMK2_SHESM RecName: Full=Ribosomal protein S6 modification protein
    1::282     3e-14  30%  299 aa  RIMK2_SHESA RecName: Full=Ribosomal protein S6 modification protein
    1::282     3e-14  30%  299 aa  RIMK1_SHESR RecName: Full=Ribosomal protein S6 modification protein
    1::299     4e-14  29%  300 aa  RIMK_SHISS RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_SHIFL RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_SHIF8 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_SHIDS RecName: Full=Ribosomal protein S6 modification protein;
    1::282     4e-14  31%  300 aa  RIMK_KLEP3 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOUT RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOSE RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOLU RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOLI RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOLC RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOL5 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOK1 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOHS RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECODH RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECOBW RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECO8A RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECO5E RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECO57 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECO55 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECO45 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     4e-14  29%  300 aa  RIMK_ECO27 RecName: Full=Ribosomal protein S6 modification protein;
    1::282     4e-14  32%  300 aa  RIMK_CITK8 RecName: Full=Ribosomal protein S6 modification protein;
    1::282     4e-14  29%  301 aa  RIMK2_SHESW RecName: Full=Ribosomal protein S6 modification protein
    1::282     4e-14  30%  299 aa  RIMK2_SHEON RecName: Full=Ribosomal protein S6 modification protein
    1::282     4e-14  29%  301 aa  RIMK2_SHEB5 RecName: Full=Ribosomal protein S6 modification protein
    1::282     4e-14  29%  301 aa  RIMK1_SHEPC RecName: Full=Ribosomal protein S6 modification protein
    1::282     4e-14  29%  301 aa  RIMK1_SHEB9 RecName: Full=Ribosomal protein S6 modification protein
    1::282     4e-14  29%  301 aa  RIMK1_SHEB8 RecName: Full=Ribosomal protein S6 modification protein
    1::299     5e-14  31%  300 aa  RIMK_ECOSM RecName: Full=Ribosomal protein S6 modification protein;
    1::299     5e-14  31%  300 aa  RIMK_ECO7I RecName: Full=Ribosomal protein S6 modification protein;
    1::299     7e-14  29%  300 aa  RIMK_SHIB3 RecName: Full=Ribosomal protein S6 modification protein;
    1::282     7e-14  30%  298 aa  RIMK2_SHEFN RecName: Full=Ribosomal protein S6 modification protein
   76::282     7e-14  32%  303 aa  RIMK1_HAHCH RecName: Full=Ribosomal protein S6 modification protein
  167::453     9e-14  27%  458 aa  RIMK_SHEPA RecName: Full=Ribosomal protein S6 modification protein;
   89::286     1e-13  32%  301 aa  RIMK_SYNP2 RecName: Full=Ribosomal protein S6 modification protein;
  167::453     1e-13  28%  458 aa  RIMK_SHEHH RecName: Full=Ribosomal protein S6 modification protein;
   76::286     1e-13  33%  301 aa  RIMK_PSEPK RecName: Full=Ribosomal protein S6 modification protein;
   76::286     1e-13  33%  301 aa  RIMK_PSEP1 RecName: Full=Ribosomal protein S6 modification protein;
   96::286     1e-13  34%  299 aa  RIMK_HAES2 RecName: Full=Ribosomal protein S6 modification protein;
   96::286     1e-13  34%  299 aa  RIMK_HAES1 RecName: Full=Ribosomal protein S6 modification protein;
    1::284     1e-13  29%  300 aa  RIMK_ESCF3 RecName: Full=Ribosomal protein S6 modification protein;
    1::282     2e-13  30%  301 aa  RIMK_IDILO RecName: Full=Ribosomal protein S6 modification protein;
    1::282     2e-13  30%  295 aa  RIMK1_SHEDO RecName: Full=Ribosomal protein S6 modification protein
    5::284     2e-13  29%  301 aa  RIMK_VIBCM RecName: Full=Ribosomal protein S6 modification protein;
    5::284     2e-13  29%  301 aa  RIMK_VIBCH RecName: Full=Ribosomal protein S6 modification protein;
    5::284     2e-13  29%  301 aa  RIMK_VIBC3 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     2e-13  28%  300 aa  RIMK_SHIBS RecName: Full=Ribosomal protein S6 modification protein;
    1::299     2e-13  29%  300 aa  RIMK_ECOL6 RecName: Full=Ribosomal protein S6 modification protein;
    1::299     2e-13  29%  300 aa  RIMK_ECO81 RecName: Full=Ribosomal protein S6 modification protein;
    4::294     3e-13  28%  302 aa  RIMK_PSYIN RecName: Full=Ribosomal protein S6 modification protein;
   76::286     3e-13  33%  301 aa  RIMK_PSEFS RecName: Full=Ribosomal protein S6 modification protein;
   76::286     4e-13  33%  301 aa  RIMK_PSEF5 RecName: Full=Ribosomal protein S6 modification protein;
   88::299     4e-13  29%  300 aa  RIMK_ENT38 RecName: Full=Ribosomal protein S6 modification protein;
   76::286     5e-13  33%  301 aa  RIMK_PSEPF RecName: Full=Ribosomal protein S6 modification protein;
    5::293     5e-13  29%  301 aa  RIMK1_SHEFN RecName: Full=Ribosomal protein S6 modification protein
   76::282     6e-13  29%  301 aa  RIMK_DESAD RecName: Full=Ribosomal protein S6 modification protein;
   76::293     1e-12  33%  295 aa  RIMK_XANOR RecName: Full=Ribosomal protein S6 modification protein;
   76::293     1e-12  33%  295 aa  RIMK_XANOM RecName: Full=Ribosomal protein S6 modification protein;
   76::286     1e-12  33%  301 aa  RIMK_PSEPW RecName: Full=Ribosomal protein S6 modification protein;
   76::286     1e-12  33%  301 aa  RIMK_PSEPG RecName: Full=Ribosomal protein S6 modification protein;
   51::286     1e-12  32%  301 aa  RIMK_PSEMY RecName: Full=Ribosomal protein S6 modification protein;
   79::281     1e-12  27%  285 aa  LYSX_SULTO RecName: Full=Lysine biosynthesis protein lysX;
    5::292     1e-12  28%  301 aa  RIMK_PSEHT RecName: Full=Ribosomal protein S6 modification protein;
   76::282     1e-12  31%  301 aa  RIMK_MARAV RecName: Full=Ribosomal protein S6 modification protein;
   76::284     1e-12  32%  302 aa  RIMK_ALCBS RecName: Full=Ribosomal protein S6 modification protein;
   13::279     1e-12  28%  301 aa  RIMK2_SHEAM RecName: Full=Ribosomal protein S6 modification protein
    5::286     2e-12  31%  301 aa  RIMK_PSEE4 RecName: Full=Ribosomal protein S6 modification protein;
   37::279     2e-12  30%  303 aa  RIMK_ERWCT RecName: Full=Ribosomal protein S6 modification protein;
    1::282     2e-12  30%  300 aa  RIMK_SALSV RecName: Full=Ribosomal protein S6 modification protein;
    5::286     2e-12  31%  301 aa  RIMK_PSEU5 RecName: Full=Ribosomal protein S6 modification protein;
    5::282     2e-12  28%  302 aa  RIMK_HALHL RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALTY RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALTI RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALPK RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALPC RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALPB RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALPA RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALNS RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALHS RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALG2 RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALEP RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALDC RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALCH RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-12  30%  300 aa  RIMK_SALA4 RecName: Full=Ribosomal protein S6 modification protein;
   76::286     3e-12  32%  301 aa  RIMK_PSESM RecName: Full=Ribosomal protein S6 modification protein;
   76::286     3e-12  32%  301 aa  RIMK_PSE14 RecName: Full=Ribosomal protein S6 modification protein;
    5::282     3e-12  28%  302 aa  RIMK1_PSEA6 RecName: Full=Ribosomal protein S6 modification protein
   76::282     4e-12  27%  405 aa  RIMK_RHOBA RecName: Full=Ribosomal protein S6 modification protein;
   76::286     4e-12  33%  301 aa  RIMK_PSEAE RecName: Full=Ribosomal protein S6 modification protein;
   76::286     4e-12  33%  301 aa  RIMK_PSEAB RecName: Full=Ribosomal protein S6 modification protein;
   76::286     4e-12  33%  301 aa  RIMK_PSEA8 RecName: Full=Ribosomal protein S6 modification protein;
   76::286     4e-12  33%  301 aa  RIMK_PSEA7 RecName: Full=Ribosomal protein S6 modification protein;
    5::282     4e-12  29%  301 aa  RIMK_ERYLH RecName: Full=Ribosomal protein S6 modification protein;
   76::286     4e-12  31%  301 aa  RIMK_AZOVD RecName: Full=Ribosomal protein S6 modification protein;
   76::282     5e-12  32%  301 aa  RIMK_PSEU2 RecName: Full=Ribosomal protein S6 modification protein;
    5::282     5e-12  28%  301 aa  RIMK_PHOPR RecName: Full=Ribosomal protein S6 modification protein;
   76::282     7e-12  30%  301 aa  RIMK_VIBFM RecName: Full=Ribosomal protein S6 modification protein;
   76::282     7e-12  30%  301 aa  RIMK_VIBF1 RecName: Full=Ribosomal protein S6 modification protein;
    5::279     7e-12  30%  301 aa  RIMK_NITOC RecName: Full=Ribosomal protein S6 modification protein;
    5::282     9e-12  29%  301 aa  RIMK_THICR RecName: Full=Ribosomal protein S6 modification protein;
   76::286     1e-11  31%  291 aa  RIMK_XANCP RecName: Full=Ribosomal protein S6 modification protein;
   76::286     1e-11  31%  291 aa  RIMK_XANC8 RecName: Full=Ribosomal protein S6 modification protein;
   76::290     1e-11  30%  299 aa  RIMK_TRIEI RecName: Full=Ribosomal protein S6 modification protein;
   76::279     1e-11  30%  301 aa  RIMK_MARMM RecName: Full=Ribosomal protein S6 modification protein;
   13::278     1e-11  28%  301 aa  RIMK2_SHESR RecName: Full=Ribosomal protein S6 modification protein
   13::278     1e-11  28%  301 aa  RIMK1_SHESM RecName: Full=Ribosomal protein S6 modification protein
   13::278     1e-11  28%  301 aa  RIMK1_SHEON RecName: Full=Ribosomal protein S6 modification protein
   88::284     2e-11  30%  301 aa  RIMK_PELCD RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-11  31%  301 aa  RIMK_COXBU RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-11  31%  301 aa  RIMK_COXBR RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-11  31%  301 aa  RIMK_COXBN RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-11  31%  301 aa  RIMK_COXB2 RecName: Full=Ribosomal protein S6 modification protein;
    1::282     3e-11  31%  301 aa  RIMK_COXB1 RecName: Full=Ribosomal protein S6 modification protein;
   76::286     3e-11  31%  291 aa  RIMK_XANCB RecName: Full=Ribosomal protein S6 modification protein;
    5::282     3e-11  27%  301 aa  RIMK_ALISL RecName: Full=Ribosomal protein S6 modification protein;
   13::278     3e-11  29%  301 aa  RIMK1_SHESA RecName: Full=Ribosomal protein S6 modification protein
   13::278     4e-11  28%  301 aa  RIMK2_SHEPC RecName: Full=Ribosomal protein S6 modification protein
   13::278     4e-11  28%  301 aa  RIMK1_SHESW RecName: Full=Ribosomal protein S6 modification protein
   76::282     7e-11  31%  301 aa  RIMK_METBU RecName: Full=Ribosomal protein S6 modification protein;
    1::282     1e-10  30%  301 aa  RIMK_ALTMD RecName: Full=Ribosomal protein S6 modification protein;
   76::293     2e-10  29%  295 aa  RIMK_XANC5 RecName: Full=Ribosomal protein S6 modification protein;
   76::286     2e-10  30%  292 aa  RIMK_STRMK RecName: Full=Ribosomal protein S6 modification protein;
   76::286     3e-10  29%  292 aa  RIMK_STRM5 RecName: Full=Ribosomal protein S6 modification protein;
   13::278     3e-10  28%  301 aa  RIMK2_SHEB9 RecName: Full=Ribosomal protein S6 modification protein
   13::278     3e-10  28%  301 aa  RIMK2_SHEB8 RecName: Full=Ribosomal protein S6 modification protein
   13::278     3e-10  28%  301 aa  RIMK1_SHEB5 RecName: Full=Ribosomal protein S6 modification protein
   70::265     3e-10  23%  285 aa  COFF_METMP RecName: Full=Gamma-F420-2:alpha-L-glutamate ligase;    
   76::293     5e-10  29%  295 aa  RIMK_XANAC RecName: Full=Ribosomal protein S6 modification protein;
    5::286     6e-10  27%  301 aa  RIMK_MARMS RecName: Full=Ribosomal protein S6 modification protein;
    5::288     1e-09  26%  301 aa  RIMK2_PSEA6 RecName: Full=Ribosomal protein S6 modification protein
    5::282     2e-09  27%  302 aa  RIMK_CHRSD RecName: Full=Ribosomal protein S6 modification protein;
    5::279     2e-09  27%  301 aa  RIMK2_SHEDO RecName: Full=Ribosomal protein S6 modification protein
   89::290     3e-09  29%  301 aa  RIMK_XYLFT RecName: Full=Ribosomal protein S6 modification protein;
   89::290     3e-09  29%  301 aa  RIMK_XYLF2 RecName: Full=Ribosomal protein S6 modification protein;
   89::290     7e-09  29%  301 aa  RIMK_XYLFM RecName: Full=Ribosomal protein S6 modification protein;
   76::290     2e-07  24%  296 aa  RIMK_SODGM RecName: Full=Ribosomal protein S6 modification protein;
  169::454     4e-07  29%  464 aa  RIMK_DESPS RecName: Full=Ribosomal protein S6 modification protein;
   96::305     8e-07  33%  307 aa  GSHB_SYNPX RecName: Full=Glutathione synthetase;       
   63::284     2e-06  24%  288 aa  COFF_METJA RecName: Full=Gamma-F420-2:alpha-L-glutamate ligase;    
   67::305     4e-06  24%  405 aa  RIMKB_DANRE RecName: Full=Ribosomal protein S6 modification-like
  145::273     9e-06  39%  308 aa  GSHB_ANACE RecName: Full=Glutathione synthetase;       
  104::305     2e-05  25%  307 aa  GSHB_PROMP RecName: Full=Glutathione synthetase;       
   91::279     5e-05  30%  314 aa  DDL_PSEU5 RecName: Full=D-alanine--D-alanine ligase;       
   59::287     1e-04  30%  318 aa  DDL_XANAC RecName: Full=D-alanine--D-alanine ligase;       
  104::269     2e-04  28%  308 aa  GSHB_PROMM RecName: Full=Glutathione synthetase;       
  138::288     5e-04  30%  310 aa  DDL_PELPD RecName: Full=D-alanine--D-alanine ligase;       
   89::300     7e-04  21%  387 aa  RIMKB_MOUSE RecName: Full=Ribosomal protein S6 modification-like
   89::300     7e-04  20%  386 aa  RIMKB_HUMAN RecName: Full=Ribosomal protein S6 modification-like
   89::300     7e-04  20%  386 aa  RIMKB_BOVIN RecName: Full=Ribosomal protein S6 modification-like
  141::233     9e-04  33%  575 aa  CH61_CUCMA RecName: Full=Chaperonin CPN60-1, mitochondrial;AltName:
    1::307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAAIVRGIAAGSF
MPTN_METMP      -----------------------------------------------------------AFVRNIGEGV-
MPTN_METJA      ---------------------------------------------------------DCCFVRNLGWDSF
MPTN_METMA      ----IAITDPEDWTARALIKAAKEKGFSPLVFDLSDAEVRIGSPASIFKAGLLSDL-DALIVRDVGAGAF
MPTN_METAC      ----IAITDPEDWTARALITAAKEKGFFPFILDLRIAEVSISSPATLFKAGLLSDL-DALIVRDVGAGAF
RIMK_LEGPL      ----ILATNPHLYSHKRLEAEAAGHEVKIINPLYCYMNVAASNPK-VHYRG-GAPLPDAVIPRIGASITY
RIMK_LEGPH      ----ILATNPHLYSHKRLEAEAAGHEVKIINPLYCYMNVAASNPK-VHYRG-GAPLPDAVIPRIGASITY
RIMK_LEGPC      ----ILATNPHLYSHKRLEAEAAGHEVKIINPLYCYMNVAASNPK-VHYRG-GAPLPDAVIPRIGASITY
RIMK_LEGPA      ----ILATNPHLYSHKRLEAEAAGHEVKIINPLYCYMNVAASNPK-VHYRG-GAPLPDAVIPRIGASITY
RIMK_VIBVY      -MRIAILSRNENLYSTRLKQAGEARGHEVDVIDTLHCYMDITS-NNPKIRYKGEELPDAIIPRIGASVTF
RIMK_VIBVU      -MRIAILSRNENLYSTRLKQAGEARGHEVDVIDTLHCYMDITS-NNPKIRYKGEELPDAIIPRIGASVTF
RIMK2_HAHCH     --------------------------------------------------GVSEELQFDAVIPRIGASV-
RIMK_VIBSL      -MRIAILSRNENLYSSRLKAAGEARGHQVDVIDTLHCDIDIAS-NNPKIRYMGEELPDAVIPRIGASITF
RIMK_HAEIN      ----------------------------------------------------------------------
RIMK_CELJU      ----ILSRNRRLYSTRRLVEACTQRGHEVRVIDILKCYIDIASASPA-IWYMGEKLEDAVIPRIGASVTH
RIMK_PASMU      ----------------------------------------------------------------------
RIMK1_SHEAM     -MRIAVLSQGPELYSRRLVEAAKERGHEVRVINPLECYMNINMASSIHIAGEELPIFDAVIPRIGSAITF
RIMK_HAEIG      ----------------------------------------------------------------------
RIMK_HAEDU      ----------------------------------------------------------------------
RIMK_TERTT      -MRIAILSRGPALYSRRLKEAAELRGHEVHIIDTLHCYMDITS-SKPAVRYDGEELPDAVIPRIGASITF
RIMK_SERP5      -MKIAILSRDGTLYSKRLVEAAEQRGHSIEVIDPLSCYMNINPAAPIHYRGRQLERYDAVIPRIGSAMTF
RIMK_HAEIE      ----------------------------------------------------------------------
RIMK_SHELP      -MRIAILSRNENLYSTQLKEAGEARGHEVDIIDTLHCYMDITS-SNPTVRYMGKVLPDAVIPRIGSSITF
RIMK_VIBPA      -MRIAILSRNENLYSTRLKQAGEERGHQIDVIDTLHCYMDITSNNPM-IRYKGEELPDAVIPRIGASITF
RIMK_THISH      ----------------------------------------------------------------------
RIMK_SYNPX      ----------------------------------------------------------------------
RIMK_PECCP      -MKIAILSRDGALYSKRLREAAEARKHSVEIIDPLSCYMNINSAASVHYRGRRLDKYDAVIPR---IGS-
RIMK_HAEI8      ----------------------------------------------------------------------
RIMK_AERS4      ----ILSREPRNYSTRRLVEVAQARGHQVEVLDTLRCYMNIASHSSIHYEGRELESYDAVIPRIGASITF
RIMK_SACD2      ----VLSRNPNLYSTRRLKEAGEARGHTVDIIDTLHCYMDI-TMSRPAVRYHGEELPDAVIPRIGASITF
RIMK_ALHEH      ----------------------------------------------------------------------
LYSX_SULSO      ----------------------------------------------------------------------
RIMK_ECO24      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_AERHH      ----ILSREPNNYSTRRLVEVAQARGHQVEVLDTLRCYMNIASHNSIHYEGRELESYDAVIPRIGASITF
RIMK_MANSM      ----------------------------------------------------------------------
RIMK2_SHESM     -MRIAILSQGPELYSKRLVEAATLRGHEVKVINPLECYMNINMQSSIHIGG--EELPDAVIPRIGASITF
RIMK2_SHESA     -MRIAILSQGPELYSKRLVEAATLRGHEVKVINPLECYMNINMQSSIHIGG--EELPDAVIPRIGASITF
RIMK1_SHESR     -MRIAILSQGPELYSKRLVEAATLRGHEVKVINPLECYMNINMQSSIHIGG--EELPDAVIPRIGASITF
RIMK_SHISS      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_SHIFL      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIYYKGRKLPDAVIPRGTAITFY
RIMK_SHIF8      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIYYKGRKLPDAVIPRGTAITFY
RIMK_SHIDS      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_KLEP3      -MKIAILSRDGTLYSRRLREAAQQRGHQVEILDPLSCYMNV-SPVASSIHYKGRQLPDAVIPRGSAITYY
RIMK_ECOUT      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOSE      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOLU      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOLI      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOLC      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOL5      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOK1      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOHS      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECODH      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOBW      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECO8A      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECO5E      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECO57      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECO55      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECO45      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECO27      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_CITK8      -MKIAILSRDGTLYSKRLREAAMKRGHLVEILDPLSCYMNI-SPAASSIHYKGRQLPDAVIPRIGSAITF
RIMK2_SHESW     -MRIAILSQGPELYSKRLVEAAQLRGHEVHVINPLECYMNINMQSSIHIGGRELPTFDAVIPRIGASITF
RIMK2_SHEON     -MRIAILSQGPELYSKRLVEAATLRGHEVKVINPLECYMNINMQSSIHIGG--EELPDAVIPRIGASITF
RIMK2_SHEB5     -MRIAILSQGPELYSKRLVEAAQLRGHEVHVINPLECYMNINMQSSIHIGGRELPAFDAVIPRIGASITF
RIMK1_SHEPC     -MRIAILSQGPELYSKRLVEAAQLRGHEVHVINPLECYMNINMQSSIHIGGRELPTFDAVIPRIGASITF
RIMK1_SHEB9     -MRIAILSQGPELYSKRLVEAAQLRGHEVHVINPLECYMNINMQSSIHIGGRELPAFDAVIPRIGASITF
RIMK1_SHEB8     -MRIAILSQGPELYSKRLVEAAQLRGHEVHVINPLECYMNINMQSSIHIGGRELPAFDAVIPRIGASITF
RIMK_ECOSM      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECO7I      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_SHIB3      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK2_SHEFN     -MRIAILSQGPQLYSTKVEAALARHEVKVINPLKCYMNINMTKPS-IHMAGKDLGHFDAVIPRIGASVTF
RIMK1_HAHCH     ----------------------------------------------------------------------
RIMK_SHEPA      ----LLASNPDLYSNRRIIEAGEQRGHEMVFLNISQCYLKLDSPEVHYRGGRVLNNVDAVIPRIRPSMTF
RIMK_SYNP2      ----------------------------------------------------------------------
RIMK_SHEHH      ----LLASNPDLYSNRRIIEAGEQRGHEMVFLNIKQCYLKLDSEPEVHYRGILNDL-DAVIPRIRPSMTF
RIMK_PSEPK      ----------------------------------------------------------------------
RIMK_PSEP1      ----------------------------------------------------------------------
RIMK_HAES2      ----------------------------------------------------------------------
RIMK_HAES1      ----------------------------------------------------------------------
RIMK_ESCF3      -MKIAILSRDGTLYSKRLREAAIQRGHLVEVLDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRIGSAITF
RIMK_IDILO      -MRIAILSNASLYSTRRLVEAAEERGHEVDVLNPLRCYMNINAESSIHKHGKELPHYDCVIPRIGASVTF
RIMK1_SHEDO     -MRIAILSQGPQLYSKRLVEAAQARGHDVHIINPLKCNINMRQPS-IHIAGKELPQFDAVIPRIGASITF
RIMK_VIBCM      ----ILSRNASLYSTKRLIEACKQRGVRVIDALRCYMNINSDKPE-IHYKGEELAGFDAVIPRIGASVTF
RIMK_VIBCH      ----ILSRNASLYSTKRLIEACKQRGVRVIDALRCYMNINSDKPE-IHYKGEELAGFDAVIPRIGASVTF
RIMK_VIBC3      ----ILSRNASLYSTKRLIEACKQRGVRVIDALRCYMNINSDKPE-IHYKGEELAGFDAVIPRIGASVTF
RIMK_SHIBS      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECOL6      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_ECO81      -MKIAILSRDGTLYSKRLREAAIQRGHLVEILDPLSCYMNIN-PAASSIHYKGRKLPDAVIPRGTAITFY
RIMK_PSYIN      ---VILSRNKSLYSTRRLKEEGEARGHQIDIIDTLHCYMDITS-SRPTVRYQGEELPDALIPRIGASVTF
RIMK_PSEFS      ----------------------------------------------------------------------
RIMK_PSEF5      ----------------------------------------------------------------------
RIMK_ENT38      ----------------------------------------------------------------------
RIMK_PSEPF      ----------------------------------------------------------------------
RIMK1_SHEFN     ----IMSRNKNLYSTSRLKEAAEARGHVIKIVDPLKCNINMNAPS-IHVRG--EELPDAVIPRIGASVTF
RIMK_DESAD      ----------------------------------------------------------------------
RIMK_XANOR      ----------------------------------------------------------------------
RIMK_XANOM      ----------------------------------------------------------------------
RIMK_PSEPW      ----------------------------------------------------------------------
RIMK_PSEPG      ----------------------------------------------------------------------
RIMK_PSEMY      --------------------------------------------------------------RGRALEGF
LYSX_SULTO      ----------------------------------------------------------------------
RIMK_PSEHT      ----ILSRNKKLYSTRRLIEAAEARGHEVKVVDALRCYMNINSEPEIHYRGENLKGFDAVIPRIGASVTF
RIMK_MARAV      ----------------------------------------------------------------------
RIMK_ALCBS      ----------------------------------------------------------------------
RIMK2_SHEAM     ------------YSTRRLVEACESRGHEAWVINPINCYMNINSVKSIHLEGEEVPMFDAIIPRIHASVTF
RIMK_PSEE4      ----VLSRNPRLYSTRRLVEAGTQRGVVVIDTLRAYMNIASHKPQ-IHYRGKPLEGFDAVIPRIGASVTF
RIMK_ERWCT      ------------------------------------CYMNINSAASVHYRGRRLDKFDAVIPR---IGS-
RIMK_SALSV      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNINAASSIHYKGRRLPHYDAVIPRGSAITFY
RIMK_PSEU5      ----VLSRNPRLYSTRRLVEAGEQRGVVVIDTLRAYMNIASHKPQ-IHYRGKPLEGFDAVIPRIGASVTF
RIMK_HALHL      ----VLSRNSRLYSTRRLMEAAQSRGHQIRVVDPLRCYMNITSNPEIHYKGQKLEAFDAVIPRIGASITF
RIMK_SALTY      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALTI      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALPK      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALPC      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALPB      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALPA      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALNS      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALHS      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALG2      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALEP      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALDC      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALCH      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_SALA4      -MKIAILSRDGTLYSKRLREAAMRRGHLVEILDPLSCYMNIN-PAASSIHYKGRRLPDAVIPRGSAITFY
RIMK_PSESM      ----------------------------------------------------------------------
RIMK_PSE14      ----------------------------------------------------------------------
RIMK1_PSEA6     ----ILSRNKKLYSTRRLQEAALARGHEVDIIDTLHCYMDISSPS---VRFKGEPLPQYAIIPRIGASIT
RIMK_RHOBA      ----------------------------------------------------------------------
RIMK_PSEAE      ----------------------------------------------------------------------
RIMK_PSEAB      ----------------------------------------------------------------------
RIMK_PSEA8      ----------------------------------------------------------------------
RIMK_PSEA7      ----------------------------------------------------------------------
RIMK_ERYLH      ----MLARNPNLYSHKRLVEAAEKRGHSLDILNTTRCTVNIASHNGETIKGY-----DAVIPRGASITNY
RIMK_AZOVD      ----------------------------------------------------------------------
RIMK_PSEU2      ----------------------------------------------------------------------
RIMK_PHOPR      ----ILSQNETLYSTRRLREACEARGHEAVIINALRCYMNINSVQSIHFEGNDLTGFDAIIPRIGADITF
RIMK_VIBFM      ----------------------------------------------------------------------
RIMK_VIBF1      ----------------------------------------------------------------------
RIMK_NITOC      ----VLSRNAKLYSTRRLVEAAKTRGHEVRVLDVLRCYMNIAS----HRPSIGEDLTDAVIPRIGASVTF
RIMK_THICR      ----ILSRNAKLYSTRRLIEAAEERGHEVRVIDALRCYMNISSNHPVHYKGEVLDGFDAIIPRIGASITF
RIMK_XANCP      ----------------------------------------------------------------------
RIMK_XANC8      ----------------------------------------------------------------------
RIMK_TRIEI      ----------------------------------------------------------------------
RIMK_MARMM      ----------------------------------------------------------------------
RIMK2_SHESR     ------------YSTRRLVAACESRGHEAVVINTLNCYMNINSPS-IHYQGQELTGFDAIIPRIHASVTF
RIMK1_SHESM     ------------YSTRRLVAACESRGHEAVVINTLNCYMNINSPS-IHYQGQELTGFDAIIPRIHASVTF
RIMK1_SHEON     ------------YSTRRLVAACESRGHEAVVINTLNCYMNINSPS-IHYQGQELTGFDAIIPRIHASVTF
RIMK_PELCD      ----------------------------------------------------------------------
RIMK_COXBU      -MKIAILSTKQELSSTQREAALA-RGHKVKIINTLRCYMSLSQEKPIHYMGKELARYDAVIPRIGASITF
RIMK_COXBR      -MKIAILSTKQELSSTQREAALA-RGHKVKIINTLRCYMSLSQEKPIHYMGKELARYDAVIPRIGASITF
RIMK_COXBN      -MKIAILSTKQELSSTQREAALA-RGHKVKIINTLRCYMSLSQEKPIHYMGKELARYDAVIPRIGASITF
RIMK_COXB2      -MKIAILSTKQELSSTQREAALA-RGHKVKIINTLRCYMSLSQEKPIHYMGKELARYDAVIPRIGASITF
RIMK_COXB1      -MKIAILSTKQELSSTQREAALA-RGHKVKIINTLRCYMSLSQEKPIHYMGKELARYDAVIPRIGASITF
RIMK_XANCB      ----------------------------------------------------------------------
RIMK_ALISL      ----ILSRNQDLYSTRRLIEAAESRGHEVKVIDALRCYMNINSEKPIHFKGEELINYDAIIPRIGASVTF
RIMK1_SHESA     ------------YSTRRLVAACESRGHEAVVINTLNCYMNINSPS-IHYQGQELTGFDAIIPRIHASVTF
RIMK2_SHEPC     ------------YSTQRLVAACESRGHEAVVINTLNCYMNINSPS-IHYEGQELVGFDAIIPRIHASVTF
RIMK1_SHESW     ------------YSTQRLVAACESRGHEAVVINTLNCYMNINSPS-IHYEGQELVGFDAIIPRIHASVTF
RIMK_METBU      ----------------------------------------------------------------------
RIMK_ALTMD      -MRIAILSNPRLYSTSRLVEAGQARGHDVDVIDTMHCYMDITSPS---VRYHGKKLPDAVIPRIGASVSF
RIMK_XANC5      ----------------------------------------------------------------------
RIMK_STRMK      ----------------------------------------------------------------------
RIMK_STRM5      ----------------------------------------------------------------------
RIMK2_SHEB9     ------------YSTQRLVEACQSRGHEAVVINTLNCYMNINSPS-IHYEGTELVGFDAIIPRIHASVTF
RIMK2_SHEB8     ------------YSTQRLVEACQSRGHEAVVINTLNCYMNINSPS-IHYEGTELVGFDAIIPRIHASVTF
RIMK1_SHEB5     ------------YSTQRLVEACQSRGHEAVVINTLNCYMNINSPS-IHYEGTELVGFDAIIPRIHASVTF
COFF_METMP      ----------------------------------------------------------------------
RIMK_XANAC      ----------------------------------------------------------------------
RIMK_MARMS      ----ILSRNPRLYSTRRLVEAGEQLGHEVDVIDTMHCYMDITS-SNPSVRYDGKPLPDAVIPRIGASVTF
RIMK2_PSEA6     ----ILSRNQNLYSTKRLKEAGESLGHEVDVIDTLHCYMDISSNRAVRFKGEALPYYDAIIPRIGASVTF
RIMK_CHRSD      ----ILSRNRRLYSTRRLVEAAEARGHTARVVDTLRCYMNIASPS-IHYKGEEIEPFDAIVPRIGASVTF
RIMK2_SHEDO     ----IMSRNKNLYSTRRLKEAAIARGVKVVDHISCYMNINMTSPS-IHMKGVELPKFDAVIPRIGASVTF
RIMK_XYLFT      ----------------------------------------------------------------------
RIMK_XYLF2      ----------------------------------------------------------------------
RIMK_XYLFM      ----------------------------------------------------------------------
RIMK_SODGM      ----------------------------------------------------------------------
RIMK_DESPS      ---ILACNESLYGNQRLLEAG-RERGHEMLFLDIKQCYLKLDTEPEVHYKGLLNDL-DAVLTK---IGS-
GSHB_SYNPX      ----------------------------------------------------------------------
COFF_METJA      ---------------------------------------------------------------------F
RIMKB_DANRE     --------------------------------------------------------PQVAVVR--VPTPW
GSHB_ANACE      ----------------------------------------------------------------------
GSHB_PROMP      ----------------------------------------------------------------------
DDL_PSEU5       ----------------------------------------------------------------------
DDL_XANAC       -----------------------------------------------------------ALAKALVAQQF
GSHB_PROMM      ----------------------------------------------------------------------
DDL_PELPD       ----------------------------------------------------------------------
RIMKB_MOUSE     ----------------------------------------------------------------------
RIMKB_HUMAN     ----------------------------------------------------------------------
RIMKB_BOVIN     ----------------------------------------------------------------------
CH61_CUCMA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREK
MPTN_METMP      -EMFHRFDMLKYLENY-VPIINPMDGIENAGNKFRTSFLMEVHKIPHPKTIVAEDVNKA----LIAADKF
MPTN_METJA      ----FRFDVLKYLNHY-IPVINPPDGIDRASNKFLTSVFLELNNLPQPKTVVTESINEAIVWIDKFE---
MPTN_METMA      EGVSFRFDILRELEAEGVSVINSPEAIQNAANKYHASYLLAKAGLPVPETVAVQSLEAALKVIS----EF
MPTN_METAC      EGVSFRFDILRELEAGGVTVMNSPEAIQNAANKYHASYLLARAGLPVPETVAVQSVEAA----LRAASGF
RIMK_LEGPL      YGTA----VLRHMETMGMYTLNESIAISRSRDKFRSLQLLARKGIPMPLAQSPDDTEDLIHMVGGAP---
RIMK_LEGPH      YGTA----VLRHMETMGMYTLNESIAISRSRDKFRSLQLLARKGIPMPLAQSPDDTEDLIHMVGGAP---
RIMK_LEGPC      YGTA----VLRHMETMGMYTLNESIAISRSRDKFRSLQLLARKGIPMPLAQSPDDTEDLIHMVGGAP---
RIMK_LEGPA      YGTA----VLRHMETMGMYTLNESIAISRSRDKFRSLQLLARKGIPMPLAQSPDDTEDLIHMVGGAP---
RIMK_VIBVY      YGTA----VVRQFEMMGTFVVNESVAISRSRDKLRSLQLLSRKGIGLPRTGFAHHPDNIQDVIRNVGGAP
RIMK_VIBVU      YGTA----VVRQFEMMGTFVVNESVAISRSRDKLRSLQLLSRKGIGLPRTGFAHHPDNIQDVIRNVGGAP
RIMK2_HAHCH     --TTYGCAVLRQFEVSGVYSINESIAITRSRDKLRAHQLLARKGVGQP-------VTSYAH-SADATNDL
RIMK_VIBSL      YGTA----VVRQFEMMGTFCINESVAISRSRDKLRSLQLLSRKGIGLPKTGFASRPDKIQDLIKNVGGAP
RIMK_HAEIN      --------------------LNSSQAFLNARDKWKSLQLLLKAGIPVPNSLLSGGEVQAQ---ATIPHIS
RIMK_CELJU      ----YGLAVIRQFEMMGVYCLTESIALGRSRDKLRALQLLSRKGIGLPKTSFAYNVYDARELIKLVGGTP
RIMK_PASMU      --------VLRHFEAQNIPCLNSATAFLQARDKWQSLQMLMAQGIAIPHSLLAGPEFQA---PSTMQYVQ
RIMK1_SHEAM     YGCA----VLRQFEMMGVYTLNESVAVTRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIEMVGGAP
RIMK_HAEIG      --------------------LNSSQAFLNARDKWKSLQLLLKAGVPVPNSLFSGGEVQAH---ATIPHIS
RIMK_HAEDU      --------VLDYFAAKKVVILNNSTAFRLARDKWSSLQVLAAQHIPIPTSFAGALFSTAAHIS----QHR
RIMK_TERTT      YGTS----VVRQFEMMGTFVVNESVAISRSRDKLRSLQLLSRKGIGLPRTGFANKPDNIKDLIRNV--GG
RIMK_SERP5      YGTA----VLRQFELLGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTGDLIELVGGAP---
RIMK_HAEIE      --------------------LNSSQAFLNARDKWKSLQLLLKTGVPVPNSFLSGGEVQAQ---ATIPHIS
RIMK_SHELP      YGTA----VVRQFEMMGTFCVNESVAISRSRDKLRSLQLLSRKGIGLPRTGFASKPDKIQDLIKNVGGAP
RIMK_VIBPA      YGTA----VVRQFEMMGTFCVNESVAISRSRDKLRSLQLLSRKGIGLPRTGFAHHPDNIQDVIKNVGGAP
RIMK_THISH      --------VLRQFEMMGVFPVNESVAISRARDKLRSLQLLSRKGVGLPVTGFAHSPDDIDDLLAEVQGAP
RIMK_SYNPX      ----------------GISVLNAAEPIKRSRDKLLASQLFVRHGLNMPVTGFASSPLDTKDLIKMVGGAP
RIMK_PECCP      -QITFYTAVLRQFEMLGSYPLNNSVAVIRARDKLHSLQLLAREGIDLPITGFAHSPDDTGDLIAMVGGAP
RIMK_HAEI8      --------------------LNLSQAFLNARDKWKSLQLLLKTGVPVPNSFLSGGEVQAQ---ATIPHIS
RIMK_AERS4      TAVLRQFEMMNTMA------LNSSVAISRSRDKLRAMQLLSRHGIGLPYAHSTHDVPDLITMVGGAP---
RIMK_SACD2      YGTA----VVRQFEMMGTFCVNESVAISRSRDKLRSLQLLSRKGVGLPRTGFANRPDKIKDLIKNVGGAP
RIMK_ALHEH      --------VLRQFEIMGTFPLNESVAISRSRDKLRSTQLLARKGIGLPMTYSPDDTEDLINLVGGPP---
LYSX_SULSO      --------------QVGYPVINDHTTLIRCENKIFTTYILARHNIPTPKTFIAFDKTNAIEYS---KKLG
RIMK_ECO24      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_AERHH      TAVLRQFEMMNTMA------LNSSVAISRSRDKLRAMQLLSRHGIGLPYAHSTHDVPDLITMVGGAP---
RIMK_MANSM      --------VLTHLAAKNIPCLNNPASFALARDKWLSLQALAAANIAVPTVFAGQDF----QAGSAVEKVS
RIMK2_SHESM     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK2_SHESA     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK1_SHESR     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK_SHISS      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_SHIFL      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_SHIF8      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_SHIDS      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_KLEP3      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPLTGIAHSPDDTSDLIAMVGGAP
RIMK_ECOUT      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECOSE      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECOLU      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECOLI      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECOLC      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECOL5      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECOK1      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECOHS      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECODH      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECOBW      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECO8A      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECO5E      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECO57      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECO55      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECO45      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECO27      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_CITK8      YGTA----ALRQFEMLGSYPLNESVAITRARDKLRSLQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK2_SHESW     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK2_SHEON     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK2_SHEB5     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK1_SHEPC     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK1_SHEB9     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK1_SHEB8     YGSA----VLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK_ECOSM      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECO7I      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_SHIB3      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK2_SHEFN     YGSA----VLRQFEMMGVYAVNGSIGIARSRDKLRSMQLLSRQGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK1_HAHCH     --------VLRQFEMMGVFPLNESVAISRARDKLRSLQLLSRKGVGMPVTGFAHSPDDIRDLISMVGGAP
RIMK_SHEPA      YGCALT----RHFESLNIEALNTSDAITRSRDKLFSLQLLQKNNLDIPTSGFANSPVDTKDLIDMVGGAP
RIMK_SYNP2      ---------------------NTSQAISRSRDKLRSLQILARKGIGLPVAHATQDIDGLIETVGGAP---
RIMK_SHEHH      YGCALT----RHFESLNIMALNTSDAITRSRDKLFSLQLLQKNNLDIPTSGFANSPVDTKDLIDMVGGAP
RIMK_PSEPK      --------VLRQFEMMGVYPLNESVAIARSRDKLRSLQLLSRRGIGLPIAHSPDDIPDLIQMVNGAP---
RIMK_PSEP1      --------VLRQFEMMGVYPLNESVAIARSRDKLRSLQLLSRRGIGLPIAHSPDDIPDLIQMVNGAP---
RIMK_HAES2      --------------------LNDDVAFLKARDKWLSLQLLTEQGIAVPNS----ALSGAEFSATQAILQQ
RIMK_HAES1      --------------------LNDDVAFLKARDKWLSLQLLTEQGIAVPNS----ALSGAEFSATQAILQQ
RIMK_ESCF3      YGTA----ALRQFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_IDILO      YGTA----VLRQFEMIGSYPLNESVAISRSRDKLRSLQLLSRKGIGLPTASQPQDIPDLIDMVGGAP---
RIMK1_SHEDO     YGSA----VLRQFEMMGVYTINDSVGISRSRDKLRSMQLLSRKGIGLPITGFANKPSDIPDLIDMVGGAP
RIMK_VIBCM      YGTA----VLRQFEMMGVYPANESVAITRSRDKLRSMQLLSRRGIGMPITGFASKPDDVKDLLDMVGGAP
RIMK_VIBCH      YGTA----VLRQFEMMGVYPANESVAITRSRDKLRSMQLLSRRGIGMPITGFASKPDDVKDLLDMVGGAP
RIMK_VIBC3      YGTA----VLRQFEMMGVYPANESVAITRSRDKLRSMQLLSRRGIGMPITGFASKPDDVKDLLDMVGGAP
RIMK_SHIBS      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIVHSPDDTSDLIDMVGGAP
RIMK_ECOL6      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_ECO81      GTAALR-----QFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVAHSPDDTSDLIDMVGGAP---
RIMK_PSYIN      TAVARQFEVMGTFN------INESVAISRSRDKLRSMQLLSRKGIGMPRTGFASKPDNIKDLIKNVGGAP
RIMK_PSEFS      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRRGIGLPVAHSPDDIPDLIDMVNGAP---
RIMK_PSEF5      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRRGIGLPVAHSPDDIPDLIEMVNGAP---
RIMK_ENT38      --------------------LNESVAITRARDKLRSLQLLARQGIDLPMTGIAHSPDDTSDLIAMVGGAP
RIMK_PSEPF      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRRGIGLPVAHSPDDIPDLIDMVNGAP---
RIMK1_SHEFN     YGTA----VLRQFEMMGTHPLNESVAITRSRDKLRSLQLLSRKNIGLPVTGFASKPADIPDLLDMVGGAP
RIMK_DESAD      --------VVRQFEMMGVYCVNESVAITRSRDKLRSLQLLARKGIGLPVTAFAHSTQYTEDLIDIVGGAP
RIMK_XANOR      --------VLRQLEFMGTYTPNPSDAILRARDKLRAHQLLAAQGIDMPVTVFGDNPDDTQDLLSMLGPPP
RIMK_XANOM      --------VLRQLEFMGTYTPNPSDAILRARDKLRAHQLLAAQGIDMPVTVFGDNPDDTQDLLSMLGPPP
RIMK_PSEPW      --------VLRQFEMMGVYPLNESVAIARSRDKLRSLQLLSRRGIGLPIAHSPDDIPDLIQMVNGAP---
RIMK_PSEPG      --------VLRQFEMMGVYPLNESVAIARSRDKLRSLQLLSRRGIGLPIAHSPDDIPDLIQMVNGAP---
RIMK_PSEMY      DAVIPRIGVLRQFEMMGVYPLNESVAISRSRDKLRALQLLSRKGIGLPVAHSPDDIPDLIQMVGGAP---
LYSX_SULTO      --------------------INDSSTLIKCENKLYTLSLLSKHGIRVPKTIVAFSKEKALEL---ANKLS
RIMK_PSEHT      YGCS----VLRQFEMMGVYPVNESVAISRSRDKLRSLQLLSRKGVGMPVTGFASKPDDVKDLLEMVGGAP
RIMK_MARAV      --------VLRQFEMMGVFPVNESVAITRSRDKLRSLQLLARKGVGMPVTGFANKPDNVPELLKMVGGAP
RIMK_ALCBS      --------VVRQFEMMGVFPVNESVAISRSRDKLRSLQLLSRKGVGLPIAHSPDDIPDLINMVRGAP---
RIMK2_SHEAM     YGCA----VVRQFEMMGVFAANDSISIARSRDKLRALQLLSRKGIGMPVTGFANKPNNIPDLINMVGGAP
RIMK_PSEE4      YGCA----VLRQFEMMGVYPLNESVAIARSRDKLRSLQLLSRRGIGLPIAHSPDDIPDLIQMVNGAP---
RIMK_ERWCT      -QITFYTAVLRQFEMLGSYPLNNSVAVIRARDKLHSLQLLAREGIDLPITGFAHSPDDTGDLIAMVGGAP
RIMK_SALSV      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_PSEU5      YGCA----VLRQFEMQGVFPLNESVAIARSRDKLRALQLLSRRGVGLPVAHSPDDIPDLIRMVNGAP---
RIMK_HALHL      YGTA----VLRQFEMLGTYPLNESQGISRSRDKLRSMQLLSREGVGMPAAHSPDDTDDLMQLVGGSP---
RIMK_SALTY      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALTI      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALPK      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALPC      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALPB      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALPA      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALNS      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALHS      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALG2      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALEP      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALDC      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALCH      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_SALA4      GTAALRQFEL-----LGSYPLNESVAITRARDKLRSLQLLARQGIDLPIAHSPDDTSDLIKMVGGAP---
RIMK_PSESM      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRRGIGLPVAHSPDDIPDLIQMVNGAP---
RIMK_PSE14      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRRGIGLPVAHSPDDIPDLIQMVNGAP---
RIMK1_PSEA6     FYGTAVVRQFEMMGSFSV---NESVAISRSRDKLRSMQLLSRKGIGLPRTGFAHSPDNIKDLIANVGGAP
RIMK_RHOBA      --------VVRQFEQMDVFCANSSAGISNSRDKLRSLQILSRHQIGIPKTTFVRDRKDI--LPAIERVGG
RIMK_PSEAE      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRKGIGLPVAHSPDDVPDLIEMVGGAP---
RIMK_PSEAB      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRKGIGLPVAHSPDDVPDLIEMVGGAP---
RIMK_PSEA8      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRKGIGLPVAHSPDDVPDLIEMVGGAP---
RIMK_PSEA7      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRKGIGLPVAHSPDDVPDLIEMVGGAP---
RIMK_ERYLH      G-----LAVLRQFEMAGVWPLNESVAIGRSRDKLRSMQILAKYGLGLPLTAYANDPKQAEEIIKAVNGPP
RIMK_AZOVD      --------VLRQFEMMGVFPLNESVAISRSRDKLRSLQLLSRKGIGLPVTGFAHSPDDIPDLIAMVGGAP
RIMK_PSEU2      --------VLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRRGIGLPVAHSPDDIPDLIQMVNGAP---
RIMK_PHOPR      YGCS----VLRQFEMMDVFSVNQSIAISRSRDKLRSLQLLSRKGVGMPIASKPDDVPDLIKMVGGAP---
RIMK_VIBFM      --------VLRQFEMMGVYPVNESVAITRSRDKLRSMQLLSRKGIGMPITGFASKPDDVKDLLDMVGGAP
RIMK_VIBF1      --------VLRQFEMMGVYPVNESVAITRSRDKLRSMQLLSRKGIGMPITGFASKPDDVKDLLDMVGGAP
RIMK_NITOC      YGTA----VLRQFEMIGVYPLSESVAITRSRDKLRSLQLLARKGIGLPVAHAPDEIDDLIKMVGGAP---
RIMK_THICR      YGTA----VLRQFEMMGVYPLNESVAISRSRDKLRSLQLLSRRGVGLPVAHSPDDVNDLLETVGGAP---
RIMK_XANCP      --------VLRQLEFMGTYTPNPSDAILRSRDKLRAHQLLASQGIDMPVTVFGDNPDDTQDLLSMLGPPP
RIMK_XANC8      --------VLRQLEFMGTYTPNPSDAILRSRDKLRAHQLLASQGIDMPVTVFGDNPDDTQDLLSMLGPPP
RIMK_TRIEI      --------VVRQFEMMGVFTANPSLAISRSRDKLHCLQLLAREGIELPVAHFTKDINSLINTVGGAP---
RIMK_MARMM      --------VVRQFEMMGVWALNESVAIGRSRDKLRSLQLLSRAGLGLPVTAFAHDTSMTDDVLDIAGGEP
RIMK2_SHESR     YGCA----VVRQFEMMGVFAANDSISIARSRDKLRALQLLSRKGIGMPVTGFANDIPDLINMVGGAP---
RIMK1_SHESM     YGCA----VVRQFEMMGVFAANDSISIARSRDKLRALQLLSRKGIGMPVTGFANDIPDLINMVGGAP---
RIMK1_SHEON     YGCA----VVRQFEMMGVFAANDSISIARSRDKLRALQLLSRKGIGMPITGFANDIPDLINMVGGAP---
RIMK_PELCD      --------------------VNESVAISRSRDKLRSLQLLSRKGIGLPHTCFAHSTRYTKDLINQVGGAP
RIMK_COXBU      YGTA----VVRQFEMMGTFCLNSSMSITRSRDKFRSLQFLSRKGIDLPIAHSPDDIEDLIQMVGGTP---
RIMK_COXBR      YGTA----VVRQFEMMGTFCLNSSMSITRSRDKFRSLQFLSRKGIDLPIAHSPDDIEDLIQMVGGTP---
RIMK_COXBN      YGTA----VVRQFEMMGTFCLNSSMSITRSRDKFRSLQFLSRKGIDLPIAHSPDDIEDLIQMVGGTP---
RIMK_COXB2      YGTA----VVRQFEMMGTFCLNSSMSITRSRDKFRSLQFLSRKGIDLPIAHSPDDIEDLIQMVGGTP---
RIMK_COXB1      YGTA----VVRQFEMMGTFCLNSSMSITRSRDKFRSLQFLSRKGIDLPIAHSPDDIEDLIQMVGGTP---
RIMK_XANCB      --------VLRQFEFMGTYTPNPSDAILRSRDKLRAHQLLASQGIDMPVTVFGDNPDDTQDLLSMLGPPP
RIMK_ALISL      YGTA----VLRQFEMMNVYPVNESVAITRSRDKLRSMQLLSRKGIGMPITGFASKPDDVKDLLDMVGGGP
RIMK1_SHESA     YGCA----VVRQFEMMGVFAANDSISIARSRDKLRALQLLSRKGIGMPITGFANDIPDLINMVGGAP---
RIMK2_SHEPC     YGCA----VVRQFEMMGVFVANDSISIARSRDKLRALQLLSRKGIGMPITGFANDIPDLINMVGGAP---
RIMK1_SHESW     YGCA----VVRQFEMMGVFVANDSISIARSRDKLRALQLLSRKGIGMPITGFANDIPDLINMVGGAP---
RIMK_METBU      --------VLRQFEMMGVYPLNESVAITRSRDKLRSLQLLSRKGIGMPYASKPDDIKDVIKMVGGAP---
RIMK_ALTMD      YGTS----VVRQFEMMGTYSLNESVAISRSRDKLRSLQLLSRKGIGMPRTGFAHHPDKIDDVIKTVGGAP
RIMK_XANC5      --------VLRQLEFMGTYTPNPSDAILRSRDKLRAHQLLAAQGIDMPVTVFGDNPDDTQDLLSMLGPPP
RIMK_STRMK      --------VLRQFELMGARTPNPSDAILRSRDKLRAHQLLAAKGIDMPVTVFGDNPDDTVDLLSMLGPPP
RIMK_STRM5      --------VLRQFELMGARTPNPSDAILRSRDKLRAHQLLAAKGIDMPVTVFGDNPDDTVDLLSMLGPPP
RIMK2_SHEB9     YGCA----VVRQFEMMGVYAANDSISIARSRDKLRALQLLSRKGIGMPVTGFANDIPDLINMVGGAP---
RIMK2_SHEB8     YGCA----VVRQFEMMGVYAANDSISIARSRDKLRALQLLSRKGIGMPVTGFANDIPDLINMVGGAP---
RIMK1_SHEB5     YGCA----VVRQFEMMGVYAANDSISIARSRDKLRALQLLSRKGIGMPVTGFANDIPDLINMVGGAP---
COFF_METMP      --------VLKNLESEGHYFINPLETIYNSSDKFKTTKILSKNGLKTPKTALIRDYADAKHF-LDTKNMN
RIMK_XANAC      --------VLRQLEFMGTYTPNPSDAILRSRDKLRAHQLLAAQGIDMPVTVFGDNPDDTQDLLSMLGPPP
RIMK_MARMS      YGTA----VVRQFEMMGTYSINESVAISRSRDKLRSLQLMSRKGLGLPKTGFAHHPDKIGDLLKNVGGAP
RIMK2_PSEA6     YGTA----VVRQFEMMGTFSINESVAISRSRDKLRSMQLLSRKGIGMPRTGFARQPDRIDDLIKNVGGAP
RIMK_CHRSD      YGCA----VLRQFEMMSTYVLNDSVSITRSRDKLRSLQLLSRKGLGLPVTGFAHSPDDIPDLITMVKGAP
RIMK2_SHEDO     YGTA----VLRQFEMMGVHPLNESVAITXXXXXXXXXXXXXXXXIGLPVTGFANKPSDVPDLLDMVGGAP
RIMK_XYLFT      ---------------------NPSDAILRSRDKLRAHQLLAAQGIDMPMTVFGDNPDDTQDLLSMLGPPP
RIMK_XYLF2      ---------------------NPSDAILRSRDKLRAHQLLAAQGIDMPMTVFGDNPDDTQDLLSMLGPPP
RIMK_XYLFM      ---------------------NPSDAILRSRDKLRAHQLLAAQGIDMPMTVFGDNPDDTQDLLSMLGPPP
RIMK_SODGM      --------VLRQFEMLGSYALNESAAITRARDKLHSLQLLARQGIDLPITGFADSPDDTGDLITMVGGAP
RIMK_DESPS      -NITPYATALSRQFEMGIYTCNSSSAISQSGDKLFSLQLLLKSGINIPITGFANSPIDASDLIEMVGGAP
GSHB_SYNPX      --------LLEVAERAGVRVLNRPSALRAWNEKLGA---LRFSR------WMAPTLVAGRVSELMAAREQ
COFF_METJA      DRLTLSWQFINALEVEGCRFINPIKTLYLTSDKFKCIKLLAKNKIKTPKTALIRDYEDAVKF-IEKYNLR
RIMKB_DANRE     VQSDSDITVLRHLEKMGCRLVNRPQAILNCVNKFWTFQELAGHGVPLPDTYSYGGHDNFRKMIDEAEPLG
GSHB_ANACE      --------------------------------------------------------------------EY
GSHB_PROMP      ----------------GVKVINKPSSL-RAWNEKLGALRYSHLMAPTIVASKVKDLINFAQIN-------
DDL_PSEU5       ----------------GIPYTGSASAL--AMDKLRTKQVWQSLGLPTPRHAV---LASEVDCQAAAQMLG
DDL_XANAC       DRV---FNVLHLMEAFGVPYTGSGSAL--SMDKIRTKQVWLSLGLSTPRYARLAAGASAEDIHAAARQIG
GSHB_PROMM      ----------------GVCVLNRPAALRAWNEKLGA---LRFNNLMAPTLVA----SRVSELAAFA-REQ
DDL_PELPD       ----------------------------------------------------------------------
RIMKB_MOUSE     ------ITVLRHLEKMGCRLMNRPQAILNCVNKFWTFQELAGHGVPLPDTFSYGGHENFAKMIDEAEVLE
RIMKB_HUMAN     ------ITVLRHLEKMGCRLMNRPQAILNCVNKFWTFQELAGHGVPLPDTFSYGGHENFAKMIDEAEVLE
RIMKB_BOVIN     ------ITVLRHLEKMGCRLMNRPQAILNCVNKFWTFQELAGHGVPLPDTFSYGGHENFAKMIDEAEVLE
CH61_CUCMA      ----------------GMNAMDLRRGISMAVDSVVTNLKSRARMISTS-----EEIAQVGTISANGEREI


                         +         .         .         .         .         *         .:210
query           RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQ
MPTN_METMP      EDVVLKPLFGNQGKGLVRVAKLKALNTFKSTHGVIYMQEFVNNPN-NVYRDIRAFVVGDKVISAMYRTSD
MPTN_METJA      -EAVLKPIFGCGGEGIVRVKKELPLNEFKEKYNTFYIQEFIKPVR-NEHRDIRAFVVDDEVVAAMYRGGE
MPTN_METMA      GDAVIKPVFGYKGKDIARVKEPAPVXXXXXXXGMLYIQEFIE----NPGRDIRAFVVGGTAIGAIYRKAA
MPTN_METAC      GDAVIKPVFGYKGKDIARVKDGEIRFSDRKTGGMLYIQEFIE----NPGRDIRAFVVGGKAIGAIYRKAA
RIMK_LEGPL      --LVIKLLEGTQGKGVILADSHQSINAFKEMHANILVQEFIEESRGT---DIRCFVIGEKVVAAVKRQAK
RIMK_LEGPH      --LVIKLLEGTQGKGVILADSHQSINAFKEMHANILVQEFIEESRGT---DIRCFVIGEKVVAAVKRQAK
RIMK_LEGPC      --LVIKLLEGTQGKGVILADSHQSINAFKEMHANILVQEFIEESRGT---DIRCFVIGEKVVAAVKRQAK
RIMK_LEGPA      --LVIKLLEGTQGKGVILADSHQSINAFKEMHANILVQEFIEESRGT---DIRCFVIGEKVVAAVKRQAK
RIMK_VIBVY      --LVIKLLEGTQGIGVVETNKAAEIEAFMGLKANIMVQEFIEEAKG---ADIRCFVVGNKVIAAMKRQAK
RIMK_VIBVU      --LVIKLLEGTQGIGVVETNKAAEIEAFMGLKANIMVQEFIEEAKG---ADIRCFVVGNKVIAAMKRQAK
RIMK2_HAHCH     IELIVKVMASTHGNGVVETDKAAEINAFRGLKADFLVQEFIKEAGGS---DIRCFVIGDKVVAAMQRTAQ
RIMK_VIBSL      --LVIKLLEGTQGIGVVETNKAAEIEAFMGLKANILVQEFIEEANG---ADIRCFVVGNKVIAAMKRQGE
RIMK_HAEIN      SPTILKTLNGSQGIGVILAEKPQSMEAFKQTNISMLQQDFIEEAGN---ADIRCFVIGDQVVATMQRIGQ
RIMK_CELJU      --LVLKLCEGTQGKGIVETQKAAEIEAFRELRAEFLVQEFIKEANGS---DVRCFVVGDKVVASMERTAQ
RIMK_PASMU      SPTILKTLSGAQGIGVILAEKRQSLETLKQADVSVLAQEFIEEANG---ADLRCFVIGERVVASMQRISQ
RIMK1_SHEAM     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIREANG---ADIRCFVLGDKVVAAMKRQAA
RIMK_HAEIG      SPTILKTLNGSQGIGVILAEKPQSMEAFKQTNISMLQQDFIEEAGN---ADIRCFVMGDQVVATMQRIGQ
RIMK_HAEDU      IPLVIKTCSGSQGVGVMKVHSVSLLQTLQQAKVDNLLQDFVVEARG---QDIRAFVIGDRVVAAIERNGN
RIMK_TERTT      APVVIKLLEGTQGIGVVLAETPKTAEAIEAFMGLILVQEFIKEAG---GADIRCLVVGGRVIAAMKRQGA
RIMK_SERP5      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIREAQGS---DVRCLVVGSKVVAAIERQAK
RIMK_HAEIE      SPTILKMLNGSQGIGVILAEKPQSMEAFKQTNISMLQQDFIEEAGN---ADIRCFVIGDQVVATMQRIGQ
RIMK_SHELP      --LVIKLLEGTQGIGVVETNKAAEIEAFMGLKANILVQEFIKEAGG---ADIRCFVVGDKVVAAMKRQAA
RIMK_VIBPA      --LVIKLLEGTQGIGVVETNKAAEIEAFMGLKANIMVQEFIEEAKG---ADIRCFVVGNKVIAAMKRQAK
RIMK_THISH      --LVVKLLEGTQGVGVVRKAAESVIQAFMGLRQNILVQEFVKEAGGT---DLRCFVIGGKVVAAMQRRAK
RIMK_SYNPX      --LILKLLEGAQGRGVVETQKAAEINAMKSLNANLLVQEFIKEAGG---KDLRCFVIGGKVVSAIERTAA
RIMK_PECCP      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYVREAQG---KDIRCLVIGNRVVAAIERQAK
RIMK_HAEI8      SPTILKMLNGSQGIGVILAEKPQSMEAFKQTNISMLQQDFIEEAGN---ADIRCFVIGDQVVATMQRIGQ
RIMK_AERS4      --LVVKLLEGTQGIGVVETHKAAEIEAFIQTNNNILVQEYIREANG---ADIRCLVVNGKVVAAMRRQAQ
RIMK_SACD2      --LVIKLLEGTQGIGVVLANKTAELEAFMGLNANILVQEYIKEAGG---ADIRCFVVGNKVVAAMKRQGA
RIMK_ALHEH      --MVIKLLEGTQGKGVVLAETQQAAESLDAFRGLFLAQEYIKEAGGS---DIRCFVVGERVVASMRRQAK
LYSX_SULSO      YPVVIKPVEGSWGR---MVAKADNLDSTQKYKDIYYIQEFVN--KPN--RDIRIFVIGETPVGIYRVNEN
RIMK_ECO24      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAYILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_AERHH      --LVVKLLEGTQGIGVVETQKAAEIEAFIQTNNNILVQEYIREANG---ADIRCLVVNGKVVAAMRRQAQ
RIMK_MANSM      SPTILKTLNGSQGIGVILADRSQSAVSIMETLTLSHLQDFIGEAGAS---DIRCFVIGDKVVAAMQRSGQ
RIMK2_SHESM     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAM
RIMK2_SHESA     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAM
RIMK1_SHESR     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAM
RIMK_SHISS      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_SHIFL      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAE
RIMK_SHIF8      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAE
RIMK_SHIDS      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_KLEP3      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERRAK
RIMK_ECOUT      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOSE      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOLU      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOLI      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOLC      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOL5      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOK1      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOHS      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECODH      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOBW      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECO8A      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECO5E      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECO57      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECO55      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECO45      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECO27      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_CITK8      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEARG---RDIRCLVVGDEVVAAIERRAK
RIMK2_SHESW     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAM
RIMK2_SHEON     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVVAAMKRQAM
RIMK2_SHEB5     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAM
RIMK1_SHEPC     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAM
RIMK1_SHEB9     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAM
RIMK1_SHEB8     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAM
RIMK_ECOSM      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECO7I      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_SHIB3      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK2_SHEFN     --LVVKLLEGTQGIGVVRKAAESVLEAFMGLKANIMVQEYIAEAQG---ADIRCFVLGDKVIAAMKRQAK
RIMK1_HAHCH     --LVIKLLEGTQGIGVVRKAAESVIEAFMGLKANILVQEFIKEAGG---ADIRCFVVGDKVVAAMKRQAQ
RIMK_SHEPA      --LIVKLLEGTQGKGVVETTKAAEINAFKSLRVNLLVQEFIKEAQG---KDLRCFVIDGKIVASIERTAA
RIMK_SYNP2      --VVIKLLEGTQGIGVVLAAAKSVIEAFRGLDANILVQEYIAEAKGT---DIRCFVVGEKVVAAMKRQGA
RIMK_SHEHH      --LIVKLLEGTQGKGVVETTKAAEINAFKSLHVNLLVQEFIKEAQG---KDLRCFVIDGKVVASIERTAA
RIMK_PSEPK      --LVIKVLEGTQGIGVVLCETPQAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAK
RIMK_PSEP1      --LVIKVLEGTQGIGVVLCETPQAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAK
RIMK_HAES2      SPTILKTLHGSQGIGVIRKSAVSIMETLTQADVPLLMQDFIQEAQGT---DIRCFVIGDKVVATMQRIGQ
RIMK_HAES1      SPTILKTLHGSQGIGVIRKSAVSIMETLTQADVPLLMQDFIQEAQGT---DIRCFVIGDKVVATMQRIGQ
RIMK_ESCF3      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAKG---RDIRCLVVGDEVVAAIERRAK
RIMK_IDILO      --LVIKLLEGTQGIGVVRQAAESVIEAFMGLHSNFMVQEYIKEAGG---ADIRCLVIGDKVIAAMKRQAK
RIMK1_SHEDO     --LVVKLLEGTQGIGVVRKAAESVLEAFMGLKANIMVQEYIKEANG---ADIRCFVLGDKVIAAMKRQAK
RIMK_VIBCM      --VVIKLLEGTQGIGVVRTAAESVIEAFMGLKANIMVQEYIKEAGG---ADIRCFVIGDKVIAAMKRQGA
RIMK_VIBCH      --VVIKLLEGTQGIGVVRTAAESVIEAFMGLKANIMVQEYIKEAGG---ADIRCFVIGDKVIAAMKRQGA
RIMK_VIBC3      --VVIKLLEGTQGIGVVRTAAESVIEAFMGLKANIMVQEYIKEAGG---ADIRCFVIGDKVIAAMKRQGA
RIMK_SHIBS      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECOL6      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_ECO81      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIKEAQGC---DIRCLVVGDEVVAAIERRAK
RIMK_PSYIN      --VVIKLLEGTQGIGVVETAKTAEIEAFMGIKANILVQEFIKEAGG---ADIRCLVIGGKVVAAMKRQGA
RIMK_PSEFS      --LVIKVLEGTQGIGVVLCETATAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIAAMKRQAK
RIMK_PSEF5      --LVIKVLEGTQGIGVVLCETATAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIAAMKRQAK
RIMK_ENT38      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIEEAKG---RDIRCLVVGNEVVAAIERQAK
RIMK_PSEPF      --LVIKVLEGTQGIGVVLCETATAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIAAMKRQAK
RIMK1_SHEFN     --CVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIAEAGG---ADIRCFVIGDKVIAAMKRQAL
RIMK_DESAD      --LVIKLLEGTQGKGVVRNTAASIIEAFKGLEANILVQEFISEASGS---DIRCLVVGGKVIASMKRQGR
RIMK_XANOR      H--VVKLNEGAQGAGVILTEKAASRSVVEALRGLYIVQEFIGEAEG---ADLRCFVVGDRVVAAMRRQAA
RIMK_XANOM      H--VVKLNEGAQGAGVILTEKAASRSVVEALRGLYIVQEFIGEAEG---ADLRCFVVGDRVVAAMRRQAA
RIMK_PSEPW      --LVIKVLEGTQGIGVVLCETTQAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAK
RIMK_PSEPG      --LVIKVLEGTQGIGVVLCETTQAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAK
RIMK_PSEMY      --LVIKVLEGTQGMGVVLAETTKAAESVEAFFGLIMVQEYIQEAGG---ADIRCFVVGDKVIASMKRQAK
LYSX_SULTO      YPVVIKPVEGSWGRMVARAIDEDTLEYQEYTTYIYLIQEFVKKPD----RDIRIFTIGDEPVGIYRVNSR
RIMK_PSEHT      --VVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEAGG---ADIRCFVLGDKVIAAMKRQAQ
RIMK_MARAV      --VVIKLLQGTQGIGVVRKAAESVIEAFMGLKADILVQEFIKEAGG---ADIRCFVIGDKVIAAMKRQGA
RIMK_ALCBS      --LVIKMLEGTQGIGVVRKAAESVIEAFMGLNVSVMVQEYIKEAGG---ADIRCFVVGGKVIAAMKRQAA
RIMK2_SHEAM     --LVIKLLEGTQGIGVVRKAAESVIEAFLGLKANIMVQEYIKEANGS---DIRCFVVGDKVVAAMRRQGP
RIMK_PSEE4      --LVIKVLEGTQGIGVVETTKAAEIEAFMGLKQNIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAK
RIMK_ERWCT      --LVVKLVDGTQGIGVVRQAAESVIDAFRGLNAHILVQEYVHEAQG---KDIRCFVIGNRVVAAIERQAK
RIMK_SALSV      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_PSEU5      --LVIKVLEGTQGIGVVLCETEKAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIAAMKRQAK
RIMK_HALHL      --VVIKLLEGTQGIGVVRKAASSVIQALRGLKAHFLVQEFIEEAGG---ADIRCLVVGGKVVAAMKRQGK
RIMK_SALTY      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALTI      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALPK      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALPC      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALPB      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALPA      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALNS      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALHS      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALG2      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALEP      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALDC      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALCH      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_SALA4      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLNAHILVQEYIAEAKGC---DIRCLVVGNEVVAAIERKAG
RIMK_PSESM      --LVIKVLEGTQGIGVVLCETATAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAK
RIMK_PSE14      --LVIKVLEGTQGIGVVLCETATAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAK
RIMK1_PSEA6     --VVIKLLEGTQGIGVVLANKAAEVEAFMGIKANILVQEYIKEAGG---ADIRCFVVGGKVVAAMKRQGA
RIMK_RHOBA      SPVIIKLLEGTQGVGVILAENEAIIETLQSTKQNVLVQQFVAESRG---KDIRAFVIGDXXXXXXXXXXX
RIMK_PSEAE      --LVIKLLEGTQGIGVVETEKAAELEAFMGLKHNIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAA
RIMK_PSEAB      --LVIKLLEGTQGIGVVETEKAAELEAFMGLKHNIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAA
RIMK_PSEA8      --LVIKLLEGTQGIGVVETEKAAELEAFMGLKHNIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAA
RIMK_PSEA7      --LVIKLLEGTQGIGVVETEKAAELEAFMGLKHNIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAA
RIMK_ERYLH      --VVIKLLEGTQGIGVVLAETMSSIEAFRGANVNILVQEFIKEAGGT---DIRALVVGGKVVAAMKRTGA
RIMK_AZOVD      --LVIKLLEGTQGIGVVETQKAAEIEAFMGMEQNIMVQEYIQEAGG---ADIRCFVVGEKVIAAMKRQAK
RIMK_PSEU2      --LVIKVLEGTQGIGVVLCETATAAESVEAFMGLIMVQEYIKEAGG---ADIRCFVVGDKVIASMKRQAK
RIMK_PHOPR      --LVIKLLEGTQGIGVVQTAAESVIEAFMGLKANIMVQEYIKEAGG---ADIRCFVIGDKVIATMKRQAA
RIMK_VIBFM      --VVIKLLEGTQGIGVVRKAAESVVEAFMGLKANIMVQEFIKEAGG---ADIRCFVIGGKVIAAMKRQGA
RIMK_VIBF1      --VVIKLLEGTQGIGVVRKAAESVVEAFMGLKANIMVQEFIKEAGG---ADIRCFVIGGKVIAAMKRQGA
RIMK_NITOC      --VVIKLLEGTQGIGVVLANKKAAQSVIEAFMGLILVQEFIKETAGS---DIRCFIIGDKVVAAMKRQAP
RIMK_THICR      --VVIKLLEGTQGVGVVLADTHSAAESVQAFNGLILVQEFIKEARG---ADLRCFVIGGKVVASMKRQAK
RIMK_XANCP      H--VVKLNEGAQGAGVILTEKAASRGVVEALRGLYIVQEFIGEAEG---ADLRCFVVGDRVVAAMRRQAA
RIMK_XANC8      H--VVKLNEGAQGAGVILTEKAASRGVVEALRGLYIVQEFIGEAEG---ADLRCFVVGDRVVAAMRRQAA
RIMK_TRIEI      --LVIKLLEGSQGIGVVQVAKSV-IEAFSGLNANFLVQEFIEEAGG---ADVRCFVVGDRVIAAIKRQGT
RIMK_MARMM      --VVIKLLEGTQGVGVVRRSAKSVIEAFRGAKVDILVQEFIKEAGG---ADIRTIVVGGKVVAAMKRQGA
RIMK2_SHESR     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANIMVQEYIKESNGS---DIRCFVVGDKVVASMKRQGP
RIMK1_SHESM     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANIMVQEYIKESNGS---DIRCFVVGDKVVASMKRQGP
RIMK1_SHEON     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANIMLQEYIKESNGS---DIRCFVVGDKVVASMKRQGP
RIMK_PELCD      --LVVKLLEGTQGIGVVETQKAAEIEAFKGLKEQILVQEFIEESGG---ADIRCLVVGGKVVAAMKRQGA
RIMK_COXBU      --LIIKLIEGTQGIGVVLAEKKAAESVIQAFLGLILIQEFIGETQG---RDIRCFVIGNKVVATMQREAR
RIMK_COXBR      --LIIKLIEGTQGIGVVLAEKKAAESVIQAFLGLILIQEFIGETQG---RDIRCFVIGNKVVATMQREAR
RIMK_COXBN      --LIIKLIEGTQGIGVVLAEKKAAESVIQAFLGLILIQEFIGETQG---RDIRCFVIGNKVVATMQREAR
RIMK_COXB2      --LIIKLIEGTQGIGVVLAEKKAAESVIQAFLGLILIQEFIGETQG---RDIRCFVIGNKVVATMQREAR
RIMK_COXB1      --LIIKLIEGTQGIGVVLAEKKAAESVIQAFLGLILIQEFIGETQG---RDIRCFVIGNKVVATMQREAR
RIMK_XANCB      H--VVKLNEGAQGAGVILTEKAASRGVVEALRGLYIVQEFIGEAEG---ADLRCFVVGDRVVAAMRRQAA
RIMK_ALISL      --VVIKLLEGTQGIGVVRKAAESVVEAFMGLKANIMVQEFIKEAGG---ADIRCFVIGGKVIAAMKRQGA
RIMK1_SHESA     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANIMVQEYIKESNGS---DIRCFVVGDKVVASMKRQGP
RIMK2_SHEPC     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANILVQEYIKESNGS---DIRCFVVGDKVVASMKRQGP
RIMK1_SHESW     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANILVQEYIKESNGS---DIRCFVVGDKVVASMKRQGP
RIMK_METBU      --LVVKLLEGTQGIGVVETQKAAEIEGFMGVKANILVQEYIKEANG---ADIRCFVIGGKVVASMKRQAP
RIMK_ALTMD      --VVIKLLEGTQGIGVVLADKAAEIEAFMGLNASILVQEFIKEAGGS---DIRCFVVGGKVVAAMKRQAA
RIMK_XANC5      H--VVKLNEGAQGAGVILTEKAASRGVVEALRGLYIVQEFIGEAEG---ADLRCFVVGDKVVAAMRRQAA
RIMK_STRMK      H--VVKLNEGTQGRGVILTEKAASRGIVEALRGLYLMQEFIGEAKG---ADLRCFVVGDQVVASMQRQAP
RIMK_STRM5      H--VVKLNEGTQGRGVILTEKAASRGIVEALRGLYLMQEFIGEAKG---ADLRCFVVGDQVVASMQRQAP
RIMK2_SHEB9     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANILVQEYIKESNGS---DIRCFVVGDKVIASMKRQGP
RIMK2_SHEB8     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANILVQEYIKESNGS---DIRCFVVGDKVIASMKRQGP
RIMK1_SHEB5     --LVIKLLEGTQGIGVVKTAAESVIEAFLGLKANILVQEYIKESNGS---DIRCFVVGDKVIASMKRQGP
COFF_METMP      YPVILKNSFSKCGMKVQKANSDDELKKLSKNSESKLIQEYVDFKNGDTYKDMRILVIDGEVVGGYRRVSN
RIMK_XANAC      H--VVKLNEGAQGAGVILTEKAASRGVVEALRGLYIVQEFIGEAEG---ADLRCFVVGDKVVAAMRRQAA
RIMK_MARMS      --VVIKLLEGTQGIGVVESNKTAEIEAFMGLKANILVQEYIKEAGG---ADIRCLVVGGKVIAAMKRQGA
RIMK2_PSEA6     --VVIKLLEGTQGIGVVLADKAAEIEAFMGLNANILVQEYIKEAGG---ADIRCLVVGGKVVAAMKRQAA
RIMK_CHRSD      --LVIKLLEGTQGIGVVETNQAAEIQAFMGMKANIMVQEYIKEAKG---ADVRCLVIGDKVVAAMKRQAA
RIMK2_SHEDO     --CVIKLLEGTQGIGVVRKAAESVIEAFMGLKANIMVQEYIKEAGG---ADIRCFVIGDKVIAAMKRQAL
RIMK_XYLFT      H--VVKLNEGAQGKGVILSEKSASRGLVEALRGLYLVQEFISEADS---ADLRCFVVGNQVVATMRRQAA
RIMK_XYLF2      H--VVKLNEGAQGKGVILSEKSASRGLVEALRGLYLVQEFISEADS---ADLRCFVVGNQVVATMRRQAA
RIMK_XYLFM      H--VVKLNEGAQGKGVILSEKSASRGLVEALRGLYLVQEFISEADS---ADLRCFVVGNQVVATMRRQAA
RIMK_SODGM      --LVVKLVEGTQGIGVVRQAAESVIDAFRGLKAQFLVQEFVAEAGG---RDVRCLVIGDKVVAVIERHAK
RIMK_DESPS      --LIIKLLEGGQGQGPILAKTKNAAESLINTFKFLLVQQFIKEANGKIL---RCLVINGKVVASIERTAA
GSHB_SYNPX      GDVVLKPLGGRAGLGVIRVGLKALLELVTEQERLPVMQRFL----PDVTEDKRILLVDGDPLGAVNRRSE
COFF_METJA      FPVVIKNSFSKCGLKVFMARNYDELKQLTKNGKL--IQEFIDFKENDLYRDMRILVVDGEVVGGYRRVSR
RIMKB_DANRE     YPVVVKNARGHRGKAVFLARDKSDLCHLIRHEAPYLFQEYVKESHXXXXXXXXXXXXX---IGSMLRCST
GSHB_ANACE      GDIVLKPLYDYGGNGVCRICGRADVGAISSAMVERYAQQFI----DDISSDKRVVLLGGRPIGAVRRKAM
GSHB_PROMP      HDVVVKPLGGKGGQGVIRLTKPGIKAMIELITSQEQLPVMMQKFIPEVKEDKRIIIVNGEPIGSINRIPQ
DDL_PSEU5       FPLIVKPAHEGSSIGMAKVGDVAELIAAWRAASAYDAQVLVEQ-----WIQGPEFTVAHGEVLPPIGLGT
DDL_XANAC       LPIIVKPANEGSSVGVSRVFDQAQLEEAVTLAARYLMEQLIE------GDELTVAVLGDTPSIRIVPKGQ
GSHB_PROMM      EEVVLKPLGGRAGQGLVRVXXXXXXXXXXXVTDQEQLPVMVQRFLPAVIEDKRILLVDGEPLGAVNRRPK
DDL_PELPD       --LVVKPVQEGSSVGISIVKEESQLAAAVKLAFRHLVEQFIKG------QEVQVGILDDRPMGAIVSRNE
RIMKB_MOUSE     FPMVVKNTRGHRGKAVFLARDKADLSHLIRHEAPYLFQKYIKESHXXXXXXXXXXXXXXXTMLRCSTDGR
RIMKB_HUMAN     FPMVVKNTRGHRGKAVFLARDKADLSHLIRHEAPYLFQKYVKESHXXXXXXXXXXXXXXXTMLRCSTDGR
RIMKB_BOVIN     FPMVVKNTRGHRGKAVFLARDKADLSHLIRHEAPYLFQKYVKESHXXXXXXXXXXXXXXXTMLRCSTDGR
CH61_CUCMA      GELIAKAMEKVGKEGVITIGKTMDNE-LEVVEGMKLDRGYISP---------------------------


                         .         .         .         +         .         .         .:280
query           GWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTEVN
MPTN_METMP      NWITNIHQNGVPEKCEITEELSKIVLAAKDAVGLVYAGVDILES-SDGLKVIEVNACPSWEGLSRISEVD
MPTN_METJA      NWKNNVSQGGRVEKCEITXXXXXXXXXXXXXXGLFYAGVDLIESE-DGLKVLEVNSTPSWIGLSKVSEVN
MPTN_METMA      SWVNNLSQGGSSDRCVLTDEQEKIAEKASLALGTTFAGIDIIEGTEESEEILEVNGTPSGKGIFDAWGIN
MPTN_METAC      SWVNNLSRGGSADRCVXXXXXXXXXXXXXXXVGTTFAGIDIIESTGQGSRILEVNGTPSGKGIFDAWGIN
RIMK_LEGPL      DFRANVHQGGKAVKVKLSPQERAIAVSAAKTMGLRVAGVDLIRSN-HGPLVLEINSSPGLEGIEKATNIN
RIMK_LEGPH      DFRANVHQGGKAVKVKLSPQERAIAVSAAKTMGLRVAGVDLIRSN-HGPLVLEINSSPGLEGIEKATNIN
RIMK_LEGPC      DFRANVHQGGKAVKVKLSPQERAIAVSAAKTMGLRVAGVDLIRSN-HGPLVLEINSSPGLEGIEKATNIN
RIMK_LEGPA      DFRANVHQGGKAVKVKLSPQERAIAVSAAKTMGLRVAGVDLIRSN-HGPLVLEINSSPGLEGIEKATNIN
RIMK_VIBVY      EFRSNLHRGGSAQLVRLSKEERATAINAAKVMGLNLCGVDILQSK-NGPVVMEVNSSPGLEGIEQATNKD
RIMK_VIBVU      EFRSNLHRGGSAQLVRLSKEERATAINAAKVMGLNLCGVDILQSK-NGPVVMEVNSSPGLEGIEQATNKD
RIMK2_HAHCH     PFRSNLHRGGSAQVVKLRPNERRLAVQAAQVMGLDLAGVDIIRS-SHGPLVLEVNSSPGLKGIESATNKD
RIMK_VIBSL      GFRSNLHRGGTAQLVKLTKEERATAINAAKIMGLNLCGVDILQS-KNGPVVMEVNSSPGLEGIEKSTGKD
RIMK_HAEIN      NFRANCHRGGKTEKITLSDEEKQIAIQATKAIGLDVAGVDLIRS-KKGLLVLEVNASPGLEMIEKTS---
RIMK_CELJU      DFRSNLHRGGTAKVTKLSPTERRTAIKAAQTMGLKVAGVDLLRS-SRGPLVMEVNSSPGLEGIESATGKD
RIMK_PASMU      NFRANFHRGGLAEKVSLSEAEKTMAVKATKALGLDVAGVDLIRA-KRGTLVLEVNASPGLEMIEKTSGID
RIMK1_SHEAM     PFRSNLHRGGSATLVKLTPEERSVAVRAAKTMGLNVAGVDLLRSN-HGPLVMEVNSSPGLEGIEGATGKD
RIMK_HAEIG      NFRANCHRGGKTEKITLSDEEKQIAIQATKAIGLDVAGVDLIRS-KNGLLVLEVNASPGLEMIEKTS---
RIMK_HAEDU      DFRANIHQGGSASVIQLNTAEQQLAVLAAKTIGLDVAGVDLIRSN-KGLLVLEVNACPGLDGIEKASKLD
RIMK_TERTT      EFRSNLHRGGSAELVRLTKEERATAVNAAKIMGLNVCGVDVLRA-TRGPVVMEVNSSPGLEGIEYATGKD
RIMK_SERP5      PFRSNLHRGGTARKVSITAKERAIAVKAATTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGVESTTGLD
RIMK_HAEIE      DFRANCHRGGKTEKIILSDDEKQIAIRATKAIGLDVAGVDLIRS-KNGLLVLEVNASPGLEMIEKTSGV-
RIMK_SHELP      EFRSNLHRGGVAQLVRLSKDERATALNAAKAMGLNLCGVDILQSN-NGPVVMEVNSSPGLEGIEQATGKD
RIMK_VIBPA      EFRSNLHRGGSAQLVRLSKEERATAVNAAKVMGLNLCGVDILQS-KNGPVVMEVNSSPGLEGIELATGKD
RIMK_THISH      EFRSNLHRGGSAEPVKLTPQERATAVKAAKVIGLNVCGVDILRS-SHGPVVIEVNASPGLEGIETASGVD
RIMK_SYNPX      DFRSNIHQGGSAQAVRIRPEERKLAVSATRALGLDVAGVDIIRSE-RGPLLLEVNSSPGLEGIETATGKD
RIMK_PECCP      AFRSNLHRGGSANNVKITAQERAIAIKATKTLGLNVAGVDILRAD-RGPLVMEVNASPGLEGIETTTGFD
RIMK_HAEI8      DFRANCHRGGKTEKIILSDDEKQIAIRATKAIGLDVAGVDLIRS-KNGLLVLEVNASPGLEMIEKTSGV-
RIMK_AERS4      PFRSNLHRGGTAEAIKISPEERATAVQAAKIMGLDVAGVDILRS-ARGPLVLEVNSSPGLQGVEAASGKD
RIMK_SACD2      EFRSNLHRGGSATLVRLSKEERATAVNAAKVMGLNVCGVDILQS-NNGPVVMEVNSSPGLEGIENATNKD
RIMK_ALHEH      EFRSNIHRGGQASTVRITPEERSMAVRAARIMGLNVAGVDLIRS-AHGSLVLEVNSSPGLEGIEKATGKD
LYSX_SULSO      NWRTNTALGAKAYPLKIDEELRELALKVKXXXXXXXXXXXXXXXKDRGYLVDEVNGVPEYKNTVRVNNFN
RIMK_ECO24      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_AERHH      PFRSNLHRGGTAEAIKISPEERATAVQAAKIMGLDVAGVDILRS-ARGPLVLEVNSSPGLQGVEAASGKD
RIMK_MANSM      EFRANCHRGGITQQITLSDDEKLIAVRAAQALGLDVAGVDLIQS-KKGLLVLEVNASPGLEMIEKTSGID
RIMK2_SHESM     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPVVMEVNSSPGLEGIEGATAKD
RIMK2_SHESA     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPVVMEVNSSPGLEGIEGATAKD
RIMK1_SHESR     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPVVMEVNSSPGLEGIEGATAKD
RIMK_SHISS      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_SHIFL      GYFSNLHRGGAASVASITLQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_SHIF8      GYFSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_SHIDS      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_KLEP3      DFRSNLHRGGMATVAQISDEERAIAIKATQTLGLDVAGVDILRA-TRGPLVMEVNASPGLEGVETTTGVD
RIMK_ECOUT      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOSE      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOLU      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOLI      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOLC      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOL5      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOK1      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOHS      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECODH      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOBW      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECO8A      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECO5E      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECO57      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECO55      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECO45      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECO27      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_CITK8      DFRSNLHRGGMASIAPREREI---AIKAAQTMGLDVAGVDILRAE-RGPLVMEVNASPGLEGVEKTTGVD
RIMK2_SHESW     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPVIMEVNSSPGLEGIEGATTKD
RIMK2_SHEON     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPLVMEVNSSPGLEGIEGATAKD
RIMK2_SHEB5     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPVIMEVNSSPGLEGIEGATTKD
RIMK1_SHEPC     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPVIMEVNSSPGLEGIEGATTKD
RIMK1_SHEB9     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPVIMEVNSSPGLEGIEGATTKD
RIMK1_SHEB8     PFRSNLHRGGTASLVKLTPEERSVAIRAAKTMGLNVAGVDLLRSN-HGPVIMEVNSSPGLEGIEGATTKD
RIMK_ECOSM      DFRSNLHRGGVASVAPQEREI---AIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECO7I      DFRSNLHRGGVASVAPQEREI---AIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_SHIB3      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK2_SHEFN     PFRSNLHRGGSATLVKLTPEERSVALRAAKTMGLNIAGVDLLRSN-HGPVVMEVNSSPGLEGIEKATQKD
RIMK1_HAHCH     EFRSNLHRGGQASVIKITPEERSTAVRAARVMGLNVAGVDLLRS-NHGPLVMEVNSSPGLEGIETATGKD
RIMK_SHEPA      PFRANIHMGGXXXXXXXXXXEKQLAIKAAKTMGLRVAGVDIIRS-SRGPLLLEINSSPGLEGIESATGID
RIMK_SYNP2      EFRSNLHRGGKADKVRLTPEERSTAVRAAKAMGLRVAGVDLLRSN-HGPLVMEINSSPGLEGIEKTTGVD
RIMK_SHEHH      PFRANIHQGGXXXXXXXXXXERQLALKAAKTMGLRVAGVDIIRS-SRGPLLLEINSSPGLEGIESATGID
RIMK_PSEPK      PFRSNLHRGGVASLIKITPEERITAIRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIEVTTGKN
RIMK_PSEP1      PFRSNLHRGGVASLIKITPEERITAIRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIEVTTGKN
RIMK_HAES2      EFRANFHRGGSAEKIQLTEQEKVLALKATKCLGLDVAGVDLIRSK-QGLLVLEVNASPGLEMIEKTSGID
RIMK_HAES1      EFRANFHRGGSAEKIQLTEQEKVLALKATKCLGLDVAGVDLIRSK-QGLLVLEVNASPGLEMIEKTSGID
RIMK_ESCF3      DFRSNLHRGGAASIACITEREREIALKAARTMALDVAGVDILRAE-RGPLVMEVNASPGLEGIEKTTGVD
RIMK_IDILO      AFRSNLHRGGSASLVKLTPAERATAVKAAKTMGLNVAGVDILRSN-HGPLVMEVNSSPGLEGIEQATEKD
RIMK1_SHEDO     AFRSNLHRGGTATLVKLSPEERTTAIRAAKTMGLSLAGVDLLRSN-HGPVVMEVNSSPGLEGIEAATQKD
RIMK_VIBCM      DFRSNLHRGGTASLVKITPQERKTAIEAAKIMGLNVAGVDLLRS-ARGPLVMEVNSSPGLEGIEAATGKD
RIMK_VIBCH      DFRSNLHRGGTASLVKITPQERKTAIEAAKIMGLNVAGVDLLRS-ARGPLVMEVNSSPGLEGIEAATGKD
RIMK_VIBC3      DFRSNLHRGGTASLVKITPQERKTAIEAAKIMGLNVAGVDLLRS-ARGPLVMEVNSSPGLEGIEAATGKD
RIMK_SHIBS      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECOL6      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_ECO81      DFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGID
RIMK_PSYIN      EFRSNLHRGGSAVVVKLTKIERETAVNAAKIMGLNFCGVDLLRSES-GPKVMEVNSSPGLEGIETATGKN
RIMK_PSEFS      PFRSNLHRGGSASLIKITPEERMTALRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIETTTGKN
RIMK_PSEF5      PFRSNLHRGGSASLIKITPEERMTALRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIETTTGKN
RIMK_ENT38      DFRSNLHRGGVARIADITEREREIAITAAQTLGLDIAGVDILRAN-RGPLVMEVNASPGLEGIEKTTGVD
RIMK_PSEPF      PFRSNLHRGGSASLIKITPEERMTALRAAKVMGLAVAGVDILRSN-HGPLVMEVNSSPGLEGIETTTGKN
RIMK1_SHEFN     PFRSNLHRGGSASIVKLTPEERSTALRAAKTMGLNVAGVDILRSK-HGPLVMEVNSSPGLEGIEKATGID
RIMK_DESAD      DFRSNLHQGGSATQVRITPEERSTAVRSAKIMGLGFCGVDILRSN-HGPVVMEVNSSPGLEGIEKTTDID
RIMK_XANOR      DFRSNLHLGGTAVVADLEREV---AVRSARALGLAVAGVDLIRSK-RGPLVLEVNSTPGLEGVEGVCGVD
RIMK_XANOM      DFRSNLHLGGTAVVADLEREV---AVRSARALGLAVAGVDLIRSK-RGPLVLEVNSTPGLEGVEGVCGVD
RIMK_PSEPW      PFRSNLHRGGVASLIKITPEERITAIRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIEVTTGKN
RIMK_PSEPG      PFRSNLHRGGVASLIKITPEERITAIRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIEVTTGKN
RIMK_PSEMY      AFRSNLHRGGSASLIKITPEERMTAVRAAKVMGLNVAGVDILRSN-HGPLVMEVNSSPGLEGIETTTGKD
LYSX_SULTO      NWKTNTALGAKAEPLKIDEELQDLALKVKDIIGGFFLGIDVFEDPERGYIINEVNGVPEYKNTVRVNNFN
RIMK_PSEHT      EFRSNLHRGGSATLVRITPEERKTAVAAAKAMGLNVAGVDLLRS-SRGPLVMEVNSSPGLEGIEIATGKD
RIMK_MARAV      EFRSNLHRGGTASLVRITPEERRTAITAAKAMGLNVAGVDLLRS-SRGPLVMEVNSSPGLEGIENATGKN
RIMK_ALCBS      PFRSNLHRGGSASLIRITPEERATAVRAARIMGLNVAGVDILRSH-HGPVVMEVNSSPGLEGIETATNKD
RIMK2_SHEAM     DFRSNLHLGGSAEPVKITPQERKSAVAAAKAMGLVVAGVDILRS-ARGPLVLEVNSAPGIEGIEQATGIK
RIMK_PSEE4      PFRSNLHRGGVASLIKITPEERMTAIRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIEVTTGKD
RIMK_ERWCT      AFRSNLHRGGSANKVKITAQERAIAIKAAKTLGLNVAGVDILRAD-RGPLVMEVNASPGLEGIETTTGLD
RIMK_SALSV      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_PSEU5      PFRSNLHRGGSASLIKITPEERMTAIRAAKVMGLNVAGVDILRSN-HGPLVMEVNSSPGLAGIEETTGKD
RIMK_HALHL      EFRSNLHRGGSASLVRITPKERATAVKAAKVLGLNVCGVDILRANS-GPVIMEVNSSPGLEGIETATGKD
RIMK_SALTY      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALTI      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALPK      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALPC      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALPB      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALPA      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALNS      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALHS      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALG2      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALEP      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALDC      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALCH      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_SALA4      DFRSNLHRGGVASIATITPRERDIAIKAAQTLGLDVAGVDILRA-ARGPLVMEVNASPGLEGIEKTTGVD
RIMK_PSESM      PFRSNLHRGGSASLIKITPEERMTALRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIEVTTSKD
RIMK_PSE14      PFRSNLHRGGSASLIKITPEERMTALRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIEVTTSKD
RIMK1_PSEA6     EFRSNLHRGGSAALVKLTAVERATAVSAAGAMGLNVCGVDLLRS-SHGPVVMEVNSSPGLEGIEAATSKD
RIMK_RHOBA      GFRSNVHRGGQTEAVVLDETYAETAVRAAQIMGLRVAGVDMLEG-TNGPQVMEVNSSPGLEGIESATKLD
RIMK_PSEAE      PFRSNLHRGGSASLIKITPEERMTAIRAARVMGLNVAGVDILRSN-HGPLVMEVNSSPGLEGIESTTGKD
RIMK_PSEAB      PFRSNLHRGGSASLIKITPEERMTAIRAARVMGLNVAGVDILRSN-HGPLVMEVNSSPGLEGIESTTGKD
RIMK_PSEA8      PFRSNLHRGGSASLIKITPEERMTAIRAARVMGLNVAGVDILRSN-HGPLVMEVNSSPGLEGIESTTGKD
RIMK_PSEA7      PFRSNLHRGGSASLIKITPEERMTAIRAARVMGLNVAGVDILRSN-HGPLVMEVNSSPGLEGIESTTGKD
RIMK_ERYLH      AFRSNLHRGGSAQLIKITPEERSTAVRAAKHMGLNVCGVDMLRSN-HGPVIMEVNSSPGLEGIEKATEKD
RIMK_AZOVD      PFRSNLHRGGTASLIKITPEERMTAIRAAKVMGLNVAGVDILRSN-HGPLVMEVNSSPGLEGIETTTGKD
RIMK_PSEU2      PFRSNLHRGGSASLIKITPEERMTALRAAKVMGLSVAGVDILRSN-HGPLVMEVNSSPGLEGIEVTTSKD
RIMK_PHOPR      DFRSNLHRGGSASLVRITPEERKTAVAAAKAMGLSVAGVDLLRSE-RGPLIMEVNSSPGLEGIEAATEKD
RIMK_VIBFM      EFRSNLHRGGSASLVKLTPEERKTAVAAANIMGLNVAGVDLLRS-ERGPLVMEVNSSPGLEGIEKATGKD
RIMK_VIBF1      EFRSNLHRGGSASLVKLTPEERKTAVAAANIMGLNVAGVDLLRSD-RGPLVMEVNSSPGLEGIEKATGKD
RIMK_NITOC      EFRSNLHRGGSASLVRITPEERSTAIRAAQTMGLNVAGVDILRS-NHGPLVMEVNSSPGLEGIESATGKD
RIMK_THICR      DFRSNLHQGGSASLVRITPEERATAVRAAKIMGLNVCGVDLLRSN-HGPVVMEVNSSPGIEGIETATQKD
RIMK_XANCP      DFRSNLHLGGTAAMAEASPQEQDVAVRSARALGLAVAGVDLIRSQ-RGPLVLEVNSTPGLEGVEGVCGVD
RIMK_XANC8      DFRSNLHLGGTAAMAEASPQEQDVAVRSARALGLAVAGVDLIRSQ-RGPLVLEVNSTPGLEGVEGVCGVD
RIMK_TRIEI      EFRSNLHQGGTAKKIKLTPQERSIAMRSAKAIGLKVAGVDLLRSD-HGPVVMEVNSSPGLEGIETATGVD
RIMK_MARMM      DFRSNLHRGGSASKIKLTPEERSTAVRAAKVMGLNVAGVDMLR-GNHGPLIMEVNSSPGLEGIEASTGVD
RIMK2_SHESR     DFRSNLHLGGCGEKVKITPEERKMAVAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
RIMK1_SHESM     DFRSNLHLGGCGEKVKITPEERKMAVAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
RIMK1_SHEON     DFRSNLHLGGCGEKVKITPKERKMAVAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
RIMK_PELCD      EFRSNIHRGGKATVVRLTPEERATAVRSAHIMGLNVAGVDILQS-NRGPIVMEVNSSPGLEGIETATGKD
RIMK_COXBU      DFRSNVHRGGTIKITPQEREI---SINAAKALGLNVAGVDLLRSK-RGPLVLEVNSSPGLEGIENITKKD
RIMK_COXBR      DFRSNVHRGGTIKITPQEREI---SINAAKALGLNVAGVDLLRSK-RGPLVLEVNSSPGLEGIENITKKD
RIMK_COXBN      DFRSNVHRGGTIKITPQEREI---SINAAKALGLNVAGVDLLRSK-RGPLVLEVNSSPGLEGIENITKKD
RIMK_COXB2      DFRSNVHRGGTIKITPQEREI---SINAAKALGLNVAGVDLLRSK-RGPLVLEVNSSPGLEGIENITKKD
RIMK_COXB1      DFRSNVHRGGTIKITPQEREI---SINAAKALGLNVAGVDLLRSK-RGPLVLEVNSSPGLEGIENITKKD
RIMK_XANCB      DFRSNLHLGGTAAMAEASPQEQDVAVRSARALGLAVAGVDLIRSQ-RGPLVLEVNSTPGLEGVEGVCGVD
RIMK_ALISL      EFRSNLHRGGSASLVKLTPEERKTAVAAANIMGLNVAGVDLLRSD-RGPLVMEVNSSPGLEGIEAATGKD
RIMK1_SHESA     DFRSNLHLGGKVKITPAERK---MAVAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
RIMK2_SHEPC     DFRSNLHLGGCGETVKITSVERKMAIAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
RIMK1_SHESW     DFRSNLHLGGCGETVKITSVERKMAIAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
RIMK_METBU      NFRSNLHRGGSAEVIRITPEERSTAVSAAKIMGLNVAGVDLLRSN-HGPVVMEVNSSPGLRGIETATGKD
RIMK_ALTMD      PFRSNLHRGGQASLVRLSPAERKTAVDAAKTMGLNCCGVDILRSN-NGPVVMEVNSSPGLEGIEKATTKD
RIMK_XANC5      DFRSNLHLGGXXXXXXXXXXXXXXXXRSARALGLTVAGVDLIRSK-RGPLVLEVNSTPGLEGVEGVCGVD
RIMK_STRMK      DFRSNLHAGGTAVAAKASRAEQQVAVRSAKALGLSVCGVDLIRS-ARGPLVLEVNSTPGLEGIEAACGVD
RIMK_STRM5      DFRSNLHAGGTAVAAKASRAEQQVAVRSAKALGLSVCGVDLIRS-ARGPLVLEINSTPGLEGIEAACGVD
RIMK2_SHEB9     DFRSNLHLGGCGEVVKITAVERKMAIAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
RIMK2_SHEB8     DFRSNLHLGGCGEVVKITAVERKMAIAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
RIMK1_SHEB5     DFRSNLHLGGCGEVVKITAVERKMAIAAVKAMGLVVAGVDILRSN-RGPLILEVNSAPGIEGIEQTTGIS
COFF_METMP      NFITNLYVGGQIEPLNVSSELEEIALKCSECMNGYIMGIDILPKDGE-YYVVEVNTAPGTKGFR------
RIMK_XANAC      DFRSNLHLGGXXXXXXXXXXXXXXXXRSARALGLAVAGVDLIRS-RRGPLVLEVNSTPGLEGVEGVCGVD
RIMK_MARMS      EFRSNLHRGGTASLIRLSPEERRTAVEAAKVMGLNMCGVDILRS-NNGPLIMEVNSSPGLEGIESATGKD
RIMK2_PSEA6     AFRSNLHRGGSASLVRLSPQERKTAIDAAKTMGLNMCGVDILRSN-NGPVVMEVNSSPGLEGIETATGKD
RIMK_CHRSD      EFRSNLHRGGTASVIRITPEERSTAIRAAKAMGLRIAGVDLLRSN-HGPVIMEVNSSPGLQGIETATGKD
RIMK2_SHEDO     PFRSNLHRGGSATIVKLTPEERSTALRAAKTMGLNVAGVDILRSK-HGPLVMEVNSSPGLEGIEKATGID
RIMK_XYLFT      DFRSNLHLGGXXXXXXXXXXXXXXXXRSAHALGLTVAGVDLIRS-RRGPLVLEVNPTPGLEGIEATSGTN
RIMK_XYLF2      DFRSNLHLGGXXXXXXXXXXXXXXXXRSAHALGLTVAGVDLIRS-RRGPLVLEVNPTPGLEGIEATSGTN
RIMK_XYLFM      DFRSNLHLGGXXXXXXXXXXXXXXXXRSAHALGLTVAGVDLIRS-RRGPLVLEVNPTPGLEGIEATSGTN
RIMK_SODGM      DFRSNLHRGGSARAVTISXXXXXXXXXXXXXLGLNVAGVDILRAK-RGPLVMEVNASPGLEGIEAASDMD
RIMK_DESPS      SGSSNTHQDGKSSIVKITPEERSLALKAAKVLGLQIASVDIINSKA-GPLLLEVNSSPELEGIEIATGKD
GSHB_SYNPX      GFRSNLAVGGQAEATELERQICAALAPALRAEGLFFVGIDVIGGMLSEINVTSPTGVREVERLMQE----
COFF_METJA      DFRTNLYLGNVVEKLNIDEELEELALKCADLSEAVILGVDILPT-KDNYYVIELNSSPGTKGFRDNADKK
RIMKB_DANRE     DMQSNCSLGGVGMMCPLSEQGKQLAVQVCNILGMDVCGIDLLQKNDGSFVVCEANANVGFIAFDQACGMD
GSHB_ANACE      GEITNLRVGATPEATELEREICHDVGMLLSSVDILFAGIDIL-----GGHLIEVN---------------
GSHB_PROMP      GFRSNLAMGGKAEKTNLEKKICTELSQHFKDEGLFFVGIDVIN---EMLSEINVTSPTGLREIETLSNKS
DDL_PSEU5       PHTKYLASDTQYLDAAREEALKVLSARACEAVGIGWARVDVMQDAEGNFWLLEVNTVP------------
DDL_XANAC       WYDYNIADDTQYLCPGLEGEIRQLALDAFRAAGCGWGRVDVMRDGSSGLYLLEVNTAP------------
GSHB_PROMM      AFRSNLAMGGRPEPTELELQICAELAPVLREQGLFFVGIDVI----------------------------
DDL_PELPD       FYDFEAGMAEHFFPARLEKGLYEEALRVGLAACRCYSRVDLLVTPAGECYVLEVNTLPGMTALSLLPEIA
RIMKB_MOUSE     -MQSNCSLGGVGMMCSLSEQGKQLAIQVSNILGTDVCGIDLLMKDDGSFCVCEANANVGFIAFDKACNLD
RIMKB_HUMAN     -MQSNCSLGGVGMMCSLSEQGKQLAIQVSNILGMDVCGIDLLMKDDGSFCVCEANANVGFIAFDKACNLD
RIMKB_BOVIN     -MQSNCSLGGVGMMCSLSEQGKQLAIQVSNILGMDVCGIDLLMKDDGSFCVCEANANVGFIAFDKACNLD
CH61_CUCMA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IAGALAKNLLERLHSSYFAHSGSSQKx
MPTN_METMP      IAQNLIDEAL-----------------
MPTN_METJA      IADKLLEKIIQYVKS------------
MPTN_METMA      PADHILEYL------------------
MPTN_METAC      PA-------------------------
RIMK_LEGPL      LAGKI----------------------
RIMK_LEGPH      LAGKI----------------------
RIMK_LEGPC      LAGKI----------------------
RIMK_LEGPA      LAGKI----------------------
RIMK_VIBVY      VAGMI----------------------
RIMK_VIBVU      VAGMI----------------------
RIMK2_HAHCH     IAGAI----------------------
RIMK_VIBSL      VA-------------------------
RIMK_HAEIN      ---------------------------
RIMK_CELJU      IAGLIVAYMEE----------------
RIMK_PASMU      IA-------------------------
RIMK1_SHEAM     VAGAIIAFIEKAAH-------------
RIMK_HAEIG      ---------------------------
RIMK_HAEDU      IAGLIIDYLL-----------------
RIMK_TERTT      VAGMIVE--------------------
RIMK_SERP5      IAGRMIEYIEQRGRPGFRLKSG-----
RIMK_HAEIE      ---------------------------
RIMK_SHELP      VAGLI----------------------
RIMK_VIBPA      VAGMI----------------------
RIMK_THISH      VAGRI----------------------
RIMK_SYNPX      LAGLMIQEIERKL--------------
RIMK_PECCP      IAGMMIE-FIEQNTQRRFATSASISK-
RIMK_HAEI8      ---------------------------
RIMK_AERS4      VAGKIIEFL------------------
RIMK_SACD2      VA-ALVMEFIE----------------
RIMK_ALHEH      IAGTI----------------------
LYSX_SULSO      VSKFLLEKAAE----------------
RIMK_ECO24      IAGKMIRWIERHATTEYCLKTG-----
RIMK_AERHH      VAGKIIEFL------------------
RIMK_MANSM      VATQMIAYLEKKI--------------
RIMK2_SHESM     VAGAI----------------------
RIMK2_SHESA     VAGAI----------------------
RIMK1_SHESR     VAGAI----------------------
RIMK_SHISS      IAGKMIRWIERHATTEYCLKTG-----
RIMK_SHIFL      IAGKMIRWIERHATTEYCLKTG-----
RIMK_SHIF8      IAGKMIRWIERHATTEYCLKTG-----
RIMK_SHIDS      IAGKMIRWIERHATTEYCLKTG-----
RIMK_KLEP3      IASRM----------------------
RIMK_ECOUT      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECOSE      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECOLU      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECOLI      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECOLC      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECOL5      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECOK1      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECOHS      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECODH      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECOBW      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECO8A      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECO5E      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECO57      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECO55      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECO45      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECO27      IAGKMIRWIERHATTEYCLKTG-----
RIMK_CITK8      IAGRM----------------------
RIMK2_SHESW     VAGAI----------------------
RIMK2_SHEON     VAGAI----------------------
RIMK2_SHEB5     VAGAI----------------------
RIMK1_SHEPC     VAGAI----------------------
RIMK1_SHEB9     VAGAI----------------------
RIMK1_SHEB8     VAGAI----------------------
RIMK_ECOSM      IAGKMIRWIERHATTEYCLKTG-----
RIMK_ECO7I      IAGKMIRWIERHATTEYCLKTG-----
RIMK_SHIB3      IAGKMIRWIERYATTEYCLKTG-----
RIMK2_SHEFN     VADAI----------------------
RIMK1_HAHCH     IAGLI----------------------
RIMK_SHEPA      IAGAMIESIEKKL--------------
RIMK_SYNP2      VAGKIIEYL------------------
RIMK_SHEHH      IAGAMIDSIEKKL--------------
RIMK_PSEPK      VAGMIIEHL------------------
RIMK_PSEP1      VAGMIIEHL------------------
RIMK_HAES2      IA-------------------------
RIMK_HAES1      IA-------------------------
RIMK_ESCF3      IAGKMIR--------------------
RIMK_IDILO      VASQI----------------------
RIMK1_SHEDO     VANAI----------------------
RIMK_VIBCM      IAGMIVE--------------------
RIMK_VIBCH      IAGMIVE--------------------
RIMK_VIBC3      IAGMIVE--------------------
RIMK_SHIBS      IAGKMIRWIERYATTEYCLKTG-----
RIMK_ECOL6      IASKMIRWIERHATTEYCLKTG-----
RIMK_ECO81      IASKMIRWIERHATTEYCLKTG-----
RIMK_PSYIN      IAGMVFEFLEKNMKAEH----------
RIMK_PSEFS      VAGIIIEHL------------------
RIMK_PSEF5      VAGIIIEHI------------------
RIMK_ENT38      IAGKMISWIERHATPGYYLKTG-----
RIMK_PSEPF      VAGIIIEHL------------------
RIMK1_SHEFN     VAEKIIQFIEKNVKST-----------
RIMK_DESAD      VAGQL----------------------
RIMK_XANOR      VAGAIVQHLEQSVRRS-----------
RIMK_XANOM      VAGAIVQHLEQSVRRS-----------
RIMK_PSEPW      VAGMIIEHL------------------
RIMK_PSEPG      VAGMIIEHL------------------
RIMK_PSEMY      VAGMIIQYL------------------
LYSX_SULTO      VSEYLIRKIEE----------------
RIMK_PSEHT      IAG-MVIDFIEKTASS-----------
RIMK_MARAV      VAGMI----------------------
RIMK_ALCBS      VAGLLIK--------------------
RIMK2_SHEAM     VA-------------------------
RIMK_PSEE4      VAGMIIEHL------------------
RIMK_ERWCT      IA-------------------------
RIMK_SALSV      IAGRM----------------------
RIMK_PSEU5      VAGLIIQYL------------------
RIMK_HALHL      VAGMI----------------------
RIMK_SALTY      IAGRM----------------------
RIMK_SALTI      IAGRM----------------------
RIMK_SALPK      IAGRM----------------------
RIMK_SALPC      IAGRM----------------------
RIMK_SALPB      IAGRM----------------------
RIMK_SALPA      IAGRM----------------------
RIMK_SALNS      IAGRM----------------------
RIMK_SALHS      IAGRM----------------------
RIMK_SALG2      IAGRM----------------------
RIMK_SALEP      IAGRM----------------------
RIMK_SALDC      IAGRM----------------------
RIMK_SALCH      IAGRM----------------------
RIMK_SALA4      IAGRM----------------------
RIMK_PSESM      VAGMIIEYL------------------
RIMK_PSE14      VAGMIIEYL------------------
RIMK1_PSEA6     VANMI----------------------
RIMK_RHOBA      IAGAI----------------------
RIMK_PSEAE      IAGIIIQYL------------------
RIMK_PSEAB      IAGIIIQYL------------------
RIMK_PSEA8      IAGIIIQYL------------------
RIMK_PSEA7      IAGIIIQYL------------------
RIMK_ERYLH      IAGQI----------------------
RIMK_AZOVD      VAGIIIEYL------------------
RIMK_PSEU2      VAGMI----------------------
RIMK_PHOPR      IAGMI----------------------
RIMK_VIBFM      VAGLI----------------------
RIMK_VIBF1      VAGLI----------------------
RIMK_NITOC      VA-------------------------
RIMK_THICR      IASQI----------------------
RIMK_XANCP      VAGTIIQHL------------------
RIMK_XANC8      VAGTIIQHL------------------
RIMK_TRIEI      VSGKIIEFLEKNL--------------
RIMK_MARMM      VA-------------------------
RIMK2_SHESR     V--------------------------
RIMK1_SHESM     V--------------------------
RIMK1_SHEON     V--------------------------
RIMK_PELCD      VADEIIR--------------------
RIMK_COXBU      IAGMI----------------------
RIMK_COXBR      IAGMI----------------------
RIMK_COXBN      IAGMI----------------------
RIMK_COXB2      IAGMI----------------------
RIMK_COXB1      IAGMI----------------------
RIMK_XANCB      VAGTIIQHL------------------
RIMK_ALISL      VAGLI----------------------
RIMK1_SHESA     V--------------------------
RIMK2_SHEPC     V--------------------------
RIMK1_SHESW     V--------------------------
RIMK_METBU      IAGMI----------------------
RIMK_ALTMD      VASMI----------------------
RIMK_XANC5      VAAAIVQHLEQSVRRS-----------
RIMK_STRMK      VATRIIEHV------------------
RIMK_STRM5      VATRIIEHV------------------
RIMK2_SHEB9     V--------------------------
RIMK2_SHEB8     V--------------------------
RIMK1_SHEB5     V--------------------------
COFF_METMP      ---------------------------
RIMK_XANAC      VAAAIVVHLEQSVRRS-----------
RIMK_MARMS      VASMIIKHI------------------
RIMK2_PSEA6     VASMIIEFIVK----------------
RIMK_CHRSD      IAGQI----------------------
RIMK2_SHEDO     VA-------------------------
RIMK_XYLFT      VAIKIVRHVEEML--------------
RIMK_XYLF2      VAIKIVRHVEEML--------------
RIMK_XYLFM      VAIKIVHHVEEML--------------
RIMK_SODGM      IATLMITFIEARL--------------
RIMK_DESPS      IAGMVISSIEKKL--------------
GSHB_SYNPX      ---PLADQTIERLRS------------
COFF_METJA      IAEALVR--------------------
RIMKB_DANRE     VAGIVADFVLSLLPS------------
GSHB_ANACE      ---------------------------
GSHB_PROMP      VSDKVIEKLLE----------------
DDL_PSEU5       ---------------------------
DDL_XANAC       ---------------------------
GSHB_PROMM      ---------------------------
DDL_PELPD       AKGA-----------------------
RIMKB_MOUSE     VAGIIA---------------------
RIMKB_HUMAN     VAGIIA---------------------
RIMKB_BOVIN     VAGIIA---------------------
CH61_CUCMA      ---------------------------