[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA56844.1

[Show Plain Result]


## Summary of Sequence Search
    1::276
    1::276     e-151 100%  276 aa  DAPF_NITOC RecName: Full=Diaminopimelate epimerase;       
    1::278     6e-91  61%  278 aa  DAPF_THISH RecName: Full=Diaminopimelate epimerase;       
    1::278     3e-88  56%  279 aa  DAPF_ALHEH RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-85  57%  276 aa  DAPF_CELJU RecName: Full=Diaminopimelate epimerase;       
    1::275     2e-84  60%  277 aa  DAPF_NITMU RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-83  57%  276 aa  DAPF_PSEAE RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-83  57%  276 aa  DAPF_PSEA8 RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-83  57%  276 aa  DAPF_PSEAB RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-83  57%  276 aa  DAPF_PSEA7 RecName: Full=Diaminopimelate epimerase;       
    1::276     4e-83  59%  276 aa  DAPF_PSEU5 RecName: Full=Diaminopimelate epimerase;       
    1::276     9e-82  57%  276 aa  DAPF_PSEMY RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-81  57%  276 aa  DAPF_DECAR RecName: Full=Diaminopimelate epimerase;       
    1::276     5e-81  59%  276 aa  DAPF_AZOVD RecName: Full=Diaminopimelate epimerase;       
    2::275     1e-80  59%  275 aa  DAPF_SHEON RecName: Full=Diaminopimelate epimerase;       
    2::275     1e-80  59%  275 aa  DAPF_SHESR RecName: Full=Diaminopimelate epimerase;       
    2::275     1e-80  59%  275 aa  DAPF_SHESM RecName: Full=Diaminopimelate epimerase;       
    2::275     1e-80  60%  275 aa  DAPF_SHESA RecName: Full=Diaminopimelate epimerase;       
    1::275     5e-80  53%  275 aa  DAPF_NITEU RecName: Full=Diaminopimelate epimerase;       
    2::275     9e-80  59%  275 aa  DAPF_SHEFN RecName: Full=Diaminopimelate epimerase;       
    1::276     1e-79  57%  276 aa  DAPF_PSE14 RecName: Full=Diaminopimelate epimerase;       
    2::275     3e-79  59%  275 aa  DAPF_SHEDO RecName: Full=Diaminopimelate epimerase;       
    1::279     3e-79  56%  281 aa  DAPF_ALCBS RecName: Full=Diaminopimelate epimerase;       
    1::276     4e-79  59%  277 aa  DAPF_AZOSB RecName: Full=Diaminopimelate epimerase;       
    1::276     7e-79  57%  276 aa  DAPF_PSEU2 RecName: Full=Diaminopimelate epimerase;       
    1::276     7e-79  58%  276 aa  DAPF_PSEPK RecName: Full=Diaminopimelate epimerase;       
    1::276     1e-78  59%  276 aa  DAPF_PSEE4 RecName: Full=Diaminopimelate epimerase;       
    1::276     1e-78  58%  276 aa  DAPF_PSEPG RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-78  57%  276 aa  DAPF_PSEPW RecName: Full=Diaminopimelate epimerase;       
    1::278     2e-78  58%  278 aa  DAPF_NITEC RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-78  57%  276 aa  DAPF_PSESM RecName: Full=Diaminopimelate epimerase;       
    2::275     4e-78  56%  275 aa  DAPF_SHEAM RecName: Full=Diaminopimelate epimerase;       
    2::279     5e-77  58%  280 aa  DAPF_SHESH RecName: Full=Diaminopimelate epimerase;       
    1::276     5e-77  56%  276 aa  DAPF_AERS4 RecName: Full=Diaminopimelate epimerase;       
    1::276     1e-76  58%  276 aa  DAPF_TOLAT RecName: Full=Diaminopimelate epimerase;       
    2::275     2e-76  58%  275 aa  DAPF_SHEB9 RecName: Full=Diaminopimelate epimerase;       
    2::275     2e-76  58%  275 aa  DAPF_SHEB8 RecName: Full=Diaminopimelate epimerase;       
    2::275     2e-76  58%  275 aa  DAPF_SHEB5 RecName: Full=Diaminopimelate epimerase;       
    2::275     2e-76  58%  275 aa  DAPF_SHEB2 RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-76  57%  276 aa  DAPF_HAHCH RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-76  55%  276 aa  DAPF_AERHH RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-76  55%  276 aa  DAPF_PSEFL RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-76  56%  281 aa  DAPF_ACIAD RecName: Full=Diaminopimelate epimerase;       
    2::275     4e-76  57%  275 aa  DAPF_SHESW RecName: Full=Diaminopimelate epimerase;       
    2::275     4e-76  57%  275 aa  DAPF_SHEPC RecName: Full=Diaminopimelate epimerase;       
    1::276     4e-76  55%  276 aa  DAPF_PSEPF RecName: Full=Diaminopimelate epimerase;       
    1::276     8e-76  52%  276 aa  DAPF_PSEHT RecName: Full=Diaminopimelate epimerase;       
    2::278     1e-75  55%  279 aa  DAPF_SHELP RecName: Full=Diaminopimelate epimerase;       
    1::277     5e-75  56%  277 aa  DAPF_SACD2 RecName: Full=Diaminopimelate epimerase;       
    1::276     5e-75  52%  277 aa  DAPF_CHRSD RecName: Full=Diaminopimelate epimerase;       
    1::291     6e-75  59%  296 aa  DAPF_METPP RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-74  54%  287 aa  DAPF_HALHL RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-74  52%  277 aa  DAPF_AZOSE RecName: Full=Diaminopimelate epimerase;       
    1::276     5e-74  53%  281 aa  DAPF_ACIBS RecName: Full=Diaminopimelate epimerase;       
    3::274     9e-74  54%  274 aa  DAPF_ERWT9 RecName: Full=Diaminopimelate epimerase;       
    3::274     9e-74  53%  274 aa  DAPF_ENTS8 RecName: Full=Diaminopimelate epimerase;       
    1::276     1e-73  53%  281 aa  DAPF_ACIBY RecName: Full=Diaminopimelate epimerase;       
    1::276     1e-73  53%  281 aa  DAPF_ACIBC RecName: Full=Diaminopimelate epimerase;       
    1::276     1e-73  53%  281 aa  DAPF_ACIB5 RecName: Full=Diaminopimelate epimerase;       
    1::276     1e-73  53%  281 aa  DAPF_ACIB3 RecName: Full=Diaminopimelate epimerase;       
    2::277     2e-73  56%  279 aa  DAPF_SHEWM RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-73  53%  281 aa  DAPF_ACIBT RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALTY RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALTI RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALSV RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALPK RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALPB RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALPA RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALNS RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALHS RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALDC RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  52%  274 aa  DAPF_SALA4 RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-73  57%  276 aa  DAPF_CHRVO RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-73  54%  274 aa  DAPF_ACTSZ RecName: Full=Diaminopimelate epimerase;       
    1::290     5e-73  58%  294 aa  DAPF_VARPS RecName: Full=Diaminopimelate epimerase;       
    1::276     5e-73  50%  276 aa  DAPF_TERTT RecName: Full=Diaminopimelate epimerase;       
    1::283     8e-73  56%  288 aa  DAPF_CUPTR RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-72  54%  274 aa  DAPF_MANSM RecName: Full=Diaminopimelate epimerase;       
    1::284     1e-72  55%  286 aa  DAPF_BURP8 RecName: Full=Diaminopimelate epimerase;       
    1::275     4e-72  52%  275 aa  DAPF_PSYIN RecName: Full=Diaminopimelate epimerase;       
    1::288     4e-72  58%  292 aa  DAPF_DIAST RecName: Full=Diaminopimelate epimerase;       
    1::274     5e-72  53%  276 aa  DAPF_VIBVY RecName: Full=Diaminopimelate epimerase;       
    1::274     5e-72  53%  276 aa  DAPF_VIBVU RecName: Full=Diaminopimelate epimerase;       
    3::274     5e-72  53%  274 aa  DAPF_PASMU RecName: Full=Diaminopimelate epimerase;       
    1::278     1e-71  54%  278 aa  DAPF_LARHH RecName: Full=Diaminopimelate epimerase;       
    1::283     1e-71  55%  288 aa  DAPF_RALME RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-71  52%  274 aa  DAPF_PHOLL RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-71  49%  276 aa  DAPF_COLP3 RecName: Full=Diaminopimelate epimerase;       
    1::272     3e-71  47%  276 aa  DAPF_COXBU RecName: Full=Diaminopimelate epimerase;       
    1::272     3e-71  47%  276 aa  DAPF_COXBR RecName: Full=Diaminopimelate epimerase;       
    1::272     3e-71  47%  276 aa  DAPF_COXBN RecName: Full=Diaminopimelate epimerase;       
    1::272     3e-71  47%  276 aa  DAPF_COXB2 RecName: Full=Diaminopimelate epimerase;       
    1::272     3e-71  47%  276 aa  DAPF_COXB1 RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ESCF3 RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECOSM RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECOLU RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECOLI RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECOLC RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECOL5 RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECOHS RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECODH RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECOBW RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECO8A RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECO7I RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECO5E RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECO57 RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECO55 RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECO45 RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-71  52%  274 aa  DAPF_ECO24 RecName: Full=Diaminopimelate epimerase;       
    3::274     4e-71  51%  274 aa  DAPF_SODGM RecName: Full=Diaminopimelate epimerase;       
    3::274     4e-71  52%  274 aa  DAPF_SHIF8 RecName: Full=Diaminopimelate epimerase;       
    3::274     4e-71  52%  274 aa  DAPF_ECOL6 RecName: Full=Diaminopimelate epimerase;       
    1::274     7e-71  53%  276 aa  DAPF_VIBCH RecName: Full=Diaminopimelate epimerase;       
    1::274     7e-71  53%  276 aa  DAPF_VIBC3 RecName: Full=Diaminopimelate epimerase;       
    3::273     7e-71  52%  274 aa  DAPF_HAEPS RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-70  52%  274 aa  DAPF_SERP5 RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-70  52%  274 aa  DAPF_PECCP RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-70  51%  274 aa  DAPF_ENT38 RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-70  51%  274 aa  DAPF_ECO27 RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-70  51%  274 aa  DAPF_SHIB3 RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-70  51%  274 aa  DAPF_ECO81 RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-70  52%  274 aa  DAPF_ACTP7 RecName: Full=Diaminopimelate epimerase;       
    1::283     3e-70  53%  292 aa  DAPF_RALSO RecName: Full=Diaminopimelate epimerase;       
    1::283     4e-70  54%  288 aa  DAPF_RALEJ RecName: Full=Diaminopimelate epimerase;       
    1::283     4e-70  54%  288 aa  DAPF_RALEH RecName: Full=Diaminopimelate epimerase;       
    3::274     4e-70  52%  274 aa  DAPF_ACTP2 RecName: Full=Diaminopimelate epimerase;       
    1::288     4e-70  56%  292 aa  DAPF_ACIAC RecName: Full=Diaminopimelate epimerase;       
    3::274     5e-70  53%  274 aa  DAPF_HAEIN RecName: Full=Diaminopimelate epimerase;       
    3::274     5e-70  53%  274 aa  DAPF_HAEI8 RecName: Full=Diaminopimelate epimerase;       
    3::274     5e-70  52%  274 aa  DAPF_ERWCT RecName: Full=Diaminopimelate epimerase;       
    1::276     6e-70  51%  276 aa  DAPF_PHOPR RecName: Full=Diaminopimelate epimerase;       
    1::276     8e-70  52%  276 aa  DAPF_PSEA6 RecName: Full=Diaminopimelate epimerase;       
    1::285     1e-69  55%  287 aa  DAPF_BURXL RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERPY RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERPS RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERPP RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERPN RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERPG RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERPE RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERPB RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERPA RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-69  51%  274 aa  DAPF_YERP3 RecName: Full=Diaminopimelate epimerase;       
    1::274     2e-69  51%  276 aa  DAPF_VIBPA RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-69  52%  274 aa  DAPF_HAEIE RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-69  51%  274 aa  DAPF_ACTPJ RecName: Full=Diaminopimelate epimerase;       
    1::291     4e-69  55%  297 aa  DAPF_LEPCP RecName: Full=Diaminopimelate epimerase;       
    3::274     4e-69  53%  274 aa  DAPF_HAEIG RecName: Full=Diaminopimelate epimerase;       
    3::274     5e-69  51%  274 aa  DAPF_HAES1 RecName: Full=Diaminopimelate epimerase;       
    3::274     7e-69  51%  274 aa  DAPF_YERE8 RecName: Full=Diaminopimelate epimerase;       
    1::276     9e-69  51%  276 aa  DAPF_VIBF1 RecName: Full=Diaminopimelate epimerase;       
    1::275     9e-69  52%  275 aa  DAPF_IDILO RecName: Full=Diaminopimelate epimerase;       
    1::274     1e-68  51%  276 aa  DAPF_VIBHB RecName: Full=Diaminopimelate epimerase;       
    1::287     3e-68  55%  291 aa  DAPF_RHOFD RecName: Full=Diaminopimelate epimerase;       
    1::276     3e-68  50%  276 aa  DAPF_ALISL RecName: Full=Diaminopimelate epimerase;       
    1::279     3e-68  54%  292 aa  DAPF_RALPJ RecName: Full=Diaminopimelate epimerase;       
    1::276     4e-68  50%  295 aa  DAPF_PSYCK RecName: Full=Diaminopimelate epimerase;       
    1::276     6e-68  50%  295 aa  DAPF_PSYA2 RecName: Full=Diaminopimelate epimerase;       
    1::285     8e-68  54%  299 aa  DAPF_BURPP RecName: Full=Diaminopimelate epimerase;       
    1::283     1e-67  47%  283 aa  DAPF_HERAR RecName: Full=Diaminopimelate epimerase;       
    3::274     1e-67  51%  274 aa  DAPF_HAES2 RecName: Full=Diaminopimelate epimerase;       
    1::276     2e-67  52%  293 aa  DAPF_PSYWF RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-67  52%  274 aa  DAPF_EDWI9 RecName: Full=Diaminopimelate epimerase;       
    1::275     1e-66  51%  277 aa  DAPF_LEGPC RecName: Full=Diaminopimelate epimerase;       
    1::275     1e-66  51%  277 aa  DAPF_LEGPA RecName: Full=Diaminopimelate epimerase;       
    1::275     1e-66  50%  277 aa  DAPF_LEGPH RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-66  51%  274 aa  DAPF_HAEDU RecName: Full=Diaminopimelate epimerase;       
    1::274     2e-66  51%  276 aa  DAPF_VIBSL RecName: Full=Diaminopimelate epimerase;       
    1::275     3e-66  50%  277 aa  DAPF_LEGPL RecName: Full=Diaminopimelate epimerase;       
    1::287     3e-66  56%  289 aa  DAPF_BURCM RecName: Full=Diaminopimelate epimerase;       
    1::287     6e-66  54%  289 aa  DAPF_BURVG RecName: Full=Diaminopimelate epimerase;       
    3::274     9e-66  48%  274 aa  DAPF_PROMH RecName: Full=Diaminopimelate epimerase;       
    1::287     4e-64  54%  289 aa  DAPF_BURTA RecName: Full=Diaminopimelate epimerase;       
    3::272     5e-64  46%  274 aa  DAPF_BAUCH RecName: Full=Diaminopimelate epimerase;       
    1::287     1e-62  54%  289 aa  DAPF_BURPS RecName: Full=Diaminopimelate epimerase;       
    1::287     1e-62  54%  289 aa  DAPF_BURP0 RecName: Full=Diaminopimelate epimerase;       
    1::287     1e-62  54%  289 aa  DAPF_BURMS RecName: Full=Diaminopimelate epimerase;       
    1::287     1e-62  54%  289 aa  DAPF_BURMA RecName: Full=Diaminopimelate epimerase;       
    1::287     1e-62  54%  289 aa  DAPF_BURM9 RecName: Full=Diaminopimelate epimerase;       
    1::287     1e-62  54%  289 aa  DAPF_BURM7 RecName: Full=Diaminopimelate epimerase;       
    1::287     2e-62  53%  289 aa  DAPF_BURP6 RecName: Full=Diaminopimelate epimerase;       
    4::280     6e-62  51%  283 aa  DAPF_NEIMB RecName: Full=Diaminopimelate epimerase;       
    4::280     6e-62  52%  283 aa  DAPF_NEIMA RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-61  47%  274 aa  DAPF_BLOPB RecName: Full=Diaminopimelate epimerase;       
    1::271     9e-59  43%  271 aa  DAPF_VESOH RecName: Full=Diaminopimelate epimerase;       
    1::271     6e-58  44%  271 aa  DAPF_RUTMC RecName: Full=Diaminopimelate epimerase;       
    9::280     3e-57  49%  284 aa  DAPF_XANCP RecName: Full=Diaminopimelate epimerase;       
    9::280     3e-57  49%  284 aa  DAPF_XANCB RecName: Full=Diaminopimelate epimerase;       
    9::280     3e-57  49%  284 aa  DAPF_XANC8 RecName: Full=Diaminopimelate epimerase;       
    3::276     1e-55  46%  276 aa  DAPF_BLOFL RecName: Full=Diaminopimelate epimerase;       
    1::279     3e-55  40%  284 aa  DAPF_HALOH RecName: Full=Diaminopimelate epimerase;       
    4::282     6e-54  47%  285 aa  DAPF_SYNJA RecName: Full=Diaminopimelate epimerase;       
    1::280     1e-52  40%  280 aa  DAPF_LEPBA RecName: Full=Diaminopimelate epimerase;       
    1::281     1e-52  41%  283 aa  DAPF_ACAM1 RecName: Full=Diaminopimelate epimerase;       
    4::282     2e-52  47%  285 aa  DAPF_SYNJB RecName: Full=Diaminopimelate epimerase;       
    3::270     3e-52  48%  274 aa  DAPF_CARHZ RecName: Full=Diaminopimelate epimerase;       
    9::280     3e-52  45%  284 aa  DAPF_XANAC RecName: Full=Diaminopimelate epimerase;       
   11::282     3e-52  42%  284 aa  DAPF_BUCAP RecName: Full=Diaminopimelate epimerase;       
    1::278     8e-52  41%  280 aa  DAPF_CYAP4 RecName: Full=Diaminopimelate epimerase;       
    1::279     8e-52  41%  279 aa  DAPF2_ANASP RecName: Full=Diaminopimelate epimerase 2;       
    9::280     1e-51  44%  284 aa  DAPF_XANC5 RecName: Full=Diaminopimelate epimerase;       
    3::281     5e-51  43%  281 aa  DAPF_HELMI RecName: Full=Diaminopimelate epimerase;       
    3::277     1e-50  38%  280 aa  DAPF_CLOTH RecName: Full=Diaminopimelate epimerase;       
    1::277     2e-50  46%  278 aa  DAPF_TRIEI RecName: Full=Diaminopimelate epimerase;       
    4::281     3e-50  38%  281 aa  DAPF_LEPBL RecName: Full=Diaminopimelate epimerase;       
    4::281     3e-50  38%  281 aa  DAPF_LEPBJ RecName: Full=Diaminopimelate epimerase;       
    1::279     4e-50  41%  279 aa  DAPF_NOSP7 RecName: Full=Diaminopimelate epimerase;       
   12::280     7e-50  44%  284 aa  DAPF_XYLFM RecName: Full=Diaminopimelate epimerase;       
    4::281     1e-49  39%  281 aa  DAPF_LEPIC RecName: Full=Diaminopimelate epimerase;       
    9::280     2e-49  44%  284 aa  DAPF_XANOM RecName: Full=Diaminopimelate epimerase;       
    1::278     2e-49  46%  280 aa  DAPF_SYNP6 RecName: Full=Diaminopimelate epimerase;       
    1::278     2e-49  46%  280 aa  DAPF_SYNE7 RecName: Full=Diaminopimelate epimerase;       
    1::277     4e-49  44%  281 aa  DAPF_MICAN RecName: Full=Diaminopimelate epimerase;       
    5::275     5e-49  42%  283 aa  DAPF_DESHD RecName: Full=Diaminopimelate epimerase;       
    5::270     6e-49  41%  291 aa  DAPF_RHOCS RecName: Full=Diaminopimelate epimerase;       
   72::351     6e-49  45%  354 aa  DAPF_ORYSJ RecName: Full=Putative diaminopimelate epimerase,
   75::354     1e-48  45%  357 aa  DAPF_ORYSI RecName: Full=Putative diaminopimelate epimerase,
    5::271     1e-48  47%  278 aa  DAPF_MAGSM RecName: Full=Diaminopimelate epimerase;       
    4::281     1e-48  39%  281 aa  DAPF_LEPIN RecName: Full=Diaminopimelate epimerase;       
   12::280     2e-48  43%  284 aa  DAPF_XYLFA RecName: Full=Diaminopimelate epimerase;       
   12::280     3e-48  43%  284 aa  DAPF_XYLFT RecName: Full=Diaminopimelate epimerase;       
   12::280     3e-48  43%  284 aa  DAPF_XYLF2 RecName: Full=Diaminopimelate epimerase;       
    1::281     3e-48  39%  281 aa  DAPF_CYAP8 RecName: Full=Diaminopimelate epimerase;       
   10::282     5e-48  41%  284 aa  DAPF_BUCAI RecName: Full=Diaminopimelate epimerase;       
    1::279     9e-48  40%  279 aa  DAPF_SYNY3 RecName: Full=Diaminopimelate epimerase;       
    5::283     9e-48  43%  287 aa  DAPF_DESDA RecName: Full=Diaminopimelate epimerase;       
   10::282     9e-48  41%  284 aa  DAPF_BUCA5 RecName: Full=Diaminopimelate epimerase;       
    1::281     1e-47  39%  281 aa  DAPF_SYNP2 RecName: Full=Diaminopimelate epimerase;       
    1::270     1e-47  46%  275 aa  DAPF_GRABC RecName: Full=Diaminopimelate epimerase;       
   10::282     1e-47  41%  284 aa  DAPF_BUCAT RecName: Full=Diaminopimelate epimerase;       
   80::359     2e-47  44%  362 aa  DAPF_ARATH RecName: Full=Diaminopimelate epimerase, chloroplastic; 
    1::285     3e-47  40%  286 aa  DAPF_THEEB RecName: Full=Diaminopimelate epimerase;       
    1::255     3e-47  44%  257 aa  DAPF_GLUOX RecName: Full=Diaminopimelate epimerase;       
    1::281     3e-47  39%  281 aa  DAPF_CYAP7 RecName: Full=Diaminopimelate epimerase;       
    2::280     3e-46  40%  286 aa  DAPF_METTH RecName: Full=Diaminopimelate epimerase;       
    1::265     4e-46  44%  274 aa  DAPF_SPHWW RecName: Full=Diaminopimelate epimerase;       
    3::277     5e-46  35%  277 aa  DAPF_METM6 RecName: Full=Diaminopimelate epimerase;       
    3::277     8e-46  34%  277 aa  DAPF_METMP RecName: Full=Diaminopimelate epimerase;       
    3::277     1e-45  35%  277 aa  DAPF_METM7 RecName: Full=Diaminopimelate epimerase;       
    3::274     2e-45  45%  280 aa  DAPF_PELTS RecName: Full=Diaminopimelate epimerase;       
    5::280     5e-45  43%  280 aa  DAPF_BACV8 RecName: Full=Diaminopimelate epimerase;       
    9::276     1e-44  40%  277 aa  DAPF_PHEZH RecName: Full=Diaminopimelate epimerase;       
    3::277     2e-44  33%  277 aa  DAPF_METM5 RecName: Full=Diaminopimelate epimerase;       
    5::263     2e-44  45%  268 aa  DAPF_SPHAL RecName: Full=Diaminopimelate epimerase;       
    3::273     2e-44  43%  278 aa  DAPF_DESAP RecName: Full=Diaminopimelate epimerase;       
    1::264     2e-43  45%  269 aa  DAPF_ERYLH RecName: Full=Diaminopimelate epimerase;       
    5::282     3e-43  39%  303 aa  DAPF_PROMM RecName: Full=Diaminopimelate epimerase;       
    3::270     5e-43  36%  274 aa  DAPF_ELUMP RecName: Full=Diaminopimelate epimerase;       
    5::267     5e-43  45%  269 aa  DAPF_BACFR RecName: Full=Diaminopimelate epimerase;       
    1::283     9e-43  38%  283 aa  DAPF_DESAH RecName: Full=Diaminopimelate epimerase;       
    1::279     1e-42  41%  286 aa  DAPF_OCEIH RecName: Full=Diaminopimelate epimerase;       
   17::282     3e-42  36%  286 aa  DAPF_BUCBP RecName: Full=Diaminopimelate epimerase;       
    1::284     4e-42  33%  284 aa  DAPF_PROM1 RecName: Full=Diaminopimelate epimerase;       
    3::274     4e-42  41%  284 aa  DAPF_DESRM RecName: Full=Diaminopimelate epimerase;       
    3::278     6e-42  44%  279 aa  DAPF_MOOTA RecName: Full=Diaminopimelate epimerase;       
    6::280     6e-42  44%  290 aa  DAPF_GEOTN RecName: Full=Diaminopimelate epimerase;       
    1::284     7e-42  33%  284 aa  DAPF_PROMT RecName: Full=Diaminopimelate epimerase;       
    3::283     1e-41  35%  288 aa  DAPF_BACCN RecName: Full=Diaminopimelate epimerase;       
    3::284     2e-41  37%  285 aa  DAPF_EUBR3 RecName: Full=Diaminopimelate epimerase;       
    1::264     3e-41  36%  269 aa  DAPF_ZYMMO RecName: Full=Diaminopimelate epimerase;       
    9::280     8e-41  41%  293 aa  DAPF_RHOPT RecName: Full=Diaminopimelate epimerase;       
    1::283     1e-40  44%  289 aa  DAPF_CAUSK RecName: Full=Diaminopimelate epimerase;       
    3::283     1e-40  41%  288 aa  DAPF_BACCR RecName: Full=Diaminopimelate epimerase;       
    3::283     2e-40  41%  288 aa  DAPF_BACC1 RecName: Full=Diaminopimelate epimerase;       
    3::283     2e-40  41%  288 aa  DAPF_BACC4 RecName: Full=Diaminopimelate epimerase;       
    1::275     3e-40  36%  283 aa  DAPF_ALKMQ RecName: Full=Diaminopimelate epimerase;       
    9::280     4e-40  40%  293 aa  DAPF_RHOPS RecName: Full=Diaminopimelate epimerase;       
    5::269     5e-40  40%  269 aa  DAPF_PARD8 RecName: Full=Diaminopimelate epimerase;       
    3::283     5e-40  41%  288 aa  DAPF_BACCZ RecName: Full=Diaminopimelate epimerase;       
    3::283     5e-40  41%  288 aa  DAPF_BACC2 RecName: Full=Diaminopimelate epimerase;       
    3::283     5e-40  41%  288 aa  DAPF_BACAN RecName: Full=Diaminopimelate epimerase;       
    3::283     5e-40  41%  288 aa  DAPF_BACAC RecName: Full=Diaminopimelate epimerase;       
    3::283     5e-40  41%  288 aa  DAPF_BACAA RecName: Full=Diaminopimelate epimerase;       
    3::283     1e-39  41%  288 aa  DAPF_BACWK RecName: Full=Diaminopimelate epimerase;       
    3::283     1e-39  41%  288 aa  DAPF_BACHK RecName: Full=Diaminopimelate epimerase;       
    3::283     1e-39  41%  288 aa  DAPF_BACC7 RecName: Full=Diaminopimelate epimerase;       
    3::283     1e-39  41%  288 aa  DAPF_BACC3 RecName: Full=Diaminopimelate epimerase;       
    3::283     2e-39  41%  288 aa  DAPF_BACC0 RecName: Full=Diaminopimelate epimerase;       
    3::274     3e-39  40%  274 aa  DAPF_THETN RecName: Full=Diaminopimelate epimerase;       
    1::282     1e-38  38%  288 aa  DAPF_CAUCR RecName: Full=Diaminopimelate epimerase;       
    1::282     1e-38  38%  288 aa  DAPF_CAUCN RecName: Full=Diaminopimelate epimerase;       
    3::283     1e-38  40%  288 aa  DAPF_BACAH RecName: Full=Diaminopimelate epimerase;       
    9::280     1e-38  40%  293 aa  DAPF_RHOPA RecName: Full=Diaminopimelate epimerase;       
    9::280     1e-38  40%  293 aa  DAPF_RHOP2 RecName: Full=Diaminopimelate epimerase;       
    8::283     3e-38  37%  291 aa  DAPF_BRAJA RecName: Full=Diaminopimelate epimerase;       
    6::284     3e-38  42%  284 aa  DAPF_BACP2 RecName: Full=Diaminopimelate epimerase;       
    6::280     3e-38  40%  284 aa  DAPF_BACA2 RecName: Full=Diaminopimelate epimerase;       
    3::280     5e-38  40%  284 aa  DAPF_GEOSW RecName: Full=Diaminopimelate epimerase;       
    3::279     6e-38  39%  286 aa  DAPF_BACHD RecName: Full=Diaminopimelate epimerase;       
    6::280     4e-37  39%  284 aa  DAPF_BACSU RecName: Full=Diaminopimelate epimerase;       
    7::268     7e-37  40%  276 aa  DAPF_RHOS4 RecName: Full=Diaminopimelate epimerase;       
    8::279     9e-37  36%  288 aa  DAPF_RHOPB RecName: Full=Diaminopimelate epimerase;       
    6::280     9e-37  38%  285 aa  DAPF_BACLD RecName: Full=Diaminopimelate epimerase;       
    5::280     1e-36  42%  290 aa  DAPF_GEOKA RecName: Full=Diaminopimelate epimerase;       
    9::257     2e-36  39%  262 aa  DAPF_WOLWR RecName: Full=Diaminopimelate epimerase;       
    3::273     3e-36  32%  275 aa  DAPF_AZOPC RecName: Full=Diaminopimelate epimerase;       
    1::273     8e-36  39%  280 aa  DAPF_ARCFU RecName: Full=Diaminopimelate epimerase;       
    4::266     1e-35  40%  267 aa  DAPF_BACTN RecName: Full=Diaminopimelate epimerase;       
    7::271     1e-35  35%  277 aa  DAPF_ACICJ RecName: Full=Diaminopimelate epimerase;       
    8::254     3e-35  37%  259 aa  DAPF_WOLTR RecName: Full=Diaminopimelate epimerase;       
    3::255     4e-35  39%  285 aa  DAPF1_ANASP RecName: Full=Diaminopimelate epimerase 1;       
    3::290     1e-34  40%  295 aa  DAPF_METJA RecName: Full=Diaminopimelate epimerase;       
    8::282     3e-34  35%  290 aa  DAPF_NITHX RecName: Full=Diaminopimelate epimerase;       
    8::280     4e-34  37%  288 aa  DAPF_RHOP5 RecName: Full=Diaminopimelate epimerase;       
    8::281     6e-34  39%  289 aa  DAPF_BRASB RecName: Full=Diaminopimelate epimerase;       
   10::283     6e-34  35%  297 aa  DAPF_BEII9 RecName: Full=Diaminopimelate epimerase;       
    4::279     9e-34  38%  303 aa  DAPF_BRUME RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-33  38%  303 aa  DAPF_BRUSU RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-33  38%  303 aa  DAPF_BRUSI RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-33  38%  303 aa  DAPF_BRUO2 RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-33  38%  303 aa  DAPF_BRUMB RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-33  38%  303 aa  DAPF_BRUC2 RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-33  38%  303 aa  DAPF_BRUAB RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-33  38%  303 aa  DAPF_BRUA2 RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-33  38%  303 aa  DAPF_BRUA1 RecName: Full=Diaminopimelate epimerase;       
    1::269     4e-33  36%  283 aa  DAPF_BARQU RecName: Full=Diaminopimelate epimerase;       
    8::281     5e-33  38%  289 aa  DAPF_BRASO RecName: Full=Diaminopimelate epimerase;       
    3::275     1e-32  36%  280 aa  DAPF_UNCMA RecName: Full=Diaminopimelate epimerase;       
    1::268     1e-32  39%  282 aa  DAPF_BARBK RecName: Full=Diaminopimelate epimerase;       
    9::285     1e-32  39%  296 aa  DAPF_METC4 RecName: Full=Diaminopimelate epimerase;       
    8::279     2e-32  36%  290 aa  DAPF_OLICO RecName: Full=Diaminopimelate epimerase;       
    3::269     3e-32  34%  272 aa  DAPF_CLOPE RecName: Full=Diaminopimelate epimerase;       
    9::285     4e-32  39%  296 aa  DAPF_METEP RecName: Full=Diaminopimelate epimerase;       
    1::292     5e-32  41%  295 aa  DAPF_META3 RecName: Full=Diaminopimelate epimerase;       
    9::282     7e-32  39%  293 aa  DAPF_METS4 RecName: Full=Diaminopimelate epimerase;       
    5::284     1e-31  37%  301 aa  DAPF_RHILW RecName: Full=Diaminopimelate epimerase;       
    5::284     3e-31  36%  301 aa  DAPF_AGRRK RecName: Full=Diaminopimelate epimerase;       
    9::284     4e-31  40%  293 aa  DAPF_METNO RecName: Full=Diaminopimelate epimerase;       
    1::279     1e-30  32%  279 aa  DAPF_BRAHW RecName: Full=Diaminopimelate epimerase;       
    1::269     1e-30  39%  283 aa  DAPF_BARHE RecName: Full=Diaminopimelate epimerase;       
    4::279     2e-30  36%  300 aa  DAPF_OCHA4 RecName: Full=Diaminopimelate epimerase;       
   11::281     2e-30  36%  290 aa  DAPF_METSB RecName: Full=Diaminopimelate epimerase;       
    1::269     2e-30  35%  283 aa  DAPF_BART1 RecName: Full=Diaminopimelate epimerase;       
    3::270     2e-30  36%  279 aa  DAPF_METTP RecName: Full=Diaminopimelate epimerase;       
    1::215     2e-30  36%  280 aa  DAPF_ALKOO RecName: Full=Diaminopimelate epimerase;       
    5::283     3e-30  38%  299 aa  DAPF_AGRT5 RecName: Full=Diaminopimelate epimerase;       
    9::286     4e-30  39%  296 aa  DAPF_METPB RecName: Full=Diaminopimelate epimerase;       
    5::284     8e-30  36%  301 aa  DAPF_RHIEC RecName: Full=Diaminopimelate epimerase;       
    7::280     4e-29  35%  294 aa  DAPF_RHILO RecName: Full=Diaminopimelate epimerase;       
    1::210     7e-29  33%  274 aa  DAPF_PELUB RecName: Full=Diaminopimelate epimerase;       
    7::279     7e-29  39%  293 aa  DAPF_MESSB RecName: Full=Diaminopimelate epimerase;       
    3::293     5e-28  34%  299 aa  DAPF_NATTJ RecName: Full=Diaminopimelate epimerase;       
    4::280     2e-26  35%  301 aa  DAPF_RHIME RecName: Full=Diaminopimelate epimerase;       
    3::270     4e-25  37%  274 aa  DAPF_THEFY RecName: Full=Diaminopimelate epimerase;       
    3::272     7e-24  35%  279 aa  DAPF_AQUAE RecName: Full=Diaminopimelate epimerase;       
    6::291     2e-22  36%  292 aa  DAPF_LEIXX RecName: Full=Diaminopimelate epimerase;       
    3::277     5e-21  34%  277 aa  DAPF_CORGL RecName: Full=Diaminopimelate epimerase;       
    4::291     3e-20  34%  292 aa  DAPF_CLAM3 RecName: Full=Diaminopimelate epimerase;       
    4::216     3e-20  32%  303 aa  DAPF_AGRVS RecName: Full=Diaminopimelate epimerase;       
    3::277     3e-20  34%  277 aa  DAPF_CORGB RecName: Full=Diaminopimelate epimerase;       
    3::283     5e-20  32%  295 aa  DAPF_MYCA9 RecName: Full=Diaminopimelate epimerase;       
    3::280     1e-19  33%  290 aa  DAPF_MYCMM RecName: Full=Diaminopimelate epimerase;       
    3::280     2e-19  33%  290 aa  DAPF_MYCUA RecName: Full=Diaminopimelate epimerase;       
    4::264     3e-19  36%  269 aa  DAPF_RICBR RecName: Full=Diaminopimelate epimerase;       
    4::264     3e-19  36%  269 aa  DAPF_RICB8 RecName: Full=Diaminopimelate epimerase;       
    4::272     3e-19  31%  277 aa  DAPF_HYDS0 RecName: Full=Diaminopimelate epimerase;       
    4::264     4e-19  35%  270 aa  DAPF_RICPU RecName: Full=Diaminopimelate epimerase;       
    4::264     4e-19  35%  270 aa  DAPF_RICCN RecName: Full=Diaminopimelate epimerase;       
    4::264     5e-19  35%  270 aa  DAPF_RICAE RecName: Full=Diaminopimelate epimerase;       
    4::291     7e-19  34%  292 aa  DAPF_CLAMS RecName: Full=Diaminopimelate epimerase;       
    4::264     9e-19  35%  270 aa  DAPF_RICRS RecName: Full=Diaminopimelate epimerase;       
    4::264     9e-19  35%  270 aa  DAPF_RICRO RecName: Full=Diaminopimelate epimerase;       
    3::281     9e-19  34%  289 aa  DAPF_RHOSR RecName: Full=Diaminopimelate epimerase;       
    4::264     1e-18  35%  270 aa  DAPF_RICFE RecName: Full=Diaminopimelate epimerase;       
    3::281     2e-18  34%  289 aa  DAPF_RHOOB RecName: Full=Diaminopimelate epimerase;       
    1::257     2e-18  30%  257 aa  DAPF_CHLTE RecName: Full=Diaminopimelate epimerase;       
    4::205     3e-18  35%  270 aa  DAPF_RICAH RecName: Full=Diaminopimelate epimerase;       
    4::280     3e-18  34%  289 aa  DAPF_STRCO RecName: Full=Diaminopimelate epimerase;       
    4::264     4e-18  34%  270 aa  DAPF_RICPR RecName: Full=Diaminopimelate epimerase;       
    4::264     6e-18  34%  269 aa  DAPF_RICCK RecName: Full=Diaminopimelate epimerase;       
    3::214     6e-18  36%  278 aa  DAPF_CORA7 RecName: Full=Diaminopimelate epimerase;       
   12::299     6e-18  28%  333 aa  DAPF_CLOAB RecName: Full=Diaminopimelate epimerase;       
    3::274     7e-18  25%  276 aa  DAPF_WIGBR RecName: Full=Diaminopimelate epimerase;       
    4::264     7e-18  34%  270 aa  DAPF_RICM5 RecName: Full=Diaminopimelate epimerase;       
    3::222     7e-18  32%  296 aa  DAPF_MYCLE RecName: Full=Diaminopimelate epimerase;       
    3::222     7e-18  32%  296 aa  DAPF_MYCLB RecName: Full=Diaminopimelate epimerase;       
    4::264     3e-17  33%  270 aa  DAPF_RICTY RecName: Full=Diaminopimelate epimerase;       
    4::293     4e-17  31%  329 aa  DAPF_LISMF RecName: Full=Diaminopimelate epimerase;       
    4::293     5e-17  31%  329 aa  DAPF_LISMC RecName: Full=Diaminopimelate epimerase;       
    1::199     3e-16  30%  277 aa  DAPF_GEMAT RecName: Full=Diaminopimelate epimerase;       
    3::222     4e-16  31%  294 aa  DAPF_MYCPA RecName: Full=Diaminopimelate epimerase;       
    4::293     5e-16  30%  329 aa  DAPF_LISMH RecName: Full=Diaminopimelate epimerase;       
    4::293     1e-15  29%  328 aa  DAPF_LISW6 RecName: Full=Diaminopimelate epimerase;       
   17::198     2e-15  35%  257 aa  DAPF_CHLPN RecName: Full=Diaminopimelate epimerase;       
    3::221     2e-15  36%  293 aa  DAPF_MYCSK RecName: Full=Diaminopimelate epimerase;       
    3::221     2e-15  36%  293 aa  DAPF_MYCSJ RecName: Full=Diaminopimelate epimerase;       
    3::248     2e-15  34%  279 aa  DAPF_METKA RecName: Full=Diaminopimelate epimerase;       
    3::222     3e-15  31%  294 aa  DAPF_MYCA1 RecName: Full=Diaminopimelate epimerase;       
    4::295     4e-15  35%  303 aa  DAPF_ACIC1 RecName: Full=Diaminopimelate epimerase;       
    5::283     6e-15  30%  283 aa  DAPF_COREF RecName: Full=Diaminopimelate epimerase;       
    3::219     1e-14  34%  291 aa  DAPF_MYCS2 RecName: Full=Diaminopimelate epimerase;       
    5::256     1e-14  27%  256 aa  DAPF_FLAPJ RecName: Full=Diaminopimelate epimerase;       
    1::228     3e-14  29%  332 aa  DAPF_LACPL RecName: Full=Diaminopimelate epimerase;       
    4::293     4e-14  29%  329 aa  DAPF_LISMO RecName: Full=Diaminopimelate epimerase;       
    3::218     5e-14  33%  289 aa  DAPF_MYCTU RecName: Full=Diaminopimelate epimerase;       
    3::218     5e-14  33%  289 aa  DAPF_MYCTA RecName: Full=Diaminopimelate epimerase;       
    3::218     5e-14  33%  289 aa  DAPF_MYCBT RecName: Full=Diaminopimelate epimerase;       
    3::218     5e-14  33%  289 aa  DAPF_MYCBP RecName: Full=Diaminopimelate epimerase;       
    3::218     5e-14  33%  289 aa  DAPF_MYCBO RecName: Full=Diaminopimelate epimerase;       
    4::293     6e-14  29%  329 aa  DAPF_LISIN RecName: Full=Diaminopimelate epimerase;       
    5::106     5e-13  36%  250 aa  DAPF_NITSB RecName: Full=Diaminopimelate epimerase;       
    5::222     9e-13  32%  325 aa  DAPF_LACS1 RecName: Full=Diaminopimelate epimerase;       
   61::198     2e-12  33%  275 aa  DAPF_CHLTR RecName: Full=Diaminopimelate epimerase;       
   61::198     2e-12  33%  275 aa  DAPF_CHLTB RecName: Full=Diaminopimelate epimerase;       
   61::198     2e-12  33%  275 aa  DAPF_CHLTA RecName: Full=Diaminopimelate epimerase;       
   61::198     2e-12  33%  275 aa  DAPF_CHLT2 RecName: Full=Diaminopimelate epimerase;       
    3::280     2e-12  29%  289 aa  DAPF_MYCVP RecName: Full=Diaminopimelate epimerase;       
    3::183     5e-12  31%  249 aa  DAPF_CAMJ8 RecName: Full=Diaminopimelate epimerase;       
    3::183     8e-12  29%  249 aa  DAPF_CAMJD RecName: Full=Diaminopimelate epimerase;       
    3::183     1e-11  31%  249 aa  DAPF_CAMJE RecName: Full=Diaminopimelate epimerase;       
    3::183     1e-11  31%  249 aa  DAPF_CAMJJ RecName: Full=Diaminopimelate epimerase;       
    3::183     3e-11  31%  249 aa  DAPF_CAMJR RecName: Full=Diaminopimelate epimerase;       
    3::280     1e-09  29%  289 aa  DAPF_MYCGI RecName: Full=Diaminopimelate epimerase;       
    1::89      1e-09  33%  273 aa  DAPF_HELPY RecName: Full=Diaminopimelate epimerase;       
    1::89      1e-09  33%  273 aa  DAPF_HELPS RecName: Full=Diaminopimelate epimerase;       
   81::221     3e-09  35%  292 aa  DAPF_RHOE4 RecName: Full=Diaminopimelate epimerase;       
    1::224     5e-09  26%  326 aa  DAPF_ENTFA RecName: Full=Diaminopimelate epimerase;       
    1::88      8e-09  32%  273 aa  DAPF_HELPH RecName: Full=Diaminopimelate epimerase;       
    1::88      2e-08  32%  272 aa  DAPF_HELP2 RecName: Full=Diaminopimelate epimerase;       
    1::88      2e-08  32%  273 aa  DAPF_HELPJ RecName: Full=Diaminopimelate epimerase;       
    1::88      2e-08  32%  272 aa  DAPF_HELPG RecName: Full=Diaminopimelate epimerase;       
   44::198     3e-08  29%  269 aa  DAPF_CHLMU RecName: Full=Diaminopimelate epimerase;       
    3::183     1e-07  29%  249 aa  DAPF_CAMLR RecName: Full=Diaminopimelate epimerase;       
    1::276

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGG
DAPF_NITOC      MRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGG
DAPF_THISH      MRIQFSKMHGLGNDFVVIDAIHQPVDLSPDQVRLLAHRRFGVGCDQVLLVERPSDPAADFRYRIFNADGN
DAPF_ALHEH      MKVRFTKMQGLGNDFVVIDAVRQPVEPSPEQIRHIADRRYGVGCDQVLLATPARRSQADFGYLIFNPDGS
DAPF_CELJU      MRIRFSKMHGLGNDFVVIDGISQTVRLTPEKIRKLADRHFGVGCDQVLLVEIPEQPNVDFRYRIFNCDGS
DAPF_NITMU      MKLKFTKMHGLGNDFIVIDAVNQQISLSPEQLRRLADRHLGVGCDQILLIEKAEGDA-DFRYRIFNADGG
DAPF_PSEAE      MLLRFTKMHGLGNDFMVLDLVSQHAHVQPKHVKLWGDRNTGIGFDQLLIVEAPSSPDVDFRYRIFNADGS
DAPF_PSEA8      MLLRFTKMHGLGNDFMVLDLVSQHAHVQPKHVKLWGDRNTGIGFDQLLIVEAPSSPDVDFRYRIFNADGS
DAPF_PSEAB      MLLRFTKMHGLGNDFMVLDLVSQHAHVQPKHVKLWGDRNTGVGFDQLLIVEAPSSPDVDFRYRIFNADGS
DAPF_PSEA7      MLLRFTKMHGLGNDFMVLDLVSQHAHVQPKHVKLWGDRNTGVGFDQLLIVEAPSSPDVDFRYRIFNADGS
DAPF_PSEU5      MLLRFTKMHGLGNDFMVIDLVSQHAHIQPKHAKQWGDRHTGVGFDQLLIVEPPQNPDVDFRYRIFNSDGS
DAPF_PSEMY      MLLRFTKMHGLGNDFMVLDLISQHAHVQPKHAKQWGDRHTGVGFDQLLIVEPPSHPDVDFRYRIFNSDGS
DAPF_DECAR      MKLKFSKMHGLGNDFVVLDGVRQSVSLSPEQLCYLADRHFGVGCDQILLVEKASQPGIDFRYRIFNADGG
DAPF_AZOVD      MLLRFTKMHGLGNDFMVIDLVTQHAHIQPKHAKQWGDRHTGIGFDQLLIVEPPSRPDVDFRYRIFNADGS
DAPF_SHEON      --IQFTKMHGLGNDFMVVDGITQNVFFSPEQIRRLADRNFGVGFDQLLLVEPPYDPDLDFHYRIFNADGG
DAPF_SHESR      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGVGFDQLLLVEPPYDPDLDFHYRIFNADGG
DAPF_SHESM      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGVGFDQLLLVEPPYDPDLDFHYRIFNADGG
DAPF_SHESA      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGG
DAPF_NITEU      MKLKFTKMHGLGNDFIVIDAINQSVSLDPATIRRWADRHFGIGFDQLLVVEKPGESG-DFRYRIFNADGG
DAPF_SHEFN      --IHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGS
DAPF_PSE14      MLLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWGDRHTGIGFDQLLLVEAPNNPDVDFRYRIFNSDGS
DAPF_SHEDO      --IHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLANRNFGVGFDQLLLVEPPYDPDLDFHYRIFNADGS
DAPF_ALCBS      MNLRFTKMHGLGNDFMVIDGIRQSLPLPADEIRRLADRKFGVGFDQMLIVQPAQGDA-DFRYRILNADGS
DAPF_AZOSB      MHIRFTKMHGLGNDFVVIDATRTPVDLTPARVKAIADRHFGVGCDQLLVVEPPGSDEVDFRYRIFNADGG
DAPF_PSEU2      MLLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWGDRHTGIGFDQLLLVEAPNNPDVDFRYRIFNSDGS
DAPF_PSEPK      MLLRFTKMHGLGNDFMVLDLVSQHAHIQPKHAKQWGDRHTGVGFDQLLIVEAPNNPEVDFRYRIFNADGS
DAPF_PSEE4      MLLRFTKMHGLGNDFMVLDLVSQHAHIQPKHAKQWGDRNTGIGFDQLLIVEAPSNPDVDFRYRIFNADGS
DAPF_PSEPG      MLLRFTKMHGLGNDFMVLDLVSQHAHIQPKHAKQWGDRHTGIGFDQLLIVEAPNNPEVDFRYRIFNADGS
DAPF_PSEPW      MLLRFTKMHGLGNDFMVLDLVSQHAHIQPKHAKQWGDRHTGIGFDQLLIVEAPNNPEVDFRYRIFNADGS
DAPF_NITEC      MKLQFTKMHGLGNDFIVINAINQPASLTPATIRRLADRHFGIGFDQLLIVEQAREGG-DFRYRIFNADGG
DAPF_PSESM      MLLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWGDRHTGIGFDQLLLVEAPNNPDVDFRYRIFNSDGS
DAPF_SHEAM      --IHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGS
DAPF_SHESH      --IHFTKMHGLGNDFMVVDGVTQNVFFSPEQIKRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGG
DAPF_AERS4      MLIDFSKMHGLGNDFMVVDGVTQKVFFSNDVIKKLADRHFGIGFDQLLLVEPPYDPELDFHYRIFNADGS
DAPF_TOLAT      MLIQFSKMHGLGNDFVVVDGVTQKVFFNAETLKRLGDRHFGIGFDQLLLVEPPYDPDLDFHYRIFNADGS
DAPF_SHEB9      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGT
DAPF_SHEB8      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGT
DAPF_SHEB5      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGT
DAPF_SHEB2      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGT
DAPF_HAHCH      MLIKFTKMHGLGNDFMVVDLISQHAHFRPEQVRRLADRNFGVGFDQLLIVEPPGRPDADFRYRIFNADGS
DAPF_AERHH      MLIDFSKMHGLGNDFMVVDGVTQKVFFSNEVIKKLADRHFGIGFDQLLLVEPPYDPELDFHYRIFNADGS
DAPF_PSEFL      MLLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWGDRHTGIGFDQLLIVEAPNNPDVDFRYRIFNADGS
DAPF_ACIAD      MLLEFTKMHGLGNDFVVLDLISQRAYLDTTTIQRMADRHFGIGFDQLLIVEPPDYPNVDFKYRIFNADGS
DAPF_SHESW      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGS
DAPF_SHEPC      --IQFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGS
DAPF_PSEPF      MLLRFTKMHGLGNDFMVLDLVSQHAHIQPKHAKMWGDRHTGIGFDQLLIVEAPSNPDVDFRYRIFNSDGS
DAPF_PSEHT      MLVNFSKMHGLGNDFVVIDNITQNVFLSRDQIIKLADRHFGIGFDQLLMVEAPYSPDLDFHYRIFNADGT
DAPF_SHELP      --IHFTKMHGLGNDFMVVDGVTQNVYFSPEQIKRLADRNFGIGFDQLLLVEPPYDPDLDFHYRIFNADGS
DAPF_SACD2      MRLRFTKMHGLGNDFVMIDAISQRVTITPERARQLADRHFGVGCDQVLVVETPDSPDADFKYRIFNHDGS
DAPF_CHRSD      MLLHFTKMHGLGNDFVVIDLITQRARLDTERIRQLADRHVGIGFDQLLLVEPPRDPEMDFRYRIFNADGN
DAPF_METPP      MKLRFTKMQGAGNDFVVLDATREPLTLSPAQYRYLADRRFGVGADQVLIVGASDEPGIDFTYRIVNADGS
DAPF_HALHL      ----FTKMEALGNDFVVLDGIRQRLHLTPETIRTLADRRRGVGCDQLLIAEPPAHIAADVRYRIFNADGT
DAPF_AZOSE      MSLRFTKMHGLGNDFVVIDAIRQSVDLTPEQVRRLADRHFGIGCDQLLVVEEATRPDVDFRYRIFNADGG
DAPF_ACIBS      MLLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFKYRIFNADGS
DAPF_ERWT9      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGIGFDQLLIVEPPYDPDLDFHYRIFNADGS
DAPF_ENTS8      ----FSKMHGLGNDFMVVDAVTQNVFFSPDMIRRLADRHQGVGFDQLLVVEPPYDPDLDFHYRIFNADGS
DAPF_ACIBY      MLLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFKYRIFNADGS
DAPF_ACIBC      MLLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFKYRIFNADGS
DAPF_ACIB5      MLLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFKYRIFNADGS
DAPF_ACIB3      MLLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFKYRIFNADGS
DAPF_SHEWM      --IHFAKMHGLGNDFMVVDGVTQNVFFSPEQIKRLADRNFGVGFDQLLLVEPPYDPDLDFHYRIFNADGG
DAPF_ACIBT      MLLEFTKMHGLGNDFMVVDLISQRAYLDTATIQRLADRHFGVGFDQLLIVEPPDVPEADFKYRIFNADGS
DAPF_SALTY      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALTI      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALSV      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALPK      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALPB      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALPA      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALNS      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALHS      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALDC      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SALA4      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_CHRVO      MKLKFSKMHGLGNDFMVIDGVRQTVSLTPEQIRLLGNRQLGIGFDQLLLVEPAREAGHDFRYRIFNNDGG
DAPF_ACTSZ      ----FSKMHGLGNDFVVVDAVTQNVFFPEEVIKKLADRHRGIGFDQLLLVEPPYDPELDFHYRIFNADGS
DAPF_VARPS      MRIRFTKMQGAGNDFVVLDETRGTLGLTAAQYRFLADRHFGVGADQILTVRPPSKGAVDFQYVIHNADGG
DAPF_TERTT      MRLRFTKMHGLGNDFVMIDAISQKVTITPERARKLADRHFGVGCDQVLVVESPDNPDADFRYRIFNNDGS
DAPF_CUPTR      MKLKFTKMHGAGNDFVVLDGIHQQIDLTPAQWRALASRHFGVGADQILIVEKPTRPDVDFRYRIVNADGS
DAPF_MANSM      ----FSKMHGLGNDFVVVDAVTQNVYFPEEVIKKLADRHRGIGFDQMLIVEPPYDPELDFHYRIFNADGS
DAPF_BURP8      MKLKFTKMHGAGNDFVVLDGYTQPLNLTETQVRALANRHFGVGADQLLVVEKPTVDGVDFRYRIFNCDGG
DAPF_PSYIN      MNIQFSKMHGLGNDFMVIDNVTQNVFLSKDTISRLADRNFGIGFDQLLMIEPPYDPELDFHYRIFNADGS
DAPF_DIAST      MHIRFTKMQGAGNDFVVLDETQGRLGLTPAQYRFLADRHFGVGADQILTVRPSPGAGIDFEYVIHNADGG
DAPF_VIBVY      MHFHFSKMHGLGNDFMVVDCITQNVYFSQELIRRLADRHTGVGFDQLLVVEAPYDPETDFHYRIFNADGS
DAPF_VIBVU      MHFHFSKMHGLGNDFMVVDCITQNVYFSQELIRRLADRHTGVGFDQLLVVEAPYDPETDFHYRIFNADGS
DAPF_PASMU      ----FSKMHGLGNDFVVVDAITQNLYFSPETIKRLADRHRGIGFDQMLIVEPPYDPDLDFHYRIFNADGS
DAPF_LARHH      MKLKFTKMQGLGNDFAVLDGVRQTIRLTPEQIRKLGDRRFGIGFDQLLLVEPPQDAGNDFSYRIFNCDGG
DAPF_RALME      MKLQFTKMHGAGNDFIVLDGIHQKLDLTDAQWRALANRHFGIGADQILIVEKSSRDDVDFRYRIVNADGG
DAPF_PHOLL      ----FSKMHGLGNDFMVVDAVTQNVYFSPELICRLADRHTGVGFDQLLIVEAPYDPDMDFHYRIFNADGS
DAPF_COLP3      MLVNFSKMHGLGNDFLVLDNVTQNVFLSPEQITKFANRNFGVGFDQLLVVEPPYDPDLDFHYRIYNADGS
DAPF_COXBU      MKVNFTKMQGSGNDFVVIDATKTPFQLTTSQIQKMANRRFGVGFDQLLVIEPPKNNSVDFHFRIFNADGS
DAPF_COXBR      MKVNFTKMQGSGNDFVVIDATKTPFQLTTSQIQKMANRRFGVGFDQLLVIEPPKNNSVDFHFRIFNADGS
DAPF_COXBN      MKVNFTKMQGSGNDFVVIDATKTPFQLTTSQIQKMANRRFGVGFDQLLVIEPPKNNSVDFHFRIFNADGS
DAPF_COXB2      MKVNFTKMQGSGNDFVVIDATKTPFQLTTSQIQKMANRRFGVGFDQLLVIEPPKNNSVDFHFRIFNADGS
DAPF_COXB1      MKVNFTKMQGSGNDFVVIDATKTPFQLTTSQIQKMANRRFGVGFDQLLVIEPPKNNSVDFHFRIFNADGS
DAPF_ESCF3      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECOSM      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECOLU      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECOLI      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECOLC      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECOL5      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECOHS      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECODH      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECOBW      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECO8A      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECO7I      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECO5E      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECO57      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECO55      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECO45      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECO24      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SODGM      ----FSKMHGLGNDFMVVDAVTQNVYFSPEMIRRLSDRHCGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SHIF8      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ECOL6      ----FSKMHGLGNDFMVVDAVTQNVFFSPDLIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_VIBCH      MHFHFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYRIFNADGS
DAPF_VIBC3      MHFHFSKMHGLGNDFMVVDCITQNVFFSPELIRRLADRHTGVGFDQLLVVEAPYDPESDFHYRIFNADGS
DAPF_HAEPS      ----FSKMHGLGNDFMVIDGVTQNVYLTEELIRKWADRHRGVGFDQLLLVEPPYDPELDFHYRIFNADGS
DAPF_SERP5      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_PECCP      ----FAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_ENT38      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHVGVGFDQLLVVEPPYDPDLDFHYRIFNADGS
DAPF_ECO27      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_SHIB3      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVIEPPYDPELDFHYRIFNADGS
DAPF_ECO81      ----FSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHYRIFNTDGS
DAPF_ACTP7      ----FSKMHGLGNDFMVIDGVTQNVYLTEDVIRKLADRHRGVGFDQLLLVEPPYDPELDFHYRIFNADGS
DAPF_RALSO      MKLHFTKMHGAGNDFVVLDGIATPIDFTPEQWRAIADRHFGVGADQLLLVERSTRPDVDFRYRIFNHDGG
DAPF_RALEJ      MKLQFTKMHGAGNDFVVLDGIHQKLDLTTEQWRALASRHFGVGADQMLIVEKPTREDVDFRYRIFNADGS
DAPF_RALEH      MKLQFTKMHGAGNDFVVLDGIHQQIDLTPAQWRALASRHFGVGADQILIVEKPSRPDVDFRYRIVNADGS
DAPF_ACTP2      ----FSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHYRIFNADGS
DAPF_ACIAC      MQIRFTKMQGAGNDFVVLDETQGRLGLTPAQYRYLADRHFGVGADQILTVRPSPAEGIDFEYVIHNADGG
DAPF_HAEIN      ----FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
DAPF_HAEI8      ----FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
DAPF_ERWCT      ----FAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHCGVGFDQLLVVEPPYDPELDFHYRIFNADGS
DAPF_PHOPR      MQINFSKMHGLGNDFMVVDCVTQNVFFSPAAIRRLADRHRGIGFDQLLVVEPPYDPETDFHYRIFNADGS
DAPF_PSEA6      MQVQFSKMHGLGNDFVVIDNVTQNVFFSKEKISQLADRNFGIGFDQLLVVEPPYDPEQDFHYRIFNSDGS
DAPF_BURXL      MKLKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALADRHFGVGADQLLLVEKPTVAGVDFRYRIFNCDGG
DAPF_YERPY      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_YERPS      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_YERPP      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_YERPN      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_YERPG      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_YERPE      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_YERPB      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_YERPA      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_YERP3      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_VIBPA      MHFHFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYRIFNADGS
DAPF_HAEIE      ----FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
DAPF_ACTPJ      ----FSKMHGLGNDFMVIDGVTQNVYLTEEVIRKLADRHRGVGFDQLLLVEPPYDPELDFHYRIFNADGS
DAPF_LEPCP      MRLHFTKMQGAGNDFVVLDATRAPLALSAADYRFLGDRRFGVGADQILVVERSTTPGVDFRYRIFNGSGD
DAPF_HAEIG      ----FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
DAPF_HAES1      ----FSKMHGLGNDFVVVDAVTQNVYFPTEVIKRLADRNRGIGFDQLLVVEPPYDPDLDFHYRIFNADGS
DAPF_YERE8      ----FSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQMLVVEPPYDPELDFHYRIFNADGS
DAPF_VIBF1      MHFHFSKMHGLGNDFMVVDCLTQNIFFSPDLIRRLADRHRGIGFDQLLVVEAPYDPETDFHYRIFNADGS
DAPF_IDILO      MLLHFSKMHGLGNDFMVVDNVTQNLYVNPDQIRRWADRHTGIGFDQMLLVEPPYDPDLDFHYRIFNADGS
DAPF_VIBHB      MHFHFSKMHGLGNDFMVVDCITQNVFFSQDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYRIFNADGS
DAPF_RHOFD      MRIPFTKMQGAGNDFVVLDETQGRFGLSTAHYRLLADRHFGVGADQILTVRPSPAPGIDFEYLIHNADGA
DAPF_ALISL      MHFHFSKMHGLGNDFMVVDCLTQNIFFSPDLIRRLADRNRGIGFDQLLVVEAPYDPETDFHYRIFNSDGT
DAPF_RALPJ      MKLHFTKMHGAGNDFVVLDGIQTPIDFTPEQWAAIADRHFGVGADQLLLVERSTRPDVDFRYRIFNHDGG
DAPF_PSYCK      MLIEFTKMHGLGNDFMVIDLVTQRLDLTKDLVQLLGDRHLGIGFDQLLVVEPPMRPDVDFSYRIFNTDGT
DAPF_PSYA2      MLIEFTKMHGLGNDFMVIDLVTQRLDLTKDLVQLLGDRHLGIGFDQLLVVEPPMRPDVDFSYRIFNTDGT
DAPF_BURPP      MKLKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALADRHFGVGADQLLLVEKPTVAGVDFRYRIFNCDGG
DAPF_HERAR      MKIKFTKMHGAGNDFVVIDAINQSIHFTPAQWQHLADRRFGVGADQMLVVEKPQAAGVDFRYRIYNADGG
DAPF_HAES2      ----FSKMHGLGNDFVVVDAVTQNIYFPTEVIKRLADRNRGIGFDQLLVVEPPYDPDLDFHYRIFNADGS
DAPF_PSYWF      MLIEFTKMHGLGNDFMVIDLVTQRLELTPELITLLADRNLGIGFDQLLVVEPPMRPDVDFRYRIFNSDGS
DAPF_EDWI9      ----FAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQLLVVEPPYDPDLDFHYRIFNADGS
DAPF_LEGPC      MGIKFTKMHGLGNDFIVLDGVNQSIQLTVEQIQKLANRHTGIGFDQCLLIESSQTEGIDFNYRIFNADGQ
DAPF_LEGPA      MGIKFTKMHGLGNDFIVLDGVNQSIQLTVKQIQKLANRHTGIGFDQCLLIESSQTEGIDFNYRIFNADGQ
DAPF_LEGPH      MGIKFTKMHGLGNDFIVLDGVNQSIQLTVEQIQKLANRHTGIGFDQCLLIESSQTEGIDFNYRIFNADGQ
DAPF_HAEDU      ----FSKMHGLGNDFMVIDGVTQNVYLTEDMIRKLADRHYGVGFDQLLLVEPPYDPELDFHYRIFNADGS
DAPF_VIBSL      MHFHFSKMHGLGNDFMVVDCITQNIFFSPDLIRRLADRHTGVGFDQLLVVEAPYDPETDFHYRIFNADGS
DAPF_LEGPL      MGIKFTKMHGLGNDFIVLDGVNQSIQLTVEQIQKLANRHTGIGFDQCLLIESSQTEGIDFNYRIFNADGQ
DAPF_BURCM      MKLSFTKMHGAGNDFVVLDGYSRALPLTEAQVRALANRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_BURVG      MKLSFTKMHGAGNDFVVLDGYSHTLPLTDVQVRALADRHFGIGADQLLVVEKPTVDGADFKYRIFNCDGG
DAPF_PROMH      ----FSKMHGLGNDFMVVDAVTQNVYFSPELICRLANRHTGVGFDQLLVVEAPYDPELDFHYRIFNADGS
DAPF_BURTA      MKLSFTKMHGAGNDFVVLDGYSRALPLTDALVRALADRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_BAUCH      ----FSKMHGLGNDFMVVDVVTQNVYLSPTKIRFLANRHSGVGFDQLLFVEPPYDPEIDFHYRIFNADGS
DAPF_BURPS      MKLSFTKMHGAGNDFVVLDGYTRALPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_BURP0      MKLSFTKMHGAGNDFVVLDGYTRALPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_BURMS      MKLSFTKMHGAGNDFVVLDGYTRALPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_BURMA      MKLSFTKMHGAGNDFVVLDGYTRALPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_BURM9      MKLSFTKMHGAGNDFVVLDGYTRALPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_BURM7      MKLSFTKMHGAGNDFVVLDGYTRALPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_BURP6      MKLSFTKMHGAGNDFVVLDGYTRALPLTGAQVRALADRHFGIGADQLLLVEKPTVDGADFKYRIFNCDGG
DAPF_NEIMB      --LKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVDFRYRIFNADGS
DAPF_NEIMA      --LKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGFDQLLVVGRSETEGVDFRYRIFNADGS
DAPF_BLOPB      ----FTKMNGLGNDFVIIDAVTQNIHLTSENIRYLSDRFYGVGFDQLLIVEPPYDPAIDFHCRIYNSDGT
DAPF_VESOH      MLINFTKMHGLGNDFMVVDNLAGDITFNAKKITNLANRAFGIGFDQLLVVETSNIRGVDFRYVIYNSNGS
DAPF_RUTMC      MLINFVKMHGLGNDFMMVDNLAGDITFNAEQIANLANRHLGIGFDQLLLVETSNTKNVDFRYVIYNADGL
DAPF_XANCP      -RLRFTKMHGAGNDFVVLDLRNGTPPPDASLAARLADRHFGVGCDQILTITPRSAEAVA-AYRIWNSDGS
DAPF_XANCB      -RLRFTKMHGAGNDFVVLDLRNGTPPPDASLAARLADRHFGVGCDQILTITPRSAEAVA-AYRIWNSDGS
DAPF_XANC8      -RLRFTKMHGAGNDFVVLDLRNGTPPPDASLAARLADRHFGVGCDQILTITPRSAEAVA-AYRIWNSDGS
DAPF_BLOFL      ----FSKMHGLGNDFVIIDSITQKVYFNSDKIRSLSNRFYGIGFDQLLVVEPPYDPNIDFHCRIYNADGS
DAPF_HALOH      MELSFTKMHGTGNDFIMVNGSNYPDLDFSKLARQLCRRHFSIGADGLIIVLPPESVEHDFRMRIFNADGS
DAPF_SYNJA      -RLSFHKYQGLGNDFILVDNRHQPQPLTPEEAVALCNRRFGVGADGVIFLLPGQEGA-DFSMRLFNSDGS
DAPF_LEPBA      MKINFTKMEGIGNDYVYIDATKNDIRLSPEQIQKLSDRNFGIGGDGVIFIRNSN--SGEFQMDMYNSDGS
DAPF_ACAM1      MRVEFTKYQGLGNDFILIDNRHQAQPLTPDQAVQMCDRNFGIGGDGVIFALPPEGDT-DYTMRIYNSDGS
DAPF_SYNJB      -RLSFHKYQGLGNDFILVDNRSQPC-LSPEEAVALCNRRFGVGADGVIFLLPGQEGA-DFSMRLFNSDGS
DAPF_CARHZ      ----FLKMHGLGNDFVVVDEIKNQNLVNSDLAKKICDRRFGIGADGLVLLLPSE--KADFKMRIINSDGS
DAPF_XANAC      -RLRFTKMHGAGNDFVVLDLRDGTXXXXXXXXXXXXXRHFGIGCDQILTIEAPRSEGAAAAYGIWNSDGS
DAPF_BUCAP      --IYFSKMHGLGNDFMVIESIKQDFILTKSIIENLSNRNTGVGFDQLLLIEKSNNFKFDFHYRIFNANGN
DAPF_CYAP4      MSLQFTKYQGLGNDFILIDNRNEPL-LTPEQAVDICDRHFGVGADGVIFLLPAT-GETDYTMRIFNSDGS
DAPF2_ANASP     MAIEFTKYHGLGNDFILIDRASKTPAITPEKAVEMCDRHFGIGADGVIFALPGE-NGTDYTMRIFNSDGS
DAPF_XANC5      -RLRFTKMHGAGNDFVVLDLRDGTXXXXXXXXXXXXXRHFGVGCDQILTIEAPRSEGAVAAYGIWNSDGS
DAPF_HELMI      ----FVKMHGLGNDFIVVNAMEPPL---LDREDWICDRHYGIGGDGLILLFPSD--KADIRWRILNSDGS
DAPF_CLOTH      ----FTKMHGLGNDYIYVNCFEETVENPSEVAKKVSDRHFGIGSDGLVLIMPSE--RADFKMRMFNSDGS
DAPF_TRIEI      MTKSFTKYHGLGNDFILIDNRHQPI-LTPEQAIELCDRNFGIGADGVIFALPG-VKQTDYTMRIFNSDGS
DAPF_LEPBL      --LKFTKMEGIGNDYIYIDSTQANIRLTPEQIQKISNRNFGIGSDGVIFIRNSKQG--DFMMDMYNSDGS
DAPF_LEPBJ      --LKFTKMEGIGNDYIYIDSTQANIRLTPEQIQKISNRNFGIGSDGVIFIRNSKQG--DFMMDMYNSDGS
DAPF_NOSP7      MAIEFTKYHGLGNDFILIDNRSSSLPLTPEQAIQLCDRHFGIGADGVIFALPGE-NGTDYTMRIFNSDGS
DAPF_XYLFM      ----FTKMQGAGNDFVVLDLRDGTPPPDAALVAWLADRHFGIGCDQVIAIEPPRGVGVVAAYRIWNADGS
DAPF_LEPIC      --LKFTKMEGIGNDYVYIDSTRNDIRLTPEQIQKISDRNFGIGSDGVIFIRNSKQG--DFMMDMYNSDGS
DAPF_XANOM      -RLRFTKMHGAGNDFVVLDLRDGTXXXXXXXXXXXXXRHFGVGCDQILTIEAPRSEGAVAAYGIWNSDGS
DAPF_SYNP6      MSLQFAKYHGLGNDFILVDNRSGEPRLTPEQAVQVCDRNFGVGADGVIFALPGSGDS-DYVMRIFNSDGS
DAPF_SYNE7      MSLQFAKYHGLGNDFILVDNRSGEPRLTPEQAVQVCDRNFGVGADGVIFALPGSGDS-DYVMRIFNSDGS
DAPF_MICAN      MKIPFTKYQGLGNDFILIDNRHSPEPLTAEMAVAMCDRHFGIGADGVIFALPGQAET-DYTMRIFNSDGS
DAPF_DESHD      ------KMHGLGNDFVFIDHFQAPAELPPELARKLCHRQFGVGGDGLIMVLPSD--KADARMRILNSDGS
DAPF_RHOCS      ----FLKMHGLGNDFVVLDARRDPLPLTTAAARAIADRHTGVGCDQIVLLEPPRHPAADLFMRILNPDGS
DAPF_ORYSJ      ----FVKYQGLGNDFIMVDNRDSAVKVTPEEAAKLCDRNFGVGADGVIFVMPG-VNGADYTMRIFNSDGS
DAPF_ORYSI      ----FVKYQGLGNDFIMMDNRDSAVKVTPEEAAKLCDRNFGVGADGVIFVMPG-VNGADYTMRIFNSDGS
DAPF_MAGSM      ----FIKMHGLGNDFVVLDHLESPRELSPQEARFWADRRRGVGCDQVVQLLPG-VEGGDAQMRIYNPDGS
DAPF_LEPIN      --LKFTKMEGIGNDYVYIDSTRNDIRLTPEQIQKISDRNFGIGSDGVIFIRNSKQG--DFMMDMYNSDGS
DAPF_XYLFA      ----FTKMQGAGNDFVVLDLRDGTPPPDVALVAWLADRHFGIGCDQVIAIEPPRGVGVFAAYRIWNADGS
DAPF_XYLFT      ----FTKMQGAGNDFVVLDLRDGTPPPDAALVAWLADRHFGIGCDQVIAIEPPRGVGVFAAYRIWNADGS
DAPF_XYLF2      ----FTKMQGAGNDFVVLDLRDGTPPPDAALVAWLADRHFGIGCDQVIAIEPPRGVGVFAAYRIWNADGS
DAPF_CYAP8      MSIEFSKYQGLGNDFILIDNRSSHTPLVSEQAIKMCDRHFGIGADGVIFVLPGTANT-DYTMRIFNSDGS
DAPF_BUCAI      -KINFSKMHGLKNDFMVINCIKKNVFLTSHIIKKLSNRYTGIGFDQLLLVEKSNSLLTDFHYRIFNANGN
DAPF_SYNY3      MALSFSKYHGLGNDFILVDRQSTEPCLTPDQAQQLCDRHFGIGADGVIFALPGQ-GGTDYTMRIFNSDGS
DAPF_DESDA      --LRFTKMQGIGNDYVYINGFQERIDSPGELARKISDRHFGIGSDGLVLILPSA--TADVRMRMFNADGS
DAPF_BUCA5      -KINFSKMHGLKNDFMVINCIKKNVFLTSHIIKKLSNRYTGIGFDQLLLVEKSNSLLTDFHYRIFNANGN
DAPF_SYNP2      MVLEFTKYQGLGNDFILLDNRQQTTPLTPEQAIQLCDRHFGIGADGVIFALPGQAGA-DYTMRIFNSDGS
DAPF_GRABC      MLIDFIKMHGLGNDFVVFDARKGPLALSGSQAAAIADRRTGVGCDQLIVLEPSTVA--DAFMRIYNPDGS
DAPF_BUCAT      -KINFSKMHGLKNDFMVINCIKKNVFLTSHIIKKLSNRYTGIGFDQLLLVEKSNSLLTDFHYRIFNANGN
DAPF_ARATH      ----FVKYHGLGNDFILVDNRSEP-KITQEQAAKLCDRNFGVGADGVIFAMPG-VNGTDYAMRIFNSDGS
DAPF_THEEB      MSLSFQKYQGLGNDFLLIDNRHQELLLTPEQAQFWCDRHFGVGADGVIFLLRGTGES-DYRMRMYNADGS
DAPF_GLUOX      MTLSFTKMHGLGNDFVVIDGRQNDPALETATIRHLCDRRFGIGCDQLVLLTPPTLAGADVHVRFFNPDGS
DAPF_CYAP7      MGIEFTKYHGLGNDFILIDNRSEPMVSPEMAVE-MCDRHFGIGADGVIFVLPGTSQT-DYQMRIFNSDGS
DAPF_METTH      --ILFSKMHGLGNDYVVIDESAQPEDKKPEFVREVCTRGFSVGADGVIFVQPASGEG-DIRFRIFNADGS
DAPF_SPHWW      MQVRFHKMHGLGNDFVVIDAATAPVEMTAARARALADRKTGVGCDQLILLEPSAVA--DARMRIFNADGS
DAPF_METM6      ----FTKMHGLGNDYIYVDAISQKIENPNEISRFVSDRHFGIGSDGLVLILPSDLA--DFKMRMFNSDGS
DAPF_METMP      ----FTKMHGLGNDYIYVDAISQKIENPNEISKFVSDRHFGIGSDGLVLILPSDVA--DFKMRMFNSDGS
DAPF_METM7      ----FTKMHGLGNDYIYVDATSQKIENPNEISRFVSDRHFGIGSDGLVLILPSEIA--DFKMRMFNSDGS
DAPF_PELTS      ----FTKAHGLGNDFILVDCFKEPEDFPGLAVK-MCDRHFGVGADGLVLLLPS--PSADVSMRIFNPDGS
DAPF_BACV8      --IKFTKMQGTGNDYIYVNTLSSPLQDPIKAARKWSTYHTGIGADGLVLIGASE--KADFSMRIFNADGS
DAPF_PHEZH      ----FLKMNGLGNDFVVVETRSAPFEPTAAQVRAIADRATGIGCDQLIAVDPAE--GADAHVRFWNADGE
DAPF_METM5      ----FTKMHGLGNDYIYVDAISQKIENPNEISKFVSDRHFGIGSDGLVLILPSDVA--DFKMRMFNSDGS
DAPF_SPHAL      ----FTKMHGLGNDFVVIDARVAPVEMTPARAHAIADRRHGIGCDQLILLEPST--SADVKMRIFNADGG
DAPF_DESAP      ----FTKMHGLGNDFVIVNGFGQSLDDPGALARRVCDRRXXXXXXXXXXXXPSA--AADLRMRVFNPDGS
DAPF_ERYLH      MRVSFTKMHGLGNDFIMLDARAESLPMTAATARALADRKTGIGCDQVILLEPSD--SADFRMRIFNADGG
DAPF_PROMM      --LQFSKYQGLGNDFLLIDGTQQVINPDPAWVRKICDRHFGIGADGLILALPPRADG-DLRMQIFNADGS
DAPF_ELUMP      ----FVKYQGLGNDFILIDCVKIKIDGLNALGKKLCDRHFGIGADGLIAVFPSA--SADYKIRIINSDGT
DAPF_BACFR      --IQFTKMHGTGNDYIYVNTLRFPIARPEAAIEWSAYHT-GIGSDGLVLIGHSD--KADFSMRIFNADGS
DAPF_DESAH      MELNFTKMEGLGNDFVMLDDRNGAIVQTVPYAKKLCSRRFGVXXXXXXXXXXSE--TADVGFKIFNPDGS
DAPF_OCEIH      MQIPFTKMHGLGNNYVYIDLFDYAIDLYHDLAIQISDVYTGIGSDGMILIHPTT--DADVGMRIFNKDGS
DAPF_BUCBP      -------MHGLGNDFIIINAMMQKFPVTSNIIQNLSNRYTGIGFDQLLLVENSKNVNIDFHYRIFNANGT
DAPF_PROM1      MKNNFSKYQGLGNDFIIFDARSNNLDHLFSKIEHLCNRNFGIGADGIILILESNNKCF-VRMKIYNSDGS
DAPF_DESRM      ----FTKVHGLGNDFILVNAFTDDCSTLAKEV---CDRKFGIGADGLVLLYDSGVA--DVRMKIVNSDGS
DAPF_MOOTA      ----FVKMHGLGNDFVLVNAMTEKVGDLPGLARRVCHRRFGIGADGLILVLPSEQARLRM--RIFNPDGS
DAPF_GEOTN      ----FTKMHGLGNSYIYVDLFREPEEDLPAIARSVADVHTGIGSDGLILICPSEQAPVKM--RIFNSDGS
DAPF_PROMT      MKNNFSKYQGLGNDFIIFDARSNNLDHLFSKIEHLCNRNFGIGADGIILILESNNKCF-VRMKIYNSDGS
DAPF_BACCN      -QFSFTKMHGLGNSYIYVNMFEEELALVAEKV---SNRNTGIGADGMILICPSEVAPVKM--RMFNNDGS
DAPF_EUBR3      ----FTKMHGCGNDYVYVNLFEEKLDDPARVSIYVSDRHFGIGSDGLITIGPSD--KADFRMRIYNADGS
DAPF_ZYMMO      MTFSFHKMHGLGNDFIVLDARKNPIQMNPALAQALSNRHTGIGCDQLIIIGNGKNQA-DVSMEIWNADGS
DAPF_RHOPT      ----FAKMNGIGNEIVVVDLRDQPAPVTPADARAVAAH---VPYDQLMLLQPARLPGTEAFVRIYNNDGS
DAPF_CAUSK      MSRTFLKMNGLGNDFVVIETLTQPFHPTAEEIRAIAKREGGIGCDQVIAIDPPRAEGASAYVRFWNSDGE
DAPF_BACCR      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACC1      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACC4      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_ALKMQ      MEIKFKKMHGTGNDFIMIYYEDYPFEQHFNQLKEVCHRHFGIGADGLMIVKESSVADVQMKY--FNSDGS
DAPF_RHOPS      ----FAKMNGIGNEIVVVDLRDQPAPVTPDDARAVAAH---LPYDQLMLLQPARLPGTEAFVRIYNNDGS
DAPF_PARD8      --IRFTKMHGAGNDYIYVNTMAYPIDNPEESIAW-SKPHTGIGSDGLVLIGSSDIA--DFSMHIYNADGS
DAPF_BACCZ      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACC2      -QFSFTKMHGLGNSYIYVNMFEEQLVLVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACAN      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACAC      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACAA      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACWK      -QFSFTKMHGLGNSYIYVNMFEEQLAIVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACHK      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACC7      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACC3      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_BACC0      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_THETN      ----FTKMHGLGNDFIVIEAV-EGVDYSELAVK-LCDRHFGIGADGLLVVEPSHIA--DIKMRIFNADGS
DAPF_CAUCR      MSRTFLKMNGLGNDFVVIQTLTEAFDPTPEQIRAIAKRKGGIGCDQVIAIDPPRAEGASAYVRFWNSDGE
DAPF_CAUCN      MSRTFLKMNGLGNDFVVIQTLTEAFDPTPEQIRAIAKRKGGIGCDQVIAIDPPRAEGASAYVRFWNSDGE
DAPF_BACAH      -QFSFTKMHGLGNSYIYVNMFEEQLALVAEKV---SNINTGIGADGMILICPSDVAPVKM--RMFNNDGS
DAPF_RHOPA      ----FAKMNGIGNEIVVVDLRDQPAPVTPADARAVAAH---VPYDQLMLLQPARLSGTEAFVRIYNNDGS
DAPF_RHOP2      ----FAKMNGIGNEIVVVDLRDQPAPVTPDDARAVAAH---VPYDQLMLLQPARLPGTEAFVRIYNNDGS
DAPF_BRAJA      ---AFAKMNGIGNEIVVVDMRDSTAKVTPDDARAVASAQGGVPYDQLMVLQKPRLDGTEAFISIYNNDGS
DAPF_BACP2      ----FTKMHGLGNNYIYVNQMKEQLSEIAIQVSSIYT---GIGSDGMILICPSDVAPVKM--RIFNNDGS
DAPF_BACA2      ----FTKMHGLGNSYIYVNQFEEPEERLAEIAVKVSSIHTGIGSDGMILICPSEKAPVKM--RIFNNDGS
DAPF_GEOSW      -KFSFTKMHGLGNSYIYVNMFEEPESLLSSLAVKVSNVNTGIGADGMILICPSEVAPVKM--RIFNSDGS
DAPF_BACHD      ----FTKMHGLGNSYIYVDCFXXXXXXXXXXXXXXXDKNKGIGSDGMILICPSDRAPVKM--RVFNNDGS
DAPF_BACSU      ----FTKMHGLGNSYIYVNQFEEQLSEIAIQVSSVYT---GIGSDGMILICPSDQAPVKM--RIFNNDGS
DAPF_RHOS4      --LGFMKMHGAGNDFVVIDSRGRGGALTAGLARALGDRHRGVGFDQLAEIRDQE--GADCALDFWNSDGS
DAPF_RHOPB      ---SFSKMNGIGNEIVVLDLRDHPXXXXXXXXXXXXXE---VPYDQLMVLQPPRTPGTEAFVRIYNNDGS
DAPF_BACLD      ----FTKMHGLGNSYIYVNQFEEPEELLSDLAVKVSSVYTGIGSDGMILICPSDRAPVKM--RIFNSDGS
DAPF_GEOKA      ---SFTKMHGLGNSYIYVDLFREPEEELPAIARSVADVHTGIGSDGLILICPSEKAPVKM--RIFNSDGS
DAPF_WOLWR      ----FIKMHGTGNNFVIIDSCS------ANDLNWIANQN---GCDQVIVITNSSLA--DCFMHIYNADGS
DAPF_AZOPC      ----FTKMHGAGNDYIYIDCFKEKIDCPEELAIRLSDRHKGIGSDGLVLIMPSD--KCSFRMRMFNSDGS
DAPF_ARCFU      MRIAFTKMHGNGNDFVLIDEFEGVIVGEEEKVRAVCHRNFGVGADGALFVQPSQ--KADVRFRYFNSDGS
DAPF_BACTN      -KIKFTKMHGAGNDYIYVDTTRYPIA--APEKKAIEWSKFHTXXXXXXXXXXXXXXKADFSMRIFNADGS
DAPF_ACICJ      ----FLKMHGAGNDFVVXXXXXXXXXXXXXXXXXXXXXXXGVGCDQIILIERDDGAAAFM--RILNADGS
DAPF_WOLTR      ------RMYGTGNNFVIID--SRSINNLNWNYREIANQN---GCDQIIVITNSS--AADCFMHIYNADGG
DAPF1_ANASP     ----FYKYHALGNDYLVINPQDLKFPLTPEKIKIICHRNFGIGSDGILLGPLASTKA-QFALRIFNPDGS
DAPF_METJA      ----FTKMHALGNDYIVIDGEKVKEEEKAEFSRKICRRGFSVGADGVIFIQKPTSDEYDVRFRIFNSDGS
DAPF_NITHX      ---AFSKMNGIGNEIVVVDLRDRPXXXXXXXXXXXXSPG-GVPYDQLMVLQPPRLPGTEAFVSIYNNDGS
DAPF_RHOP5      ---SFAKMNGIGNEIVVLDLRDDPVXXXXXXXXXXXSQ---VPYDQLMVLQPPRAAGTAAFIRIYNNDGS
DAPF_BRASB      ---SFVKMNGIGNEIVVLDLRDVKHVVTPDEARAVAAR---VPYDQLMVLQPPRLDGTEAFIRIYNNDGS
DAPF_BEII9      -----TKMNGLGNAIVVLDLRGTGIVISAAEARAIGQGK-GLHFDQLMVLHDPLSPGSAAFMRIYNIDGS
DAPF_BRUME      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BRUSU      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BRUSI      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BRUO2      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BRUMB      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BRUC2      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BRUAB      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BRUA2      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BRUA1      -KAAFARMNGLGNQIIVADMRGRADSITAAAIRLASDSETAF--DQIMAIHDPRTPGTDYYIAIINCDGT
DAPF_BARQU      MKTPFRKMDGLGNQIIVADMRESTHALTPQAILALAADPQ-THFDQIMTIHSSTQKEADFRIEIWNADGS
DAPF_BRASO      ---SFVKMNGIGNEIVVLDLRDVKHVVTPDEARAVASR---VPYDQMMVLQRPRFDGTEAFIRIYNNDGS
DAPF_UNCMA      -KIKFTKMHGNGNDFIVIDEFENPVEKKAAFAKKVCHRRFGIGADGVLFLAKPLHTSLHM--RIFNEDGS
DAPF_BARBK      MKTPFSKMNGLGNKIIVADLRKAIHNITPQAIQALASNPQ-THFDQIMAIHPPTQDA-DFRIEIWNADGS
DAPF_METC4      ----FLKMHGAGNAIVVLDLRGTAVRVTPAEARAIA-ADVHSRFDQLMVVHDPVTPGTDAFMRIYNTDGS
DAPF_OLICO      ---SFAKMNGIGNEIVIVDLRNTDSQLSXXXXXXXXXPG-GVPYDQLMVLQKPRMPGTTAFVRIYNNDGS
DAPF_CLOPE      ----FSKMHGNGNDFIVIEDLNNELGKEGEIAQKMCHRRFGIGADGILIVRKNE--NCDIEMVIINSDGS
DAPF_METEP      ----FLKMHGAGNAIVVLDLRGTAVRVTPAEARAIA-ADVHSRFDQLMVVHDPVTPGTDAFMRIYNTDGS
DAPF_META3      MGLNFTKMHGLGNDYIVINEFDGEKIKEDEKAEFICKRGFSIGADGVIFVQPATDEKYDIRFRIFNSDGS
DAPF_METS4      ----FLKMNGLGNEIVVLDLRASSHVVRPEEARAIAADPRS-RFDQLMVLHDPVTPGTDARLRIYNRDGS
DAPF_RHILW      --VEFARMNGLGNKILVVDMRGRPDKVTAAAVALNADPQTEF--DQIMAIHDPKADGTDAFIDILNSDGS
DAPF_AGRRK      --VEFARMNGLGNKILVVDMRGRK-DVVTXXXXXXXXXXXXTEFDQIMAIHDPKAEGTDAWIDILNSDGT
DAPF_METNO      ----FLKMNGLGNEIVVLDLRGTPHIVQPQEARAIAADPRS-RFDQLMVLHDPVTAGTDAALRIYNTDGS
DAPF_BRAHW      MDLSFTKMHGTGNDYIYINCFKEKFTVEDA-IKYLSHRHYSIGADGIILIMPSD--KADVQMRMFNYDGS
DAPF_BARHE      MKTPFSKMDGLGNQIIVADMRESTHALTPQAILSLAADSQTY-FDQIMAIHLPTKKEADFRIEIWNADGS
DAPF_OCHA4      -KAAFAKMNGLGNQIIVADMRGRADRITPEAAIRLAGDS-ETAFDQIMAIHDPRTAGTDNYIAIINCDGT
DAPF_METSB      ------KMNGIGNEILIVDLRGAGAGVTGPQARAIA-RTKGLAFDQLMVLEDPRSKGCAAFVTIFNADGS
DAPF_BART1      MKTPFSKMDGLGNQIIVADMRESTQALTPQAILALSADP-EMHFDQIMAIRNPTKNEADFHIEIWNADGS
DAPF_METTP      -QLEFVKLHGNGNDFILIDELNGPEDEKSEASRILCHRNFGIGGDGVLFLVPSE--RADIGMRLFQPDGS
DAPF_ALKOO      MDVQFKKMQGTGNDFIVVKYDDFPFEEKLSQLEKICDRHFGIGADGLLIVNPSSIADIRMDY--YNSDGS
DAPF_AGRT5      --VEFAKMNGLANKILVVDMRGRKDMVTPAAAIAL-NSNPATQFDQIMAIHDPRVGGTDAFIDILNCDGT
DAPF_METPB      ----FLKMHGAGNAIVVLDLRGTSIRVXXXXXXXXXXXXHS-RFDQLMVVHDPVTPGTDAFMRIYNTDGS
DAPF_RHIEC      --VEFARMNGLGNKILVVDMRGRSDKVTAAAVALNADPQTEF--DQIMAIHDPKADGTDAFIDILNSDGS
DAPF_RHILO      ----FAKMNGIGNEIIVADMRGRXXXXXXXXXXXXXXXXXX-RFDQIMAIHDARTPGTAYYVDILNSDGT
DAPF_PELUB      MDIKAFKMDGLGNDFVIIDQRSQDFNLDKDQIIKICDRSF-IGCDQLILIKKNK--EIDANVEFFNSDGS
DAPF_MESSB      ----FAKMNGLGNAIIVADMRGR-----ADRVRPEAAQRLASDFDQIMAIHDPRLEGTENYIEIINSDGS
DAPF_NATTJ      ----FEKMHGLGNDFILMKDFQRNYPDLAKR---LCDRRFGIGADGLVIYSSCKNSNIDYQMRIYNSDGS
DAPF_RHIME      -QVQFARMNGLGNKILVVDMRGRKDRVTP-QAAIALNADPATEFDQIMAIHDPKSAGTDAWIDIVNSDGS
DAPF_THEFY      ----FAKGHGTENDFVILPDPDGELDLDAATVAALCDRRAGLGADGVLRVVAATAQRCEWFMDYRNADGS
DAPF_AQUAE      ----FWKLQGSGNDFVVIDDRDEKLESFLKEVRKVCAFHTGVGADGLILIKNPDNPENDFKWEFFNSDGS
DAPF_LEIXX      ----FTKGQGTGNDFVLYADPDGTLPLSAGQIAEICDRHFGVGADGVIAVRSKRLPXXXXXXXYYNADGS
DAPF_CORGL      LTIPFAKGHATENDFIIIPDEDARLDLTPEMVVTLCDRRAGIGADGILRVVKAADPSLWFDYR--NADGS
DAPF_CLAM3      --LQFTKGQGTGNDFVLFADPAGEIDLTDTQVQALCDRHFGIGADGTIRAVPEGRAALEMDYR--NVDGS
DAPF_AGRVS      -RVEFAKMNGLGNKILVVDMRGRADRVMPQAAIALAGNA-ETHFDQIMAIHDPKLAGTFAYIDIINCDGT
DAPF_CORGB      LTIPFAKGHATENDFIIIPDEDARLDLTPEMVVKLCDRRAGIGADGILRVVKAADPSLWFDYR--NADGS
DAPF_MYCA9      ----FTKGHGTQNDFVVLPDVHIKRDLSVAAVQALCDRQRGLGADGVLRVTPAGVSSEDWFMDYRNADGS
DAPF_MYCMM      ----FAKGHGTQNDFVLLPDVAARLSLTAAQVAALCDRRRGLGADGILRXLPDGVSPGDWYMDYRNADGS
DAPF_MYCUA      ----FAKGHGTQNDFVLLPDVAARLSLTAAQVAALCDRRRGLGADGILRXLPDGVSPGDWYMDYRNADGS
DAPF_RICBR      -KINFVKMHGLGNDFVIINKKDLTGTYDLSQLKSMAKRHLGIGCDQFIIYEEQN---DSYEMIIYNIDGS
DAPF_RICB8      -KINFVKMHGLGNDFVIINKKDLTGTYDLSQLKSMAKRHLGIGCDQFIIYEEQN---DSYEMIIYNIDGS
DAPF_HYDS0      -----TKYQGSGNDFIIIDNRDEKLGLSINEVRKLCEQHTSVGADGVILIEKARNTKNHFSWAFFNADGS
DAPF_RICPU      -KINFVKMHGLGNDFVIVNKRDLSSSYDLSQLKNMAERHTGIGCDQFIIYEEHN----DFEMIIYNIDGS
DAPF_RICCN      -KINFVKMHGLGNDFVIVNKRDLSSSYDLSQLKNMAERHTGIGCDQFIIYEEHN----DFEMIIYNIDGS
DAPF_RICAE      -KINFVKMHGLGNDFVIVNKRDLSSSYDLSQLKNMAERHTGIGCDQFIIYEEHN----DFEMIIYNIDGS
DAPF_CLAMS      --LQFTKGQGTGNDFVLFADPAGEIDLTDTQVQALCDRHFGIGADGTIRAVPEGRAALDMDYR--NVDGS
DAPF_RICRS      -KINFVKMHGLGNDFVIVNKRDLSSSYDLSQLKNMAERHTGIGCDQFILYEEHN----DFEMIIYNIDGS
DAPF_RICRO      -KINFVKMHGLGNDFVIVNKRDLSSSYDLSQLKNMAERHTGIGCDQFILYEEHN----DFEMIIYNIDGS
DAPF_RHOSR      ----FSKGHGTENDFVVLPDPDVRIDLSAPRVAALCDRRRGLGADGILRXXPDGTSEDDWFMDYRNADGS
DAPF_RICFE      -KINFVKMHGLGNDFVVVNKRDLSSSYDLSQLKNMADRHTGIGCDQFIIYEEHD----DFEMIIYNIDGS
DAPF_RHOOB      ----FSKGHGTENDFVVLPDPDVRIDLSAPRVAALCDRRRGLGADGILRXXPDGTSEDDWFMDYRNADGS
DAPF_CHLTE      -------MSGAGNDFIVIDNRQGLFNLTHEQVRAMCTRRTGIGADGLILLETSE--TADFRMNYHNADGF
DAPF_RICAH      -KINFVKMHGLGNDFVIVNKRDLLSSYDLSQLKNMADRHTGIGCDQFIIYEEHN----DFYEMIYNIDGS
DAPF_STRCO      -RIAFLKGHGTENDFVIVPDPENXXXXXXXXXXXXCDRRAXXXXXXXXVVRSAAHPEARMDYR--NGDGS
DAPF_RICPR      -KINFVKMHGLGNDFVIVNKRDLATSYNLSHLKNMADRHTGIGCDQCIIYEENN----DFYTMIYNIDGS
DAPF_RICCK      -KINFVKMHGLGNDCVIVNKRDLLNAHNLSQLKNIADRHTGIGCDQFIIYENHNN---FYEMIIYNIDGS
DAPF_CORA7      ----FAKGHGTENDFVIVEGTGP---LPPEKVVALCDRRAGIGADGVLRIIRAGINADDWFMDYRNADGS
DAPF_CLOAB      VEINILKCHGTGNDFXXXXXXXXXXXXXXXTRRDIANRAKFIGGDGILFVQKSDI--CDAKMRIFNADGS
DAPF_WIGBR      ----FSKMHSLGNDFXXXXXXXXXXXXSPIFIKKLSDRYTGIGFDQLILIEXXXXXXXXXXXXXXNSDSS
DAPF_RICM5      -KINFVKMHGLGNDFVIVNKRDLSSSYDLSQLKNMAERHTGIGCDQFIIYEEHN----DFEMIIYNIDGS
DAPF_MYCLE      ----FAKGHGTQNDFVVLPDVEADVTFTAAQVAALCNRRQGLGADGVLRXLPDGVSCSDWYMDYRNADGS
DAPF_MYCLB      ----FAKGHGTQNDFVVLPDVEADVTFTAAQVAALCNRRQGLGADGVLRXLPDGVSCSDWYMDYRNADGS
DAPF_RICTY      -KINFVKMHGLGNDFVIVHKRDLATVCNLSQLKNMADRHTGIGCDQCIIYEEYNNV---YTMIIYNIDGS
DAPF_LISMF      --IHFTKVHGSQNDFFLVDEEENHITEWSDEKRALCDRKHSLGADGILYVTKSSEVGPIGQMRVVNSDGS
DAPF_LISMC      --IHFTKVHGSQNDFFLVDEEENHITEWSDEKRALCDRKHSLGADGILYVTKSSEVGPIGQMRVVNSDGS
DAPF_GEMAT      --MSFVKMTGSGNDFVFFDGRTTPIDLVTQPIKAICNRYNGIGADGLVVLEPLQEEA-DVRVHYYNSDGT
DAPF_MYCPA      ----FAKGHGTENDFVLLCDPPAELRLTGAGVAALCDRRRGLGADGVLRVTPDGVAGDDWYMDYRNADGS
DAPF_LISMH      --IHFTKVHGSQNDFFLVDEEENLITEWSDEQRALCDRKHSLGADGILYVTKSSEVGPIGQMRVVNSDGS
DAPF_LISW6      --IHFTKVHGSQNDFFLVDEEENHITAWSDTKRALCDRSHSLGADGILYVAKSNKAGAIGQMRVVNSDGS
DAPF_CHLPN      ---------GAGNRFLLGETLPE-----VEDVRFLCQETR---VDGFLYLKPSS--CADAQLIIFNSDGS
DAPF_MYCSK      ----FAKGHGTQNDFVLLPDLDARLALTPAVVSALCDRRRGLGADGVLRVTPEGVGAGDWYMDYRNADGS
DAPF_MYCSJ      ----FAKGHGTQNDFVLLPDLDARLALTPAVVSALCDRRRGLGADGVLRVTPEGVGAGDWYMDYRNADGS
DAPF_METKA      ----FWKVHGARNDFVLVDETEEPESDKPDFARWACDRRSGVGADGVVFIR-SDPPSVEM--RIFNRDGS
DAPF_MYCA1      ----FAKGHGTENDFVLLCDTPAELRLTAAGVAALCDRRRGLGADGVLRXXPDGVAGDDWYMDYRNSDGS
DAPF_ACIC1      --VPFLKGHATRNDFVILPDHXXXXXXXXXXVRAICDRRRGLGADGILRXXXXXXXXXXMDYR--NADGS
DAPF_COREF      --IAFAKGHATENDFIIIHDPDGTIDLTADEVTRLCDRRAGLGADGVLRVVRAQTPGVDPGWWFMNADGS
DAPF_MYCS2      ----FAKGHGTENDFVVLPDLDAALSLTPSAVAALCDRRRGLGADXXXXXLPDGVSAGDWYMDYRNADGS
DAPF_FLAPJ      ------KYQGTGNDFIMIDNRLQPKQNTAL-IQKLCDRRFGIGADGLILLENDQ--STDFKMVYYNSDGN
DAPF_LACPL      MAVKMIKVHGSGNDFYLLDQTQFQAPLSDADLKQLAGAGLYDGADGVLVVDKSEHPQVLGRMRVINADGT
DAPF_LISMO      --IHFTKVHGSQNDFFLVDEEGNQIMDWSDAKRALCDREHSLGADGILYVTKSSEAGPIGQMRVVNSDGS
DAPF_MYCTU      ----FAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRXLPEGVRVTDWYMDYRNADGS
DAPF_MYCTA      ----FAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRXLPEGVRVTDWYMDYRNADGS
DAPF_MYCBT      ----FAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRXLPEGVRVTDWYMDYRNADGS
DAPF_MYCBP      ----FAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRXLPEGVRVTDWYMDYRNADGS
DAPF_MYCBO      ----FAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRXLPEGVRVTDWYMDYRNADGS
DAPF_LISIN      --IHFTKVHGSQNDFFLVDEEENQIMDWSDAKRALCDREHSLGADGILYVTKSNEAGPIGQMRVVNSDGS
DAPF_NITSB      ------KYSASGNDFVIYHTFVK--KDRSELAKLLCHRHEGIGADGLIVLLPHS--RYDFEWQFYNADGS
DAPF_LACS1      ------KVHGSGNDFFIXXXXXXXXXXXXXXAQKVCDRDTGLGADGVLYVQ-AGHEGTDGRMRVINADGS
DAPF_CHLTR      ---------------------------------------------------------------VFNSDGS
DAPF_CHLTB      ---------------------------------------------------------------VFNSDGS
DAPF_CHLTA      ---------------------------------------------------------------VFNSDGS
DAPF_CHLT2      ---------------------------------------------------------------VFNSDGS
DAPF_MYCVP      ----FAKGHGTQNDFXXXXXXXXXXXXXXXXXXXXCDRRQGLGADGVLXXXPEGVVEGDWYMDYRNADGS
DAPF_CAMJ8      ----FYKYCASGNDFVITNARKEDRSALAKE---LCNRYEGIGADGFIVILPHE--KYDFEWEFYNNDGS
DAPF_CAMJD      ----FYKYCASGNDFVITNADRK--EDRSSLAKELCNRYEGIGADGFIVILPHE--KYDFEWEFYNNDGS
DAPF_CAMJE      ----FYKYCASGNDFVITNARKEDRSALAKE---LCNRYEGIGADGFIVILPHE--KYDFEWEFYNNDGS
DAPF_CAMJJ      ----FYKYCASGNDFVITNARKEDRSALAKE---LCNRYEGIGADGFIVILPHE--KYDFEWEFYNNDGS
DAPF_CAMJR      ----FYKYCASGNDFVITNARKEDRSALAKE---LCNRYEGIGGDGFIVILPHE--KYDFEWEFYNNDGS
DAPF_MYCGI      ----FAKGHGTQNDFVLLPDLNAQYSLTARAVAAXXXXXXXXXXXXXXXXXPEGVAEDDWFMDYRNADGS
DAPF_HELPY      --MVFYKYSGSGNDFLIVQSFKKKFSNLAKQV---CHRHEGFGADGLVVVLPSK--DYDYEWDFYNSDGS
DAPF_HELPS      --MVFYKYSGSGNDFLIVQSFKKKFSNLAKQV---CHRHEGFGADGLVVVLPSK--DYDYEWDFYNSDGS
DAPF_RHOE4      -----------------------------------------------------------------NSDGS
DAPF_ENTFA      MNVMMQKVHGSENDFFLLDETQFERSLTAEEIEQLRETXXXXXXXXXXXXXXXTHGTSNARMRVINSDGS
DAPF_HELPH      --MVFYKYSGSGNDFLIVQSFKKKFSNLAKQV---CHRHEGFGADGLVVVLPSK--DYDYEWDFYNSDGS
DAPF_HELP2      --MVFYKYSGSGNDFLITQSFKKKFSNLAKQV---CHRHEGFGADGLVIVLPSK--DYDYEWDFYNSDGS
DAPF_HELPJ      --MVFYKYSGSGNDFLITQSFKKKFSNLAQQV---CHRHEGFGADGLVVVLPSK--DYDYEWDFYNSDGS
DAPF_HELPG      --MVFYKYSGSGNDFLITQSFKKKFSNLAKQV---CHRHEGFGADGLVVVLPSK--DYDYEWDFYNSDGS
DAPF_CHLMU      --------------------------------------------DGFLCVEPSEIA--DAKLTIFNSDGS
DAPF_CAMLR      ----FYKYCASGNDFVIFDSEKKDRSELA---KILCNRYEGIGADGLIVIVPHD--RYDFEWEFYNCDGS


                         .         .         *         .         .         .         .:140
query           EVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADY
DAPF_NITOC      EVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADY
DAPF_THISH      EVEQCGNGARCFAVFVRERGLTAKDHIPVETAAGIIHLQVQPDGQVTVDMGPPRLKPWQIPFEAESAMTS
DAPF_ALHEH      QAEHCGNGVRCLARFLDDRGLVPRHELVIETINGLSRVRLCDDGPVTVDMGAPVLEPPHIPFRAPSRARE
DAPF_CELJU      EVENCGNGARCFAVFVRERRLTGKRVIRVETAGGIIELRVQDDEQVSVDMGVPRLLPEKIPFVADQQAVT
DAPF_NITMU      EVEQCGNGARCFVRYVHDHGMTDKQQVRIETLSGVVIPELEADGEVTVNMGVPKFDPVEIPFIAEQRAPT
DAPF_PSEAE      EVEQCGNGARCFARFVQDKRLTVKKSIRVETKGGIIELNIRPDGQVTVDMGPPRLAPAEIPFQAEREALS
DAPF_PSEA8      EVEQCGNGARCFARFVQDKRLTVKKSIRVETKGGIIELNIRPDGQVTVDMGPPRLAPAEIPFQAEREALS
DAPF_PSEAB      EVEQCGNGARCFARFVQDKRLTVKKSIRVETKGGIIELNIRPDGQVTVDMGPPRLAPAEIPFQAEREALS
DAPF_PSEA7      EVEQCGNGARCFARFVQDKRLTVKKSIRVETKGGIIELNIRPDGQVTVDMGPPRLAPAEIPFQAEREALS
DAPF_PSEU5      EVEQCGNGARCFARFVVDKRLTVKRKIKVETKGGIIELDIRPDGQIRVDMGPPRLVPAEIPFQAEREALS
DAPF_PSEMY      EVEQCGNGARCFARFVLDKRLTTKKTIRVETKSGVIELRVQNDGQVCVNMGAPRLEPAQVPFQAEQAALT
DAPF_DECAR      EVEQCGNGARCFVRFVHDEGLTDKREIRVETMRGIISPRLEGDGNVTVDMGIPRFLPAEIPFLAEDDVII
DAPF_AZOVD      EVEQCGNGARCFARFVLDKRLTVKKRIRVETRSGVIELDVRPDGQVCVDMGPPRLEPREIPFQAENAALD
DAPF_SHEON      EVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMGVPVLEPSQIPFKAKKAEKT
DAPF_SHESR      EVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMGVPVLDPSQIPFKAKKAEKT
DAPF_SHESM      EVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMGVPVLDPSQIPFKAKKAEKT
DAPF_SHESA      EVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMGVPVLDPSQIPFKAKKAEKT
DAPF_NITEU      EVEQCGNGARCFARFVRDHDLTRKNTIRVETACGIIMPTVEENGEVSVDMGIPRFDPARIPFITQERALT
DAPF_SHEFN      EVEQCGNGARCFARFVRNKGLTQKNKIRVSTNSGKITLRIERDGNVTVNMGVPVIEPSQIPFKAKKSEKT
DAPF_PSE14      EVEQCGNGARCFARFVLDKRLTAKKQIRVETKSGIIELDIRSDGQISVDMGPPRFVPEEIPFEAAEQATR
DAPF_SHEDO      EVEQCGNGARCFARFVRNKGLTQKNKIRVSTSSGKMTLRLERDGSVVVNMGVPVTDPSNIPFKAKKVEKT
DAPF_ALCBS      EVSQCGNGARCFARFVREQGLTDKKSIRVETAAGQMTLSVTDDDQITVDMGAPRWAPDAIPMTAKAEADN
DAPF_AZOSB      EVEQCGNGARCFVRFVHDKGLTDKREIRVETRAGVIAPALRPDGLVSVDMGVPELSPARIPFVSDSDAWV
DAPF_PSEU2      EVEQCGNGARCFARFVLDKRLTAKKQIRVETKSGIIELDIRSDGQISVDMGPPRFVPEEIPFEAAEQATC
DAPF_PSEPK      EVEQCGNGARCFARFVLDKRLTAKKRIRVETKSGIIVLDVQNDGQVSVDMGPPRFIPAEIPFVADAQALN
DAPF_PSEE4      EVEQCGNGARCFARFVLDKRLTAKKRIRVETKGGIIELDVRNDGQVCVDMGPPRFVPADIPFIADEQALS
DAPF_PSEPG      EVEQCGNGARCFARFVLDKRLTAKKRIRVETKSGIIVLDVQNDGQVSVDMGPPRFIPAEIPFVADAQALS
DAPF_PSEPW      EVEQCGNGARCFARFVLDKRLTAKKRIRVETKGGIIELDVQNDGQVCVDMGPPRFIPAEIPFVADEQALN
DAPF_NITEC      EVEQCGNGARCFARFVRDYNLTDKNTIRVETARGIITPTIENNGEVSVNMGVPQFEPAEIPFQAAQRMPV
DAPF_PSESM      EVEQCGNGARCFARFVLDKRLTAKKQIRVETKGGIIELEIRSDGQISVDMGPPRLVPEEIPFQAAEQAKS
DAPF_SHEAM      EVEQCGNGARCFARFVRNKGLTQKHKIKVSTSAGKMTLRLERDGGVTVNMGVPILDPAQIPFKAKKFEKT
DAPF_SHESH      EVEQCGNGARCFARFVRNKGLTNKQKIRVSTSNGKITLRLERDGNVTVNMGIPVLEPGRIPFNAKKMEKT
DAPF_AERS4      EVEQCGNGARCFARFVRLKGLINRDRIAVSTARGRISLQLEGENQVTVNMGVPQFEPGKIPFRAQKAEKT
DAPF_TOLAT      EVQQCGNGARCFARFVRLKGLTNKDRIAVSTVSGRIVLQLEDNDQVTVNMGVPEFEPAKIPFRALKAEKL
DAPF_SHEB9      EVEQCGNGARCFARFVRNKGLTNKSKIRVSTSSGKMTLRLERDGTVTVNMGVPILEPSQIPFKAKKPEKT
DAPF_SHEB8      EVEQCGNGARCFARFVRNKGLTNKSKIRVSTSSGKMTLRLERDGTVTVNMGVPILEPSQIPFKAKKPEKT
DAPF_SHEB5      EVEQCGNGARCFARFVRNKGLTNKSKIRVSTSSGKMTLRLERDGTVTVNMGVPILEPSQIPFKAKKPEKT
DAPF_SHEB2      EVEQCGNGARCFARFVRNKGLTNKSKIRVSTSSGKMTLRLERDGTVTVNMGVPILEPSQIPFKAKKPEKT
DAPF_HAHCH      EVEQCGNGARCFARFVKENRLTNKKNIRVETKKGIIELIVNKDGLVTVDMGAPRLAPADIPFVAETQEAI
DAPF_AERHH      EVEQCGNGARCFARFVRLKGLINRDRIAVSTARGRIVLQLEGENQVTVNMGVPQFEPGKIPFRAQKAEKT
DAPF_PSEFL      EVEQCGNGARCFARFVLDKRLTAKRQIRVETKSGIIELDVRSDGQIGVNMGAPRLVPADIPFQAPAQALS
DAPF_ACIAD      EVEQCGNGVRCFARFVHERQLTKKTKIKVQTKAGIVEPELGPNGWVRVNMGYPKFMPHEIPFVTEEFEAL
DAPF_SHESW      EVEQCGNGARCFARFVRNKGLTNKNKIRVSTSSGKMTLRLERDGTVTVNMGVPILEPSLIPFKAKKPEKT
DAPF_SHEPC      EVEQCGNGARCFARFVRNKGLTNKNKIRVSTSSGKMTLRLERDGTVTVNMGVPILEPSLIPFKAKKPEKT
DAPF_PSEPF      EVEQCGNGARCFARFVLDKRLTAKRQIRVETKGGIIELDVRNDGQIGVNMGAPRLVPADIPFQAPEQALS
DAPF_PSEHT      EVEQCGNGARCFARFVRMKGLTNKHKITVSTKSGNLTLYIEKDGQVTVNMGHPNFEPSKIPLKATKRELT
DAPF_SHELP      EVEQCGNGARCFARFVKSKGLINKQKIKVSTSSGKMTLRLERDGSVTVNMGIPVLEPSRIPFNAKKAEKT
DAPF_SACD2      EVENCGNGARCFAVFVRQRGLTAKSVITVETAVGRMVLHVQEDDQVTVDMGAPILSPADIPLAAPQQATS
DAPF_CHRSD      EVENCGNGARCFARFVRDNRLTHKREIRVETQAGPLTLRVEDDERIRVDMGVPRXXXXXXXXXXXXXXXX
DAPF_METPP      EVEQCGNGARCFVRYVREAGLTKKSAIRVRTAGGVIEPRWLVDGRVTVDMGAPVFEPARVPFDAPRELNG
DAPF_HALHL      EVEHCGNGVRCLARFLVDEGLAAPGVLRIETDGRITEAEPRDDGQVSVDMGPPELEPARIPFQAPVRQEA
DAPF_AZOSE      EVEQCGNGARCFVRFVHEQGLTAKRRIRVETRSGIIAPQLEDDGLVTVDMGVPVLEPARVPFVSDSDAIV
DAPF_ACIBS      EVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMGYPKFLPNEIPFVADEPEAL
DAPF_ERWT9      EVAQCGNGARCFARFVRLKGLTNKNEIRVSTQSGRMVLSITQDELVCVNMGEPNFEPQQIPFRANKAENI
DAPF_ENTS8      EVAQCGNGARCFARFVRLKGLTNKREIRVSTANGRMVLTVNEDEQVRVNMGEPVFEPSLVPFRANKAEKT
DAPF_ACIBY      EVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMGYPKFLPNEIPFVAEEPEAL
DAPF_ACIBC      EVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMGYPKFLPNEIPFVAEEPKAL
DAPF_ACIB5      EVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMGYPKFLPNEIPFVAEEPEAL
DAPF_ACIB3      EVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMGYPKFLPNEIPFVAEEPEAL
DAPF_SHEWM      EVEQCGNGARCFARFVRNKGLTNKHKIKVSTSNGKITLRLERDGNVTVNMGVPVLDPSKIPFNAKRVEKT
DAPF_ACIBT      EVEQCGNGVRCFARFVHERHLTNKTNITVQTKAGIVKPELGQNGWVRVNMGYPKFLPNEIPFVADEPEAL
DAPF_SALTY      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALTI      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALSV      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALPK      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALPB      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALPA      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALNS      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALHS      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALDC      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_SALA4      EVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLSVTEDELVRVNMGEPNFEPAQVPFRANKAEKT
DAPF_CHRVO      EVEQCGNGARCFAKFVRDQGLTGKSRIEVETARGVIAPEYLGDGLARVDMGVPRFRPADLPFLADAEALT
DAPF_ACTSZ      EVAQCGNGARCFARFVTLKGLTNKKDIAVSTAKGRMVLTVKDDGQIRVNMGEPIWEPAKIPFNANKFEKN
DAPF_VARPS      EVEQCGNGARCFMRFVREHHLTDKDTVRVETLAGIIEPRMGADGRVTVDMGPPIFEPARVPFDTQPTGSW
DAPF_TERTT      EVENCGNGARCFAVFVRQRQLTAKSDIVVETAAGLLRLHVLDDNQVTVNMGVPVLAPAQIPFVTPHEQPE
DAPF_CUPTR      EVEHCGNGARCFVRFVTEQGMTDKRSVRVEVMNGVITLTLQDDGQVTVDMGAPELEPARVPFRAQEGADL
DAPF_MANSM      EVAQCGNGARCFARFVTLKGLTDKKDIAVSTTNGKMILTVQDDGMIRVNMGEPVWEPAKIPFIANKFEKN
DAPF_BURP8      EVEHCGNGARCFVKFVRDSRLTDKRSVRVQVQKGVITLTMQDNGEVVVDMGAPVFEPVQVPFRREGNDTL
DAPF_PSYIN      EVEQCGNGARCFARFVKMKGLTQKRIINVSTAKGKIQLKIEHDGNITVDMGKPILEPAKVPFEAQKEEKT
DAPF_DIAST      QVEQCGNGARCFARYVRDKGLTAQDTIRVQTMAGVIAPHLTADGRVTVDMGRPELEPARVPFDTQGSGQK
DAPF_VIBVY      EVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMILDVEEDDQITVNMGVPEFEPNKIPFRAKQKEKT
DAPF_VIBVU      EVEQCGNGARCFARFVRMKGLTNKYSISVSTKKGKMILDVEEDDQITVNMGVPEFEPNKIPFRAKQKEKT
DAPF_PASMU      EVSQCGNGARCFARFVTLKGLTDKKDIAVSTQTGKMILSIKDDGMIRINMGEPIWEPAKIPFTANKFEKN
DAPF_LARHH      EVEQCGNGARCFARFVFDHGLTDRREIRVETARGVIVPRLADDGLVTVDMGPPRFRPADIPFVAAEDAVI
DAPF_RALME      EVEHCGNGARCFVRFVTDRGMTDKQSVRVEVMNGVITLKLQDDGQVTVDMGEPELTPARVPFRAEAQDTL
DAPF_PHOLL      EVAQCGNGARCFARFVRLKGLINKRDIKVSTQSGRMVLSITNDDQVCVNMGEPEFEPHHVPFRALRAEKT
DAPF_COLP3      EVGQCGNGARCFAKFVRMKGLCNKHKIKVSTSTGKMNLHIERDGNISVTMPVPQFEPKKIPFTAQKTEGT
DAPF_COXBU      EVGQCGNGARCIARFIRAHQLSDREELRVSTLNEVLELKIQPDGKVSVKMGVPRFEPTEIPFIASGVANF
DAPF_COXBR      EVGQCGNGARCIARFIRAHQLSDREELRVSTLNEVLELKIQPDGKVSVKMGVPRFEPTEIPFIASGVANF
DAPF_COXBN      EVGQCGNGARCIARFIRAHQLSDREELRVSTLNEVLELKIQPDGKVSVKMGVPRFEPTEIPFIASGVANF
DAPF_COXB2      EVGQCGNGARCIARFIRAHQLSDREELRVSTLNEVLELKIQPDGKVSVKMGVPRFEPTEIPFIASGVANF
DAPF_COXB1      EVGQCGNGARCIARFIRAHQLSDREELRVSTLNEVLELKIQPDGKVSVKMGVPRFEPTEIPFIASGVANF
DAPF_ESCF3      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECOSM      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECOLU      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECOLI      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECOLC      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECOL5      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECOHS      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECODH      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECOBW      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECO8A      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECO7I      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECO5E      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECO57      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECO55      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECO45      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECO24      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_SODGM      EVAQCGNGARCFARFVRMKNLTNKRDIHVSTQTGRMVLTVTEDDSVRVNMGEPNFDPQQVLFRAARVEKT
DAPF_SHIF8      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECOL6      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKVEKT
DAPF_VIBCH      EVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVPEFEPNKIPFRAKQSEKT
DAPF_VIBC3      EVEQCGNGARCFARFVRMKGLTNKYTIHVSTKKGKMVLNVEEEDLITVNMGVPEFEPNKIPFRAKQSEKT
DAPF_HAEPS      EVSQCGNGARCFARFVTLKGLTNKQDIGVSTAKGKMVLSLQDDGQVRVNMGEPIWEPAQIPFTANKFEKN
DAPF_SERP5      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRMVLSVTDDDLVCVNMGEPNFDPQTVPFRATKEEKT
DAPF_PECCP      EVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGEPNFEPQQVPFRAVKAEKT
DAPF_ENT38      EVSQCGNGARCFARFVRLKGLTNKRDICVSTANGRMILSVTDDELVRVNMGEPNFEPSAVPFRAIKAEKT
DAPF_ECO27      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_SHIB3      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKAEKT
DAPF_ECO81      EVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMXXXXXXXXXXRVNMGEPNFEPSAVPFRANKVEKT
DAPF_ACTP7      EVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGEPIWEPAQVPFTANKFEKN
DAPF_RALSO      EVEQCGNGARCFVKFVTDRGLTDKRTIRVEVMNGISTLTMQPDGQVTVDMGAPPFVPDALPTRVEGRDTQ
DAPF_RALEJ      EVEHCGNGARCFVRFVTDKGMTDKRSVRVEVMNGVITLTLQDDGQVTVDMGAPELEPARVPFRPDGEDIA
DAPF_RALEH      EVEHCGNGARCFVRFVTDKGMTDKRSVRVEVMNGVITLTLQDDGQVTVDMGAPELEPARVPFRAEEGADL
DAPF_ACTP2      EVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGEPIWEPAQVPFTANKFEKN
DAPF_ACIAC      EVEQCGNGARCFARYVRDKGLTDRDTIRVQTLAGVIAPRLTPDGRVTVDMGRPRFDPAEVPFDASGLAXX
DAPF_HAEIN      EVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN
DAPF_HAEI8      EVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN
DAPF_ERWCT      EVAQCGNGARCFARFVRLKGLTNKRDIAVSTQTGRMVLSVTDDELVRVNMGEPNFEPQQVPFRAVKAEKT
DAPF_PHOPR      EVEQCGNGARCFARFVWMKGLTNKYQVAVSTKAGKMLLKLENDNQVTVNMGVPEFEPSKIPFRAKQTEKT
DAPF_PSEA6      EVSQCGNGARCFARFVKMKGLTNRNKIVVSTKAGRIVLYHERDGQITVNMGEPIFEPAKIPLKANKQENI
DAPF_BURXL      EVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKGTITLTMQENGEVLVDMGTPVFDPERVPFATKEGADL
DAPF_YERPY      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_YERPS      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_YERPP      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_YERPN      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_YERPG      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_YERPE      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_YERPB      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_YERPA      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_YERP3      EVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKT
DAPF_VIBPA      EVEQCGNGARCFARFVRLKGLTNKYSISVSTKKGKMILDVEDDGEVTVNMGVPEFEPNKIPFKAKQKEKT
DAPF_HAEIE      EVSQCGNGARCFARFVTLKGLTNKKDIAVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN
DAPF_ACTPJ      EVAQCGNGARCFARFVTLKGLTNKQDIHVSTAKGKMVLTLKDEEKVRVNMGEPIWEPAQVPFTANKFEKN
DAPF_LEPCP      EVEQCGNGARCFARFVRDNGLSQQVRVKVETVNSLIELHVEADGRVTVDMNQPIFEHALIPFDSGNGFEL
DAPF_HAEIG      EVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN
DAPF_HAES1      EVSQCGNGARCFARFVVLKGLTDKKEIAVSTAKGKMMLRVKDDDMVCVNMGEPIWEPNKIPFNANKFEKN
DAPF_YERE8      EVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRMILSVTEDELVCVNMGEPNFEPQSVPFRAAKAEKT
DAPF_VIBF1      EVEQCGNGARCFARFVRMKGLTNKTSISVSTKKGKMILKVEDDDQITVNMGEPVFEPNKIPFKATQAEKT
DAPF_IDILO      EVAQCGNGARCFAKFVKAKNLSNKNHLKVSTKAGKMVLHLEKDGQVTVDMGEPLFEPAAVPFKAQKAEQT
DAPF_VIBHB      EVEQCGNGARCFARFVRLKGLTNRYSISVSTKKGKMILDVEDDGEVTVNMGVPEFEPNKIPFKAKQKEKT
DAPF_RHOFD      EVEQCGNGARCFARFVRDQGLTAKDAIRVQTRGGVIEPQLNPDGRVTVNMGAPVFELAEIPFDATGLQPQ
DAPF_ALISL      EVEQCGNGARCFARFVRMKGLTNRTTILVSTKKGKMSLKVEDDDQITVNMGEPQFEPNKIPFKATQAEKT
DAPF_RALPJ      EVEHCGNGARCFVKFVTDRGLTDKRTVRVEVMNGIATLTMQDDGQVTVDMGAPPFLPEGLPTRTQGDDTQ
DAPF_PSYCK      EVEQCGNGARCFARFVQARKLSFKQRLRVETASGIISLTTDRYGWVEVDMGKPKFEPSEIPFAITKIQNA
DAPF_PSYA2      EVEQCGNGARCFARFVQARKLSFKQRLRVETASGIISLTTDHYGWVEVDMGKPKFEPSEIPFATTKIQNA
DAPF_BURPP      EVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQKGTITLTMQENGEVLVDMGTPVFDPERVPFATGEGADL
DAPF_HERAR      EVEQCGNGARAFVKFVTDKKLTDKQAIRVETMSGVIEPRLEANGQITVDMGAPILTPEDVPFDVSEGADL
DAPF_HAES2      EVSQCGNGARCFARFVVLKGLTNKKEIAVSTAKGKMMLCVKDDDMVCVNMGEPIWEPNKIPFNANKFEKN
DAPF_PSYWF      EVEQCGNGARCFARFVQARKLSFKQRIRVETKSGILTLSTDNYGWVEVDMGKPRFEPAEIPFAITKIQNA
DAPF_EDWI9      EVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNSRMTLHVGEDDRVTVNMGEPQFEPGRIPFKAAKAEKT
DAPF_LEGPC      EVGQCGNGARCIALFARYYGLTAKNKLTVATKTTLMDLIINEDNSVSVNMGVPRLAPGEIPLLADRQSPE
DAPF_LEGPA      EVGQCGNGARCIALFARYYGLTAKNKLTVATKTTLMDLIINEDNSVSVNMGVPRLAPGEIPLLADRQSPE
DAPF_LEGPH      EVGQCGNGARCIALFARYYGLTAKNKLTVATKTTLMDLIINEDNSVSVNMGVPRLAPGEIPLLADRQSPE
DAPF_HAEDU      EVAQCGNGARCFARFVSLKGLINRSDMYVSTAKGKMVLTLVDEENVRVNMGEPIWEPAKIPFIANKFEKN
DAPF_VIBSL      EVEQCGNGARCFARFVRMKGLTNKYSINVSTKKGKMVLKIEDNDLITVNMGIPEFEPGKIPFKAKQPEKT
DAPF_LEGPL      EVGQCGNGARCIALFARYYGLTAKNKLTVATKTTLMDLIINEDNSVSVNMGVPRLAPGEIPLLADRQSPE
DAPF_BURCM      EVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMKGLITLTLQDNGEVVVDMGAPVFAPAQVPFDVDGRAEL
DAPF_BURVG      EVEHCGNGARCFVKFVTDRGLTDKRSVRVQVMKGLITLTMQDNGEVVVDMGAPVFEPAQVPFRTDGNDTL
DAPF_PROMH      EVAQCGNGARCFARFVRIKGLTNKREIKVSTQSGRMTLHVMDNEDVCVNMGEPEFEPQKVPFRAQKVEKT
DAPF_BURTA      EVEHCGNGARCFVKFVRDHGLTDKASVRVEVKHGVITLTMQDNGEVVVDMGAPVFEPARVPFDTSEGADL
DAPF_BAUCH      EVTQCGNGARCLAHFVRMKKLTNKREIYISTQTSRMVLTIIENNMVRVNMGVPKFELPQIPFDMHQIEKK
DAPF_BURPS      EVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMGAPVFEPARVPFDASEGADL
DAPF_BURP0      EVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMGAPVFEPARVPFDASEGADL
DAPF_BURMS      EVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMGAPVFEPARVPFDASEGADL
DAPF_BURMA      EVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMGAPVFEPARVPFDASEGADL
DAPF_BURM9      EVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMGAPVFEPARVPFDASEGADL
DAPF_BURM7      EVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMGAPVFEPARVPFDASEGADL
DAPF_BURP6      EVEHCGNGARCFVKFVRDHGLTGKASVRVEVKHGVITLTMQDNGEVVVDMGAPVFEPARVPFDASEGADL
DAPF_NEIMB      EVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKPKFMPSEIPFVPEDDACI
DAPF_NEIMA      EVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVNMGKPRFMPSEIPFVPEDDACI
DAPF_BLOPB      EVNQCGNGMRCVAQFVCLKKLTNKRNIHISTRANHIILSIMNDNRVSVNMGAPIFDPKLIPFYISQYQKT
DAPF_VESOH      EVEQCGNGARCFARFVNYKNLTHSNPITVKTRSNIISLHLNDDNTVCVDMGKPSFNPADIPLLVPQQSEY
DAPF_RUTMC      EVEQCGNGARCFAFFVSKKGLSNNNPIVVETRSGIINLYLNDDNTVRVDMGKPSFNPADILLLVPQQSTY
DAPF_XANCP      HSQQCGNGARCVAAWLVREGTAQGDVFTIDSPFTAHRVERLDAGTYSVAMGVPQFEPTQIPLAGFAHADE
DAPF_XANCB      HSQQCGNGARCVAAWLVREGTAQGDVFTIDSPFTAHRVERLDAGTYSVAMGVPQFEPTQIPLAGFAHADE
DAPF_XANC8      HSQQCGNGARCVAAWLVREGTAQGDVFTIDSPFTAHRVERLDAGTYSVAMGVPQFEPTQIPLAGFAHADE
DAPF_BLOFL      EVYQCGNGIRCVARFVCIKKLTNKQHIKISTDTYSMMLSVLDSEFISVNMGEPIFDPIKIPFFSTQYQKM
DAPF_HALOH      EAEMCGNGIRCFAHYLRENNLTTRDVLKIETLAGIITPEIVSKSLIKVNMGRPHFKSEEIPVNIEDELDY
DAPF_SYNJA      EAEMCGNGIRCLARFLQDLGIPGQDAYQIHTLAGRIVPQVRPDGLVTVDMGIPRLLAGQIPTKPEEKVVR
DAPF_LEPBA      SSEMCGNGVRCVGKFVYDHGLTKNQKPTIETGKGVLTLDLKTGTNVTVDMGEPILKPSLVPWKGDEPVIN
DAPF_ACAM1      EPEMCGNGIRCLARFLAHKPLQTDITYRIHTLAGTITPSLQADGLVKVDMGPPFLVPQEIPTTLGEGTDN
DAPF_SYNJB      EAEMCGNGIRCLARFLQDLGIPGRDAYQIHTLAGRIVPQVRADGLVTVDMGIPRLLAKQIPVEPDEKVIR
DAPF_CARHZ      EAEMCGNAIRCVARYYVEKYNPAKKQLEVETLAGIIKPEVLENNMVRVDMGRPILKPQEIPVAVEEEPVN
DAPF_XANAC      AARQCGNGARCVAAWLVRDGTAQGERFIIDSPATAHAVERLDGDRYAVAMGVPQFEPTQIPLAGFAHADE
DAPF_BUCAP      EVEQCGNGARCVGLFLFLKGLINKRKIMLSTNKKNISIKFMSDNNIQVNMNEPSFKLEEISISKKIVLNN
DAPF_CYAP4      EPEMCGNGIRCLARFAADHALTATPRYRIHTLAGTITPQVRSDGQVTVDMGQPRLLAGEIPTTLKPAAEK
DAPF2_ANASP     EPEMCGNGIRCLAAFLADEGLSNKDTYRIHTLAGVITPQLTPDGQIKVDMGLPRLLAGEIPTTLDGKVIN
DAPF_XANC5      AARQCGNGARCVAAWLVRDGTAQGERFIIDSPMSAHAVERLDGDRYAVAMGVPQFEPAQIPLAGFAHADE
DAPF_HELMI      EPEMCGNGIRCLARYVYERGIVAKRRIEVETLAGIIVPEIITDGAVTVDMGEPRLQRHQIPM-VGPEGPA
DAPF_CLOTH      EAEMCGNAIRCVGKYVFDRGMTNKNVIRVETLAGIKVLELTVDGKVKVDMGEPILKPENIPVNSDKEIFR
DAPF_TRIEI      EPEMCGNGIRCLAKFIAELENNNKTKYNIHTGAGIIVPELQGDGQVTVDMGQPRLLASEIPANADDKVVD
DAPF_LEPBL      SSEMCGNGIRCVAKYIYDHGLTNSKNPKIETGAGVLEVDLKIGSGVSVNMGKPILVPSKIPVNKDEEAII
DAPF_LEPBJ      SSEMCGNGIRCVAKYIYDHGLTNSKNPKIETGAGVLEVDLKIGSGVSVNMGKPILVPSKIPVNKDEEAII
DAPF_NOSP7      EPEMCGNGIRCLAGFLADEGQSNKDSYRIHTLGGVMTPQLLSDGLVKVDMGLPRLLAGEIPTTVEEKVIS
DAPF_XYLFM      AAQQCGNGARCVAAWVRDGSLADEHFL-IDSPVQAHSVRCIGKDEYAVEMGLPVFEPERIPLSFPNACAE
DAPF_LEPIC      SSEMCGNGIRCVAKYIYDHGLTSSKNPKIETGAGILEVDLKIGSGVSVDMGKPVLVPSQIPWKNEETIID
DAPF_XANOM      AARQCGNGARCVAAWLVRDGIAQCERFIIDSPVTAHAVERLEGGRYAVAMGMPQFDPPQIPLAGFAHADE
DAPF_SYNP6      EPEMCGNGIRCLAKFLSELDGGAQSRYRIATGAGLIVPTLTETGLVTVDMGPAYLKPVEIPTTLTGTGDR
DAPF_SYNE7      EPEMCGNGIRCLAKFLSELDGGAQSRYRIATGAGLIVPTLTETGLVTVDMGPAYLKPVEIPTTLTGTGDR
DAPF_MICAN      EPEMCGNGIRCLAQFIAEANNAIGRTYRIHTLAGTIIPRLEANEQVTVDMGPPQLLGSEIPVKGSEKVLA
DAPF_DESHD      EPEMCGNGIRCFARYIYDQGYVSQNPLQVETLAGILTLQLSITGDVRVDMGEPILKSEQVPVLIQGDPVV
DAPF_RHOCS      ESGACGNATRCVASLVADG--SGRAEVTVETATGLLRCRLRADGSVTVDMGPARLDWTQIPL----AAAH
DAPF_ORYSJ      EPEMCGNGVRCFARFIAEENLQGTHSFKIHTGAGLIIPEIQNDGKVKVDMGQPILSGPDIPTKLNEAVVQ
DAPF_ORYSI      EPEMCGNGVRCFARFIAEENLQGTHSFKIHTGAGLIIPEIQNDGKVKVDMGQPILSGPDIPTKLNEAVVQ
DAPF_MAGSM      RAEMCGNAMRCVGLYLHEQGMAA--ALAVETLAGIMRPQVTSALAITVDMGRPQWAGRAIPLDQDGEMID
DAPF_LEPIN      SSEMCGNGIRCVAKYIYDHGLTSSKNPKIETGAGILEVDLKIGSGVSVDMGKPVLVPSQIPWKNEETIID
DAPF_XYLFA      AAQQCGNGARCVAAWVRDGSVADEHFLIDSPVQAHLVRCIGKD-EYAVEMGLPVFEPERIPLSFPNACGE
DAPF_XYLFT      AAQQCGNGARCVAAWLVRDGSVATEHFLIDSPVQTHSVRCIGKDEYAVEMGLPVFEPERIPLSGFPNAGE
DAPF_XYLF2      AAQQCGNGARCVAAWLVRDGSVATEHFLIDSPVQTHSVRCIGKDEYAVEMGLPVFEPERIPLSGFPNAGE
DAPF_CYAP8      EPQMCGNGIRCLARFIAEGGETLGKTYQIDTLAGVISPRLEAQGQVKVDMGTPYLLAKEIPTTLGNSNDK
DAPF_BUCAI      EVEQCGNGARCFGLFLLLKGXXXXXXXXXXXXXXXXXXEFLTENMIKVNMNEPDFKFYNLSSLQNVLDNN
DAPF_SYNY3      EPEMCGNGIRCLAKFLADLEGVEEKTYRIHTLAGVITPQLLADGQVKVDMGEPQLLAELIPTTLGEKVVD
DAPF_DESDA      ESEMCGNAVRCVGKYVYDHGIQVKDVITVETRAGIVRLLFEA-GKVTVDMGEPELHPARIPVLTETSGDG
DAPF_BUCA5      EVEQCGNGARCFGLFLLLKGXXXXXXXXXXXXXXXXXXEFLTENMIKVNMNEPDFKFYNLSSLQNVLDNN
DAPF_SYNP2      EPEMCGNGIRCLARFIDEGGNAPGKTYSIHTLAGMIRPRLETDALVRVDMGEPILTATDIPTTLKDQAVN
DAPF_GRABC      ESGACGNATRCVADLLHRDGIAAPCM---ETVAGLLLAEINGNG-ICIDMGQPGLGWRDVPLAREMDTLF
DAPF_BUCAT      EVEQCGNGARCFGLFLLLKGXXXXXXXXXXXXXXXXXXEFLTENMIKVNMNEPDFKFYNLSSLQNVLDNN
DAPF_ARATH      EPEMCGNGVRCFARFIAEENLQGKHSFTIHTGAGLIVPEIQDDGQVKVDMGTPILKAQDVPTKLSEAVVE
DAPF_THEEB      VAQMCGNGIRCLAKFIFAEGRSAGEIVRIDTLAGLIVPEVQADGQVTVDMGKPRLLAQQIPTTLDQKVVD
DAPF_GLUOX      EAGACGNASRCVAKFV-------GGAPTLQTAAGLLPTAQDGD-LFTVDMGTPRLDWQDVP--LSRACDT
DAPF_CYAP7      EPEMCGNGIRCLAQFIAELEKTTEKSYRIDTLGGLMTPRLEAQEQVTVDMGLPRLLGSEIPTTLVSRTEK
DAPF_METTH      EAEMCGNGIRCFSKFVYDNAIVRKRRLEVETLAGIKTVELEVDGAVVVDMGTATFKTDQIPMDVEEEFID
DAPF_SPHWW      EVEACGNATRCVVSLLGGSA-------RIETVAGLLEGR-SADGQVSVELGEPRFDWDAIPLAYAM--DT
DAPF_METM6      EAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGILEMTIENDKLVKVDMGEPILKAETIPV-LSEKHPV
DAPF_METMP      EAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVLEMTIENGVKVDMGEPILKAEEIPV-LSEKHPV
DAPF_METM7      EAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGILEMTVENDKLVKVDMGEPILKAETIPV-LSEKHPV
DAPF_PELTS      EAEMCGNAIRCVAKYLYERGMVKADRIRVETLAGVMXXXXXXXXXXXXDMGEPRLERSEIPMEGPPGRVL
DAPF_BACV8      EAMMCGNASRCIGKYVYEKGLTDKEVITLETLSGIKILKLHTGNDVTVDMGTPLLSPGQIATKTGGML-A
DAPF_PHEZH      EVGACGNGTRCVGWLLMQSSGKDEAV--IETRAGRLVATRAGERLVSVDMGPPRLEWNEIPLAEPHDTRY
DAPF_METM5      EAEMCGNAIRCVGKFVYDKKMTDKSTISIETLAGIKVLEMTVENLVKVDMGEPILKAETIPV-LSEKHPV
DAPF_SPHAL      EVEACGNATRCVATLIGKPAV-------IETLAGMLRV-TPADGGAEVTLGEPVFDWDHIPLAMPM--DT
DAPF_DESAP      EPEMCGNAIRCVALYARRRGLVAKTQLEVETLAGLIRPEILLDGDVRVDMGRPRLERAEIPMRGPAGPVV
DAPF_ERYLH      EVEACGNASRAVA-------LLHGEAANVETSGGVIAIA-PASGGARVDMGVPRFDWEAIPLAYAM--DT
DAPF_PROMM      LAEMCGNGIRCLTRFLADEGDLCVQRWNIETLAGIICPVLQEDGQICVDMGTPFLDPESIPTTLSAGLPQ
DAPF_ELUMP      EPEMCGNGIRCAMRFVFDY-IKPQRKLTFETLAGPIKTELLAENLVKVDMGAPKLTAAQIPLNIDGRAVD
DAPF_BACFR      EAMMCGNASRCIGKYLYEYGLTSKNVITLDTLSGIKILELHLEGRVTVDMGVP------------LETD-
DAPF_DESAH      EPEMCGNGMRCFAKLVFEQGIVTKQRFTVETLAGTIEILLSDTRQICVDMGEPILEPDRIPFKCNQRAVN
DAPF_OCEIH      EGKSCGNGLRCTAKYAYENGIVTNKKFHIQTKANIVEAEVSVDNQVTIDMGEPILARNEIPMMGNNDVKV
DAPF_BUCBP      EVSQCGNGARCFALFVXXXXXXXXXXXYXXXXXXXXXXXXXXXXXXXXDMGVPCFKLKNIFGENIIENSL
DAPF_PROM1      EPEMCGNGIRCLIAFLNDNNINELSEIPIETKAGLILTSIDCNENIKVNMGEPILSPLDIPTKLSLKVPN
DAPF_DESRM      EAEMCGNAIRCVAKYLYDHGIIKKDEIKVETLAGIIVPQIQQEGSVKVDMGEPRVERAEIPM-IGPPGQV
DAPF_MOOTA      EPEMCGNGIRCFARYVYETGLAEGEELQVETLAGIIKPRLILEGGVRVDMGAPHLEREQIPMATGSPVLD
DAPF_GEOTN      EGKNCGNGLRCVAKYAYEHGIVRDRSFLIETLSGLVEAEVTVENSVTIDMGEPRLRRSAIPM-TGPEAEQ
DAPF_PROMT      EPEMCGNGIRCLIAFLNDNNINELSEIPIETKAGLILTYIDGNENIKVNMGEPILSPLDIPTKLSLKVPN
DAPF_BACCN      EGKSCGNGLRCVAKYAYEHKLVEETIFTIETLAGIVTAEVTVENDIVIDMGAPRLTRAELPMLGEGETPF
DAPF_EUBR3      EAEMCGNGIRCVAKYVYDHKLTDKTEISVETGAGIKYLTLYVESQVRVDMGEPILTPGDIPVKADGSADY
DAPF_ZYMMO      EVEACGNATRCVPVFLGRDVI-------ISTAAGLLDARLSDEG-ACVDMGRPRLSWDEIP--LAYAMDT
DAPF_RHOPT      ESGACGNGMRCVARQMFAG--SDKNGLTFETRAGLLNCRGPADGLYTVDMGEPKFGWQDIPL-AEEFRDT
DAPF_CAUSK      ETGACGNGTRCVAWLLMQSG--QKDSVAFDTVAGRLSGKMAGDKLVTVDMGQPGLAWNQIP--LAEEMDT
DAPF_BACCR      EGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVDGVVTIDMGAPRLTRAEIPMLGESETPF
DAPF_BACC1      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACC4      EGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVDGVVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_ALKMQ      EAGMCGNGIRCFAKFVYDEGLVKKEIFTVETLSGVKELQVEKVSSVRVNMGKMVLDPKQIP--VNSEGLQ
DAPF_RHOPS      EAGACGNGMRCVARQMFAS--TDKQGLTFETRAGLLNCRGPADGLYTVDMGEPKFGWKDIPL-AEEFRDT
DAPF_PARD8      EAMMCGNASRCIGKYVYEAGLTQKNKVTLETLSGIKELQLKIETEVTVDMGMP--AVGEMALEVEAGGEI
DAPF_BACCZ      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACC2      EGKSCGNGLRCVAKYAYEHKLVEETVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACAN      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACAC      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACAA      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACWK      EGKSCGNGLRCVAKYAYEHKLVEGKVFTIETLAGIVTAEVTVDDKVTIDMGAPRLTREEIPMLGEGETPF
DAPF_BACHK      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACC7      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACC3      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_BACC0      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_THETN      EAEMCGNGSRCFAKYVYEKGIVSKQKMTVETLAGVIMPELFVENSVKVYMGSPIFESSKIPVKSEQKFID
DAPF_CAUCR      VAGACGNGTRCVAWLLMQSA--GKDAVAFDTVAGRLSGVAAGDKLVTVDMGPPGLDWTQIPLAEEMNTER
DAPF_CAUCN      VAGACGNGTRCVAWLLMQSA--GKDAVAFDTVAGRLSGVAAGDKLVTVDMGPPGLDWTQIPLAEEMNTER
DAPF_BACAH      EGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEGKVTIDMGAPRLTRAEIPMLGEGETPF
DAPF_RHOPA      ESGACGNGMRCVARQMFSG--SEKNGLTFETRAGLLNCRGPADGLYTVDMGEPKFGWQDIPL-AEEFRDT
DAPF_RHOP2      ESGACGNGMRCVARQLFAG--SDQQGLTFETRAGLLNCRGPAEGLFTVDMGAPKFGWQDIPL-AEEFRDT
DAPF_BRAJA      EAGACGNGMRCVVRRIFEK--TGQATATFETAAGLLNAQGPAPDLYTVDMGVPKFGWQDIPLAEERDTRY
DAPF_BACP2      EGKNCGNGLRCVAKYVYEHQIVTDTTFQIETLSGLVEATVHVQDDVTVDMGKPRFEKEAMPMTINEPLDF
DAPF_BACA2      EGKNCGNGLRCVAKYAYEHKLTEETSFFIETLSGLVKADITEDNEVAVDMGEPRLTKKELPMTIDETFVF
DAPF_GEOSW      EGKNCGNGLRCVAKYAYEHGMVKDRSFFIETLSGLVKAEVTVENNVTIDMGKPRLKRSEIPM-IGLDAER
DAPF_BACHD      EAKNCGNGLRCVAKFAFEHGYVKETSFDVETLGGLVKATVHPNDNVTVNMGEPRLGRAQIPMLGEEAAEV
DAPF_BACSU      EGKNCGNGLRCVAKYAYEHKLVEETSFLIETLSGLVKAEVQVENGVTVDMGEPRLTKSELPMLDGGEEHT
DAPF_RHOS4      RSGTCGNATRCVSDYLRDLGRDEVNLV---TARGRLHARRREDGLVAVNMGAPQLLWSEIPLARAMETD-
DAPF_RHOPB      ESSACGNGMRCVARQVFATSASD--ALTFETRAGLLNCWRPAPNLYTVDMGPPKLGWKDIPL-AEEFRDT
DAPF_BACLD      EGKNCGNGLRCVAKYAYEHKLVEETSFLIETLSGLVKAQVEVDGKVTVDMGEPRLLKSDMPMRGEQGSET
DAPF_GEOKA      EGKNCGNGLRCVAKYAYEHGIVSDRTFLIETLSGLVEARVAVDGEVTVDMGEPRLERSAIPM-LGPEAER
DAPF_WOLWR      KAEMCGNAARCVGYLLMSEKGTEYITIELVNKR-ILECFKVGDKSIKVNMGKPLLKWHKIPLSTECDTLH
DAPF_AZOPC      EAQMCGNAIRCVGKYVYDNGYTRKLNITIETLAGVKQLELDKIRKVKVNMGKPILLAKDIPVIWEKEKLI
DAPF_ARCFU      EAAMCGNGIRCFSRYVVEEGYAGER-LRVETLAGILELEVENGWWVKVDMGKPKFGREEIPAKTDVWG--
DAPF_BACTN      EAMMCGNGSRCVGKYVYEYGLTAKKEITLDTRSGIKVLKLHVEGAVTVDMGSP----------LETEAVD
DAPF_ACICJ      ESGACGNATRCVAALLA--GETGARRLTIRTNAGLLPAEIKGPTLVEVDMGAPKLGWEDIPLA--EPADT
DAPF_WOLTR      EVEMCGNAARCVGYLIMSEKSTEYATIELVNKR-ILECFKVGGRSIKVNMGKPLFKWHEIPLSAKCDPLH
DAPF1_ANASP     EAEKSGNGLRIFSRYLWDMGLVDEKPFSIETAGGIVESAIKDAGKVQVEMGKVSFWSRDIPIGDDREVIQ
DAPF_METJA      EAEMCGNGIRCFSKYVYER-IMKKNPLKVETKGGLRVSEMEIEGKIKVYMGVPKFKLKDIPMVVDEDDEF
DAPF_NITHX      EANACGNGMRCVARQVFEA--TGKAALTFETRAGLLSCQGPAPGLYTVDMGPPKFGWRDIPLAEERDTRY
DAPF_RHOP5      ESNACGNGMRCVAKQVFSG--TDASALAFESRAGLLQCWRGAAPDITVDMGVPKFGWQDIPL-AEEFRDT
DAPF_BRASB      ESGACGNGMRCVVRQVFEK--TGQASATFETRAGLLNCQGPAPDLYTVDMGVPKFGWQEIPLAEERDTRY
DAPF_BEII9      LAGACGNGTRCVAWTLLREDHRIGAELMLETAAGQLACLKLAEDRFSVDMGKPAFAWDAIPLAVDLARDL
DAPF_BRUME      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BRUSU      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BRUSI      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BRUO2      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BRUMB      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BRUC2      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BRUAB      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BRUA2      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BRUA1      QAQACGNGTRCVVQALAAE--TGRHAFTFETRAGILTATEHDDGLISVDMGTPRFDWQDIPL-AQAVADT
DAPF_BARQU      MAKACGNGTRCVIAWLTDHNLGES--FRLETPAGIIEGKRQTDNLISVDMGCPNFNAKEMPVSREIADTN
DAPF_BRASO      ESGACGNGMRCVVSQVF--GKTGQTSATFETRAGLLNCQGPAPDLYTVDMGVPRFGWQDIPLAEERDTRY
DAPF_UNCMA      EAEMCGNGIRCFVKYAVDNGHMNPGKDKVETKAGILEVEAREDGKVKVSMGKPLFDPKKIP--AAGLNNF
DAPF_BARBK      MAKACGNGTRCVIEWLANHNLG--NNFRLETSTGIVEGKRQTDGLISVDMGRPYLNAKDMP--VSREI--
DAPF_METC4      ESGACGNGTRCVGYALLDDPAAENGALTLETKAGLVAVKRITERSFTVDMGQPRLRWDEIPL-TEPFLDT
DAPF_OLICO      EAGACGNGMRCVAK--RVFGESGAQAATFETRAGLLNCQGPSPDLYTVDMGTPKFGWQDIPLAEERDTRY
DAPF_CLOPE      YAAMCGNGIRCFAKYVYEKGIVKKDVLDVLTGDGVIFLEIENDKTINVNMGFGDFKPKNIPALCDEEIIE
DAPF_METEP      ESGACGNGTRCVGYALLDDPAAENGALTLETKAGLVAVKRITERSFTVDMGQPRLRWDEIPL-AEPFLDT
DAPF_META3      EAEMCGNGIRCFSKFVYER-VMQKNPLNVETMGGVSEMNIENNKSIKVFMGAPTFELKDIPMVVEGKSE-
DAPF_METS4      ESGACGNGTRCVAWAMRADPVMGREQLTLESAAGLLAVTRVSDTDFTVDMGPPHLRWDEIPLS-EPFPDT
DAPF_RHILW      KAQACGNGTRCVVQALAAE--TGRKAFTFQTVAGILNAVEHEDGTISVDMGRPVFDWNRIPL-AEEFHDT
DAPF_AGRRK      KAQACGNGTRCVVQALAAE--TGKKVFTFQTVAGILNAVEHEDGTISVDMGRPVFDWDKIPL-AEEFADT
DAPF_METNO      ESGACGNGTRCVAWAMLEDPVMGRPALTLQSRAGLLAVTRVSATDFTVDMGPPRLRWDEIPL-AEPFPDT
DAPF_BRAHW      ESEMCGNGIRCVAKYAYDRGISKNNPMKIETLRGILEAELEEVDTVEISMSSPXXXXXNEPIIFNDKTYY
DAPF_BARHE      MANACGNGTRCVIAW-----LTDHNIFRLETPAGIVEGKRQIDNLISVDMGCPNFNAKEMP--VSREI--
DAPF_OCHA4      EAQACGNGTRCVVQALAAE--TGRQAFTFETRAGILTATEHEDGLISVDMGKPRFDWQDIPL-AEEFRDT
DAPF_METSB      QSAACGNGTRCVAWTLLKDGARDEVLL--ETAAGRLACRRVSELVFSVEMGRPRLKAAEIPLSRDAP-DT
DAPF_BART1      KAKACGNGTRCVIAWLTDHNFGEN--FRLEAPTGIIEGKRQADNLISVDMGCPNFNAKEMP--VSREVDT
DAPF_METTP      EAEMCGNGIRCLAKHAWESGYVGER-FSVETLAGVIPIQVRRDRKARVEMGIPRFERSEIP--ADGEGTF
DAPF_ALKOO      IAAMCGNGIRCFSKFVFDEGFLRTKQFSVETLDGXXXXXXXTVKSVEVNMGQVTYDTEKIP--VVSEDGY
DAPF_AGRT5      KAQACGNGTRCVVQALSSE--TGKTSFTFQTVAGILNAVEHEDGMISVDMGLPRFRWSDIPLS-EEFHDT
DAPF_METPB      ESGACGNGTRCVGYALLDDPAAENGCLTLETKAGLVAVKRVTDRSFTVDMGQPRLRWDEIPL-AEPFPDT
DAPF_RHIEC      KAQACGNGTRCVVQALAAE--TGRKAFTFQTVAGILNAIEHEDGTISVDMGKPVFDWDRIPL-AEEFHDT
DAPF_RHILO      SAQACGNGMRCVVQALAAE--TGQKTFTFETRAGILNAREHADGTISVDMGMPHFGWQEIPL-AEEFRDT
DAPF_PELUB      ISGACGNGTRCVADLLSKE--SGKKEITLLTTSGSLKSKILGNNLVETEIGIPKVNWQEIPLSKQLDTQD
DAPF_MESSB      VAQACGNGMRCVVQRLAAE--TGRPSFTFETIAGVLSAEEHANGLISVDMGKPRFGWQDIPL-AEEFHDT
DAPF_NATTJ      EAEMCGNAIRCLAKYLAKTEETDGKRLAIATTAGIKRVEISQEQLVKVNMEKPLLKSSDIPLAVKNDARQ
DAPF_RHIME      MAQACGNGTRCVVQALAAE--TGRKAFLFHTVAGLLEAKEHDNGTISVDMGKPRFGWDQIPL-AEEFHDT
DAPF_THEFY      VAEMCGNGVRVFARYLQEAGLVGAAAFEVGTRAGARHVVLEPDGNITVDMGPVRILGPG-----------
DAPF_AQUAE      VAEMCGNGSRCAVRFAYERGIVG-NKVRFETLAGVIKAEVYENGRKVKVQLTPPSKPEE-----------
DAPF_LEIXX      AAEMCGNGIRVYVRYLIESQLADGDTLPIGTRSGVRDVQRTLSG-FQVDLGRWRLA--------GGEPLV
DAPF_CORGL      LAEMCGNGVRLFAHWLYSRGLVDNTSFDIGTRAGVRHVDIQHSAQVRVDMGIP------------DVTGL
DAPF_CLAM3      PAEMCGNGIRVFTLFLIENGLIEGRTIPIGTRAGVRDVQRSGSG-FQVDLGRWELA--------GGEPLV
DAPF_AGRVS      LAQACGNGTRCVVQALSAE--TGLKAFTFQTLAGILNAVEHDDRTVSVDMGSPVFDWNRIPLS-EEFHDT
DAPF_CORGB      LAEMCGNGVRLFAHWLYSRSLVDNTSFDIGTRAGVRHVDIQHSAQVRVDMGIP------------DVTGL
DAPF_MYCA9      IAEMCGNGVRVFAHYLRSVGLEHRDEFVVASLAGPRPVRINSWSQLTADVTV-----DMGPVK---EFGA
DAPF_MYCMM      TAQMCGNGVRVFAHYLRASGLETRDEFVVGSLAGTVHHADQTHADVTVDMGANKLGPGE-----------
DAPF_MYCUA      TAQMCGNGVRVFAHYLRASGLETRDEFVVGSLAGTVHHADQTHADVTVDMGANKLGPGE-----------
DAPF_RICBR      SAKLCGNATRCLAKLIYLD--TGKKDITVVVGNKKLLCHVIDENNISVNVGGVSFNESWMPSKIWEFAER
DAPF_RICB8      SAKLCGNATRCLAKLIYLD--TGKKDITVVVGNKKLLCHVIDENNISVNVGGVSFNESWMPSKIWEFAER
DAPF_HYDS0      AAEMCGNGSRCAARFAYEKDIAPKDIV-FETIAGEIEAHIMDSKRVKVQL--TPYHSHQKNIEIKTEYGT
DAPF_RICPU      SAKLCGNATRCLAKLIYLD--TGKQDITVMVGNKKLLCNVNDENNISVNVGSVSFNEAWMPSKVWEFAER
DAPF_RICCN      SAKLCGNATRCLAKLIYLD--TGKQDITVMVGNKKLLCNVNDENNISVNVGSVSFNEAWMPSKVWEFAER
DAPF_RICAE      SAKLCGNATRCLAKLIYLD--TGKQDITVMVGNKKLLCNVNDENNISVNVGSVSFNEAWMPDKVWEFAER
DAPF_CLAMS      PAEMCGNGIRVFTLFLIENGLIEGRTVPIGTRAGVRDVQRSGSG-FQVDLG--RWA------LAGGEPLV
DAPF_RICRS      SAKLCGNATRCLAKLIYLD--TGKQDITVMVGNKKLLCNVNDENNISVNVGSVSFNEAWMPSKVWEFAER
DAPF_RICRO      SAKLCGNATRCLAKLIYLD--TGKQDITVMVGNKKLLCNVNDENNISVNVGSVSFNEAWMPSKVWEFAER
DAPF_RHOSR      IAEMCGNGVRVFAHYLRAAGLESRDEFVVGSRAGIVHSADGAFGEVTVDMGVVR------------DLGT
DAPF_RICFE      SAKLCGNATRCLAKLIYLD--TGKKDITVMVGNKKLLCNVEDENNISVNVGKVSFNEVWMPSKIWELAER
DAPF_RHOOB      IAEMCGNGVRVFAHYLRSTGLETRDEFVVGSRAGIVHSADGSAGEVTVDMGVVR------------DLGT
DAPF_CHLTE      PGTMCGNGGRCAVWFAHLIGITGKH-YRFEAGPSTYEAEVTGEESVRLHMLPPS------DFRDGLQAGA
DAPF_RICAH      SAKLCGNATRCLAKLIYLD--TGKKDITVMVCNKKLLCNVEDENNISVNVGSVSFNEAWMPSKIWELAER
DAPF_STRCO      VAEMCGNGVRVFARYLQHAGHVTEGDLAVATRGGVKTVHIAKNGDVTVGMGRALLPAGDVEVSVGE----
DAPF_RICPR      SAKLCGNAIRCLAKLIYLD--TGKQNITVMVGKKKLLCNVKAANKISVNVGNVSFNETWMPSKIWKFAER
DAPF_RICCK      SAKLCGNATRCLAKLIYLD--TGKKDITIVVGNKELLCRIEDENKISVNVGAVSFNETWMPSKIWAFAAR
DAPF_CORA7      VAEMCGNGTRVFAHWVRSRGLLEEDTFTVGTRAGAKQVTVETEAEVSVEMG-----PAQV-------LGV
DAPF_CLOAB      EAEMCGNGLRCVGRYVIE--MLNKESVEIETLKSKYWVKLQEDKTVKIDIKSVSLDVKTLPLNYKKEKLI
DAPF_WIGBR      ESFQCINGIRCVFMFXXXXXXXXXNIAFIGNNLGLSKTLMTKNKLICVKIKPPRFYIEKLVNPKYNNKEK
DAPF_RICM5      SAKLCGNATRCLAKLIYLD--TGKKDITVMVGNKKLLCNVNDENNISVNVGSVSFNEAWMPSKVWAFAER
DAPF_MYCLE      VAQMCGNGVRVFAHYLRASGLESCDEFVVGSLAGPRLVNVELNADVTVDMGKANL--------LGSGGPA
DAPF_MYCLB      VAQMCGNGVRVFAHYLRASGLESCDEFVVGSLAGPRLVNVELNADVTVDMGKANL--------LGSGGPA
DAPF_RICTY      NAKLCGNATRCLAKLIYLD--TGKKDITIMVGKKKLLCNVEAANKISVNVGNVSFNETWMPSRIWAFAER
DAPF_LISMF      IASMCGNGLRTVARYLLEKALTD---AKVETMKAILDVKKATSPTYQVEISPVKFAAETLPMHVGVEKLF
DAPF_LISMC      IASMCGNGLRTVARYLLEKALTD---AKVETMKAILDVKKATSPTYQVEISPVKFAAETLPMHVGVEKLF
DAPF_GEMAT      AADLCGNATLCSTAISAQWGITSASGMRLATGAGLINSRID---------GLPAIALQPI---TDIRPDM
DAPF_MYCPA      VAQMCGNGVRVFAHYLRASGLETRDEFVVGSLAGTVHAADATGADVSVDMGKAN--------TLGGGGEA
DAPF_LISMH      IASMCGNGLRTVARYLLEKALTE---AKVETMKAILDVKKATSPTYQVEISPVKFAAETLPMHVGVEKLF
DAPF_LISW6      IASMCGNGLRTVARYLLEKALTD---AKVETMKAILDVRKATSPTYQVEISPVKFNPESLPMYVGVEKLF
DAPF_CHLPN      RPTMCGNGLRCIAHLASQKGKSD---ISVSTDSGLYSGYFYSWDRVLVDMTL-----------ADWRASV
DAPF_MYCSK      IAQMCGNGVRVFAHYLRAADLESRDEFVVGSLAGPFDLAHRSRAEVTVEMG-----------KVNLLGS-
DAPF_MYCSJ      IAQMCGNGVRVFAHYLRAADLESRDEFVVGSLAGPFDLAHRSRAEVTVEMG-----------KVNLLGS-
DAPF_METKA      EAEFCGNAARCVVKYVTE--VRGENVKILRTLSGAHRVEVQ-GGWIAVEV---------------PEAEI
DAPF_MYCA1      VAQMCGNGVRVFAHYLRASGLETRDEFVVGSLAGTVHAADATGADVSVDMGKAN--------TLGSGGKA
DAPF_ACIC1      VAEICGNGIRLFARYLVDAGLEEAGRFLVGTRIXXXXXXXXXXXXXTAWLPAPELRGGG-----------
DAPF_COREF      LAEMCGNGVRVFAHWLAAHQLVDTTDFTIGTRAGA--------RSVTVLSXXXXXXXXXXXMGPAAVTGI
DAPF_MYCS2      IAQMCGNGVRVFAHYLRASGLESADEFVVGSLAGPRPVVLHTTAEVTVEMG-----------KANQ-FGA
DAPF_FLAPJ      QSTMCGNGGRCLVAFAKKLNII-KNKTTFIAIDGLHHATINENDIISLQM------------KNVEEVNI
DAPF_LACPL      EASMCGNGLRTVARYLGTQ--NSQEDFRVQTMYADLKVQAVADPAYSVEISPVTFDAQTLGMHANNDATT
DAPF_LISMO      IASMCGNGLRTVARYLLEKALTE---AKVETMKAILDVKKATSPTYQVEISPVKFNAESLPMNVGVEKLF
DAPF_MYCTU      AAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHAYADVSVDMG-----------KANRLGAG
DAPF_MYCTA      AAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHAYADVSVDMG-----------KANRLGAG
DAPF_MYCBT      AAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHAYADVSVDMG-----------KANRLGAG
DAPF_MYCBP      AAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHAYADVSVDMG-----------KANRLGAG
DAPF_MYCBO      AAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHAYADVSVDMG-----------KANRLGAG
DAPF_LISIN      IASMCGNGLRTVARYLLEKALTE---AKVETMKAILDVKKATSPTYQVEISPVKFNAESLPMNVGVEKLF
DAPF_NITSB      EAEMCGNGSRAAAHYAYSYGLASKQ-MRFLTLAGVIEASVEAD---------------------------
DAPF_LACS1      EASMCGNGIRTVARYLSEK----KNLAEFKIQTMHADLEVKKADKLAEK--VPAFDAEISPVSFDAQIDD
DAPF_CHLTR      IASMCGNGLRCAMAHVAQCGLED---VSIETERGVYQGKFFSMNRVLVDMTLPDWK------KAERKLTH
DAPF_CHLTB      IASMCGNGLRCAMAHVAQCGLED---VSIETERGVYQGKFFSMNRVLVDMTLPDWK------KAERKLTH
DAPF_CHLTA      IASMCGNGLRCAMAHVAQCGLED---VSIETERGVYQGKFFSMNRVLVDMTLPDWK------KAERKLTH
DAPF_CHLT2      IASMCGNGLRCAMAHVAQCGLED---VSIETERGVYQGKFFSMNRVLVDMTLPDWK------KAERKLTH
DAPF_MYCVP      IAQMCGNGVRVFAHYLRASGLESRDEFVVGSLAGVLNALAGVGADVTVEMG-----------KANQ-LGV
DAPF_CAMJ8      RAAMCGNGSRAAAHFVHHINKINPN-MSFLTGAGVIKAKVNQD-KVEVSLGKIKSVQN------------
DAPF_CAMJD      RAAMCGNGSRAAAHFAHHINKINPSMIFL-TGAGVIKAKVNQD-KVEVSLGKIKSVQN------------
DAPF_CAMJE      RAAMCGNGSRAAAHFAHHINKINPN-MSFLTGAGIIKAKVNQD-KVEVSLGKIKSVQN------------
DAPF_CAMJJ      RAAMCGNGSRAAAHFAHHINKINPN-MSFLTGAGVIKAKVNQD-KVEVSLGKIKSVQN------------
DAPF_CAMJR      RAAMCGNGSRAAAHFAHHINKINPN-MSFLTGAGIIKAKVNQD-KVEVSLGKIKSVQN------------
DAPF_MYCGI      IAEMCGNGVRVFAHYLHAGGLEHRSEFVVGSLAGVLHEADDTTADVTVEMGKA------------VRCGT
DAPF_HELPY      KAGMCGNASRCVGLFAYQHAIASKN---------------------------------------------
DAPF_HELPS      KAGMCGNASRCVGLFAYQHAIASKN---------------------------------------------
DAPF_RHOE4      IAEMCGNGVRVFAHYLKASGLESKDEFVVGSRAGVVHGYDATHGDVTVAMG---------PIK---DLGT
DAPF_ENTFA      EASMCGNGLRTVARYLAEK--NQEKSFTVETMFADLKVRAEEVATYQVEISPVSFEAVTIPMHLGQTLID
DAPF_HELPH      KAGMCGNASRCVGLFAYQHAIAPK----------------------------------------------
DAPF_HELP2      KAGMCGNASRCVGLFAYQHAIAPK----------------------------------------------
DAPF_HELPJ      KAGMCGNASRCVGLFAYQHAIAPK----------------------------------------------
DAPF_HELPG      KAGMCGNASRCVGLFAYQHAIAPK----------------------------------------------
DAPF_CHLMU      EASMCGNGLRCMAHVAQSLGLED---VSIETVRGVYQGKFFSMDRVLVDM---------XXXXXXXXXXX
DAPF_CAMLR      KANMCGNGSR-XXXXXXXXXLKKSQYLNFLTGAGLIKSFVDDDIVEIKLSGIK---------DIKEAFEY


                         +         .         .         .         .         *         .:210
query           YSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYE
DAPF_NITOC      YSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYE
DAPF_THISH      YPLEVEGETYEIGAVSMGNPHAVLRVDNVQTAPVARLGPLIEAHPRFPRHVNVGFMQVVSPGEIRLRVYE
DAPF_ALHEH      YELEVEGQVVRLGAVSMGNPHAVLRVDDVDSAPVETLGPAIESHSRFPRRVNVGFMQVLTPTHIRLRVYE
DAPF_CELJU      YPLDVAGQVCSISAVSMGNPHAVMLVDDVKSAPVGQLGPLVENHPRFPARVNAGFLQVVSRDEINLRVYE
DAPF_NITMU      YSLSLDDRQVEISSVSMGNPHAVQVVSDLDNAPVLTEGPVIEKHSRFPQRVNAGYMQVVDPHHIRLRVYE
DAPF_PSEAE      YEIEVNGQRVELAAVSMGNPHGVLRVENVDSAPVHSLGPQLEVHPRFPKKANIGFLQVLDPHHARLRVWE
DAPF_PSEA8      YEIEVNGQRVELAAVSMGNPHGVLRVENVDSAPVHSLGPQLEVHPRFPKKANIGFLQVLDPHHARLRVWE
DAPF_PSEAB      YEIEVNGQRVELAAVSMGNPHGVLRVENVDSAPVHSLGPQLEVHPRFPKKANIGFLQVLDPHHARLRVWE
DAPF_PSEA7      YEIEVNGQRVELAAVSMGNPHGVLRVENVDSAPVHSLGPQLEVHPRFPKKANIGFLQVLDPHHARLRVWE
DAPF_PSEU5      YSLEVDGQQVELAAASMGNPHAVLRVDSVERAPVHELGPKIEHHPRFPQRVNVGFLQVVDRRHARLRVWE
DAPF_PSEMY      YRVDVEGQSVELAALSMGNPHAVLRVDNVDSAPVHTLGPKLEHHPRFPQRVNVGFLQVLDRKHARLRVWE
DAPF_DECAR      HLLDVADETLETSVVSMGNPHAVQVVDSVDTAPVGEHGPLIEKHPRFPLRVNAGFMQIVDRHAIKLRVYE
DAPF_AZOVD      YQVEVDGCEVELAALSMGNPHAVLRVENVESAPVHELGPKLEHHPRFPQRVNVGFLQVVDRQHARLRVWE
DAPF_SHEON      YLLQTPQQTFLCGAASMGNPHCVLDVEDVANANVAEIGALLTKHERFPRGVNVGFMQVVNAGHIKLRVYE
DAPF_SHESR      YLLQTSQQTFLCGAASMGNPHCVLDVEDVANANVAEIGALLTKHERFPRGVNVGFMQVVNSGHIKLRVYE
DAPF_SHESM      YLLQTSQQTFLCGAASMGNPHCVLDVEDVANANVAEIGALLTKHERFPRGVNVGFMQVVNSGHIKLRVYE
DAPF_SHESA      YLLQTPQQTFLCGAASMGNPHCVLDVEDVANANVAEIGALLTKHERFPRGVNVGFMQVVNSGHIKLRVYE
DAPF_NITEU      YPLNVNDREIEISAVSMGNPHAVQIVPDIDLAPVTSEGPAIESHPFFPEKVNAGYMQIVDRTHIRLRVFE
DAPF_SHEFN      YLLQTPMQTYLCGAISMGNPHCVIQVEDVQTVNVDEIGSSLTRHERFPKGVNVGFMQVINPGHIKLRVYE
DAPF_PSE14      YNVEVDGQNIELAAVSMGNPHAVLRVDDINNAPVHELGPKIEHHPRFPARVNVGFLHVVDRQRAQLRVWE
DAPF_SHEDO      YLLQTPVQTFLCGAISMGNPHCVIEVDDIDTVAVDEIGALLTRHERFSKGVNVGFMQIINPGHIKLRVYE
DAPF_ALCBS      YFLVSGTQAWDVGAVGLGNPHCTLLVENVDTAPVDTVGPLLESHEQFPERANVGFMQIVSRNEIRLRVYE
DAPF_AZOSB      QPLQLAEDTVAITAVSMGNPHAVQVVADVDTAPVARQGAEIECHPRFPARVNAGFMQVVDAGHIRLRVFE
DAPF_PSEU2      YTVDVDGQHVDMAAVSMGNPHAVLRVDDINNAPVHELGPKIEHHPRFPARVNVGFLHVVDRQRAQLRVWE
DAPF_PSEPK      YPLEVDGQLHSIAAVSMGNPHAVLRVDDVQTAPVHELGPKIENHPRFPQRVNAGFIQVIDRHRANLRVWE
DAPF_PSEE4      YPLEVDGQVHQIAAVSMGNPHSVLRVDDVRTAPVHELGPKIEHHPRFPQRVNAGFIQVVDRHRANLRVWE
DAPF_PSEPG      YPLEVDGQLHSIAAVSMGNPHAVLRVDDVRTAPVHELGPKIENHPRFPQRVNAGFIQVIDRHRANLRVWE
DAPF_PSEPW      YPLEVDGELHSIAAVSMGNPHAVLRVDDIRTAPVHGLGPKIENHPRFPQRVNAGFLQVIDRHRANLRVWE
DAPF_NITEC      YPLQIGDKTIEISAVSIGNPHAVQIIPDIDLAPVTTEGPKIEAHPLFPERVNAGFMQIIDRAHIRLRVFE
DAPF_PSESM      YSLDVDGQTVELAAVSMGNPHAVLRVDDINNAPVHTLGPKIEHHPRFPARVNVGFLHVVDRQRAQLRVWE
DAPF_SHEAM      YLLQSAQQTFLCGAVSMGNPHVVLEVDDITQAPVADVGAQLTRHERFPKGVNVGFMQVVAPDHIKLRVYE
DAPF_SHESH      YLLQATNQTFLFGAVSMGNPHCVLDVEDIEAADVEGIGALLTRHERFPKGVNVGFMQIINSGHIKLRVYE
DAPF_AERS4      YLLRAQEHTVMCGVVSMGNPHCVIEVPSVADAPVETLGAIMERHERFPERVNVGFMEMVNATEIRLRVFE
DAPF_TOLAT      YLLRVAEQTVMCGVVSMGNPHCVIEVPSVKDAPVETLGPKLESFDRFPERINVGFMEVVSASEINLRVYE
DAPF_SHEB9      YLLQTPMQTFLCGAASMGNPHCVLDVEDVASASVAEIGAMLTKHERFPRGVNVGFMQVVDSGHIKLRVYE
DAPF_SHEB8      YLLQTPMQTFLCGAASMGNPHCVLDVEDVASASVAEIGAMLTKHERFPRGVNVGFMQVVDSGHIKLRVYE
DAPF_SHEB5      YLLQTPMQTFLCGAASMGNPHCVLDVEDVASASVAEIGAMLTKHERFPRGVNVGFMQVVDSGHIKLRVYE
DAPF_SHEB2      YLLQTPMQTFLCGAASMGNPHCVLDVEDVASASVAEIGAMLTKHERFPRGVNVGFMQVVDSGHIKLRVYE
DAPF_HAHCH      YPIEVNGVMYEISAVSMGNPHGVLVVDDVNKAPVHKLGKALENHPRFPERANIGFLQVVHRRFAKLRVFE
DAPF_AERHH      YLLRAQEHTVMCGAVSMGNPHCVIEVPSVADAPVATLGPIMERHERFPERVNVGFMEMVNASEIKLRVFE
DAPF_PSEFL      YQVDVDGATVELAAVSMGNPHAVLRVADINSAPVHELGPKIEHHPRFPARVNVGFLQVIDRHRAQLRVWE
DAPF_ACIAD      YTLELANEQLKIDVVNMGNPHAVTIVPDVLTADVATMGPQVESHVRFPQRVNAGFMQIVDEKHIRLRVFE
DAPF_SHESW      YLLQTAQQTFLCGAASMGNPHCXXXXXXXXXXXXXXIGALLTKHERFPRGVNVGFMQVINSGHIKLRVYE
DAPF_SHEPC      YLLQTAQQTFLCGAASMGNPHCXXXXXXXXXXXXXXIGALLTKHERFPRGVNVGFMQVINSGHIKLRVYE
DAPF_PSEPF      YQVDVDGTPVDLAAVSMGNPHAVLRVSDINTAPVHELGPKIEHHPRFPARVNVGFLQVIDRHRAQLRVWE
DAPF_PSEHT      YIIRTEEHTVFSGAVSMGNPHCVLEVDDITTAQVDILGPLLENHERFPQRANIGFMQVISKEHIKLRVWE
DAPF_SHELP      YLLQADGMQTFLGAVSMGNPHCVLEVDDVANADVERIGSLLTKHERFPKGVNVGFMQVVDANHIKLRVYE
DAPF_SACD2      YTLPTQGADITIGAVSMGNPHAVYCVNDCKTAPVETLGPEIEAHPHFPKKVNAGFMQVVSPSEINLRVYE
DAPF_CHRSD      HCLEVDGETWDIGAVSMGNPHAVLRVDDVAQAPVARLGPLIERHPRFPRGVNVGFLQVVSRHEARLRVFE
DAPF_METPP      FALDAADRTVEAAVVSMGNPHAVMNVAGVDEAPVAELGPLVERHTRFPQRVNAGFLQVLSDTHVKLRVYE
DAPF_HALHL      YRLATSRGEQTIGAVSMGNPHAVLRVDDMTGAPVAELGPEIERHPRFPRRVNVGFMEVCTRDRIRLRVFE
DAPF_AZOSE      QPLDVGGETVAITAVSMGNPHXXXXXXXXXXXXXXXXXXLIERHPRFPARVNAGFVQVVDAHRIRLRVFE
DAPF_ACIBS      YTLELNDQNISIDVVNMGNPHAVTIVPDVLTADVAGIGPQVESHKRFPERINAGFMQVIDDKHVRLRVFE
DAPF_ERWT9      YLMRAAEQTVMCGVVSMGNPHCVLQVDNVKTAAVETLGPVLESHERFPERVNVGFMEVVHREHIRLRVYE
DAPF_ENTS8      YIMRAAEQTVLCGVVSMGNPHCVIQVDDVATAPVETLGPLMESHERFPERANIGFMQVMNTEHIRLRVFE
DAPF_ACIBY      YTLELNDQNISIDVVNMGNPHAVTIVPDVLTADVAGIGPQVESHKRFPERVNAGFMQVIDDKHVRLRVFE
DAPF_ACIBC      YTLELNDQNISIDVVNMGNPHAVTIVPDVLTADVAGIGPQVESHKRFPERVNAGFMQVIDDKHVRLRVFE
DAPF_ACIB5      YTLELNDQNISIDVVNMGNPHAVTIVPDVLTADVAGIGPQVESHKRFPERVNAGFMQVIDDKHVRLRVFE
DAPF_ACIB3      YTLELNDQNISIDVVNMGNPHAVTIVPDVLTADVAGIGPQVESHKRFPERVNAGFMQVIDDKHVRLRVFE
DAPF_SHEWM      YLLQTSSSHAMCGAISMGNPHCVLEVEDIEHAEVERIGALLTQNERFPKGVNVGFMQVIDAGHIKLRVYE
DAPF_ACIBT      YTLELNDQNISIDVVNMGNPHAVTIVPDVLTADVAGIGPQVELHKRFPERVNAGFMQVIDDKHVRLRVFE
DAPF_SALTY      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALTI      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALSV      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALPK      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALPB      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALPA      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALNS      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALHS      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALDC      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_SALA4      YIMRAAEQTILCGVVSMGNPHCVIQVDNVDTAAVETLGPVLESHERFPERANIGFMQVVRREHIRLRVYE
DAPF_CHRVO      YSLPLPEGRCEIGIASMGNPHXXXXXXXXXXXXXXXXXXXIESHPAFPQRVNAGFMQIVNRGEIRLRVYE
DAPF_ACTSZ      YILRTDIQTVLCGAVSMGNPHCVIQVEDIKTANVAQLGPLLESHERFPERVNAGFMQVIDRHHIKLRVYE
DAPF_VARPS      HTWHLDSAIVSVAVLSMGNPHAVQVVDNVDTAPVARQGPLIEHHPRFAQRVNAGFMQVVDRSHIKLRVFE
DAPF_TERTT      YPLQLDNMEITISAVSMGNPHAVTLVDNLASFPVKTLGAQIETHAQFPNRVNAGFMELISRQEVKLRVFE
DAPF_CUPTR      YGLEVNGRTEWISAVSMGNPHAVQVVDDVENFPVLQDGPVIEHHPAFPNRVNAGFMQVVDRHAIRLRVYE
DAPF_MANSM      YILRTDIQTVLCGAVSMGNPHCTLVVDDVETANVTELGPLLENHERFPERVNVGFMQVINPNHIKLRVYE
DAPF_BURP8      YALEVNGETRWVSVVSMGNPHAVQVVDDVEAFPVLVDGPVIETHPRFPQRVNAGFMQIVGRSEVKLRVYE
DAPF_PSYIN      YILRVEDHTVLCGVVSIGNPHCVVLVDDIDNAPVETLGPLLENHERFPNKVNVGFLEIKSRDHARLRVWE
DAPF_DIAST      WPLALDGQASEVAVVSMGNPHAVQLVDDVDTAPVAQTGPLIESHPRFPQRVNAGYLQIVNRGEVRLRVYE
DAPF_VIBVY      YIMRVGEKTLFCGAVSMGNPHVVTVVDDVDSAEVETLGPLLESHERFPERVNAGFMQVVNREQIRLRVYE
DAPF_VIBVU      YIMRVGEKTLFCGAVSMGNPHVVTVVDDVDSAEVETLGPLLESHERFPERVNAGFMQVVNREQIRLRVYE
DAPF_PASMU      YILRTSIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLENHERFPERVNAGFMQVIHRGHIKLRVYE
DAPF_LARHH      HELEVAGQILGVTVVSMGNPHXXXXXXXXXXXXXXXFGPLIENHLRFPARVNAGFMQIESRTAICLRVFE
DAPF_RALME      YGLEVNGRTEWISPVSMGNPHAVQIVDDVEQFPVLQDGPVIEHHKSFPNRVNAGFMQIVDRNTVRLRVFE
DAPF_PHOLL      YILRVAERTVLCGVVSMGNPHCVIQVPDVETAEVDILGPALESHERFPERANIGFMQILNRGHIRLRVYE
DAPF_COLP3      YILRSESETVLCGAVSMGNPHCVVTVDSVAEADVESLGKELSVHERFPEDANVGFMEIVSPNYIKLRVYE
DAPF_COXBU      YDIAVDNQIVKLGVVNIGNPHAIIPVERINAEEVGKLGARLSVHECFPEGANVGFMQVIDPQNIRLRVYE
DAPF_COXBR      YDIAVDNQIVKLGVVNIGNPHAIIPVERINAEEVGKLGARLSVHECFPEGANVGFMQVIDPQNIRLRVYE
DAPF_COXBN      YDIAVDNQIVKLGVVNIGNPHAIIPVERINAEEVGKLGARLSVHECFPEGANVGFMQVIDPQNIRLRVYE
DAPF_COXB2      YDIAVDNQIVKLGVVNIGNPHAIIPVERINAEEVGKLGARLSVHECFPEGANVGFMQVIDPQNIRLRVYE
DAPF_COXB1      YDIAVDNQIVKLGVVNIGNPHAIIPVERINAEEVGKLGARLSVHECFPEGANVGFMQVIDPQNIRLRVYE
DAPF_ESCF3      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECOSM      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECOLU      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECOLI      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECOLC      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECOL5      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECOHS      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECODH      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECOBW      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECO8A      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECO7I      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECO5E      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECO57      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECO55      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECO45      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECO24      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_SODGM      YIMRAAEQTVLCGVVSMGNPHCVIAVDSVDNAPVATLGPVLESHERFPERANIGFMQVLNRGHIRLRVYE
DAPF_SHIF8      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECOL6      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_VIBCH      YILRVGEHTLFCGAVSMGNPHVVTVVDDIRTAAVETLGPLLESHERFPERVNAGFMQVVSRDEINLRVYE
DAPF_VIBC3      YILRVGEHTLFCGAVSMGNPHVVTVVDDIRTAAVETLGPLLESHERFPERVNAGFMQVVSRDEINLRVYE
DAPF_HAEPS      YILRTDIQTVLCGVVSMGNPHCVLQVENIQTANVNELGALLERHERFPERANIGFMQVINRNHIKLRVFE
DAPF_SERP5      YIMRAAEHTVLCGVVSMGNPHCVLQVDDVKTAKVELLGPVLEGHERFPERANIGFMQIVSREHIKLRVYE
DAPF_PECCP      YIMRADEHTVLCGVVSMGNPHCVIQVEDVDTAKVETLGPLLESHERFPERANIGFMQVVDSHTVRLRVYE
DAPF_ENT38      YIMRASEQTVLCGVVSMGNPHCVIQVDDVDTAAVEILGPIMESHERFPERANIGFMQVMKREHIRLRVYE
DAPF_ECO27      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVFE
DAPF_SHIB3      YIMRAAEQTILCGVVSIGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ECO81      YIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYE
DAPF_ACTP7      YILRTDLQTVLCGVVSMGNPHCVLQVEDINLAPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFE
DAPF_RALSO      HALQINGRTAWLSTVSMGNPHAVQVVDDAEAFPVREDGPLIESHAVFPRRVNAGFMEIADRHAIRLRVYE
DAPF_RALEJ      YGLEINGRTAWISPVSMGNPHAVQVVDDVENFPVLQDGPLIEHHATFPNRVNAGFLQVVDRHTARLRVFE
DAPF_RALEH      YGLEVNGRTEWISVVSMGNPHAVQVVDDVENFPVLQDGPVVEHHAAFPNRVNAGFMQVQDRHAIRLRVYE
DAPF_ACTP2      YILRTDLQTVLCGVVSMGNPHCVLQVEDINLTPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFE
DAPF_ACIAC      XXXXXXXXXXXXXXXSMGNPHAVQLVGDVDAAPVAHTGPLIEGHARFPQRVNAGYLQIEDRARVRLRVYE
DAPF_HAEIN      YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
DAPF_HAEI8      YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
DAPF_ERWCT      YIMRADEHTVLCGVVSMGNPHCVIQVEDVETAKVETLGPLLESHERFPDRANIGFMQVVDSQTVRLRVYE
DAPF_PHOPR      YIMRVGERTIFCGTVSMGNPHCXXXXXXXXXXXXXXXGPLIESHERFPERVNAGFMQVVSRNEVKLRVYE
DAPF_PSEA6      YIIRENDHTFFCGAVSMGNPHCVLLVDDVETADVEGIGKTLVAHERFPEGANIGFMQILNSGHIKLRVYE
DAPF_BURXL      WPLDVSGTTRWISVVSMGNPHAVQVVGDVEAFPVLAEGPVIERHARFPQRVNAGFMQIVGRNEIRLRVYE
DAPF_YERPY      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_YERPS      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_YERPP      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_YERPN      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_YERPG      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_YERPE      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_YERPB      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_YERPA      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_YERP3      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYE
DAPF_VIBPA      YIMRAGDKTLFCGAVSMGNPHXXXXXXXXXXXXXXXLGPLLESHERFPERVNAGFMQVVSRDHIRLRVYE
DAPF_HAEIE      YILRTDIQTVLCGAVSIGNPHCVVQVDDIQTANVEQLGPLLENHERFPERVNAGFMQIINKEHIKLRVYE
DAPF_ACTPJ      YILRTDLQTVLCGVVSMGNPHCVLQVEDINLTPVNELGPLLENHERFPERANIGFMQVVNRNHIKLRVFE
DAPF_LEPCP      WPLQLPGPSVDVAVLSMGNPHAVQRVHDVDTAPVAEIGPRVETHARFPRHVNAGFMQVMSRREVRLRVFE
DAPF_HAEIG      YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
DAPF_HAES1      YIIRTDIQTLLCGVVSMGNPHCVTQVEDIQHANIEILGPLLESHERFPERVNAGFMQIINRNHIKLRVYE
DAPF_YERE8      YILRAAEHTVLCGVVSMGNPHCVMQVDDVSVANVALLGPVLESHERFPERANIGFMQVVSREHIRLRVYE
DAPF_VIBF1      YLLRVDDKTLFSGAVSMGNPHCXXXXXXXXXXXXXKYGQLVESHERFPERVNAGFMQIISPNEVKLRVYE
DAPF_IDILO      YVLRVKEETVLCGVLGLGNPHCVIAVDNVDTTPVETLGAALAAHERFPESVNVGFMQKVSADEIKLRVFE
DAPF_VIBHB      YIMRAGDKTLFCGAVSMGNPHXXXXXXXXXXXXXXXLGPLLESHERFPERVNAGFMQVVNRNHIRLRVYE
DAPF_RHOFD      TSLALHATTVYVAVVSMGNPHAVQVVDDVDTAPVRLQGPLIEHHASFPKRVNAGFMQIVDRSHIRLRVYE
DAPF_ALISL      YLLRAEDKTLFCGAVSMGNPHCXXXXXXXXXXXXXKYGPLVEGHERFPERVNAGFMEIVSPSEIKLRVYE
DAPF_RALPJ      HALQINGRTEWLSTVSMGNPHAVQIVDDTEAFPVLEDGPLIESHAVFPRRVNAGFMQIVDRHSVRLRVYE
DAPF_PSYCK      YHLDVNGTPVQLYVANMGNPHAVIKVDDVLDADVETLGKAIESHPAFPERVNVGFMQIMNQRHIRLRVFE
DAPF_PSYA2      YHLDVNGTPVQLYVANMGNPHAVIKVDDVLDADVESLGRAIESHPAFPERVNVGFMQVMNQRHIRLRVYE
DAPF_BURPP      WPLDVNGTTRWISVVSMGNPHAVQVVDDVEAFPVLVEGPVIERHARFPQRVNAGFMQIVGRSEIKLRVYE
DAPF_HERAR      WPLDIKGETHWISVLSMGNXXXXXXXXXXXXXXXREDGVLIEHHPRFPKRVNAGFMQIIDPHQIKLRVFE
DAPF_HAES2      YIIRTDIQTLLCGVVSMGNPHCVTQVEDIQHANIEILGPLLESHERFPERVNAGFMQIINRNHIKLRVYE
DAPF_PSYWF      YHLDVEGTPVQLYVANMGNPHAVIKVDDILTADVEKLGKAIESHPAFPERVNVGFMQVMNQRHIRLRVYE
DAPF_EDWI9      YILRVAQQTVLCGAVSMGNPHCVLQVEDISRAQVELLGPSLESHERFPERVNVGFMQVVERSHIRLRVYE
DAPF_LEGPC      YSLELNGNTVNLHAISVGNPHAVLLVENIDTAPVNSLGQQISFHPQFPEQVNVGFMQIVNHEKINLRVYE
DAPF_LEGPA      YSLELNGNTVNLHAISIGNPHAVLLVENIDTAPVNSLGQQISFHPQFPEQVNVGFMQIVNHEKINLRVYE
DAPF_LEGPH      YSLELNGNTVNLHAISVGNPHAVLLVENIDTAPVNSLGQQISFHPQFPEQVNVGFMQIINHEKINLRVYE
DAPF_HAEDU      YILRTDLQTVLCGVVSMGNPHCVLQVDDIEQATVHQLGALLEKHHRFPERANVGFMQIIDRHHIKLRVFE
DAPF_VIBSL      YILRTDVHTLFCGAVSMGNPHXXXXXXXXXXXXXXXLGPLLESHERFPERVNAGFMQVVNREEVRLRVYE
DAPF_LEGPL      YSLKLNGNTVNLHAISVGNPHAVLLVENIDTAPVNSLGQQISFHPQFPEQVNVGFMQIVNHEKINLRVYE
DAPF_BURCM      WPLDVGGATRWISAVSMGNPHAVQVVDDVEAYPVLEEGPLIERHARFPQRVNAGFMQIVSRHEVKLRVYE
DAPF_BURVG      WPLDVGGATRWVSTVSMGNPHAVQVVDDAEAYPVLAEGPLIERHARFPKRVNAGFMQIVSRHEVKLRVYE
DAPF_PROMH      YIIRAMERTVLCGVVSMGNPHCVIQVEDIKTAEVESLGSVLEQHERFPERANIGFMQVVDRNTLHLRVFE
DAPF_BURTA      WPLPVNGATRWISVVSMGNPHAVQIVDDAEAFPVLADGPAIERDPRFPQRVNAGFMQIVSRHEVKLRVYE
DAPF_BAUCH      EILYLAKNYIFGGIVSIGNPHCIMIVNNVDSAQVSIIGPILEIHKYFSERTNVGFMQVINREQVLLRVYE
DAPF_BURPS      WPLPVNGVTRWISVVSMGNPHAVQIVDDAEAFAVRVDGPAIECDPRFPQRVNAGFMQIVSRHEVNLRVYE
DAPF_BURP0      WPLPVNGVTRWISVVSMGNPHAVQIVDDAEAFAVRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYE
DAPF_BURMS      WPLPVNGVTRWISVVSMGNPHAVQIVDDAEAFAVRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYE
DAPF_BURMA      WPLPVNGVTRWISVVSMGNPHAVQIVDDAEAFAVRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYE
DAPF_BURM9      WPLPVNGVTRWISVVSMGNPHAVQIVDDAEAFAVRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYE
DAPF_BURM7      WPLPVNGVTRWISVVSMGNPHAVQIVDDAEAFAVRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYE
DAPF_BURP6      WPLPVNGVTRWISVVSMGNPHAVQIVDDAEAFAVRVDGPAIERDPRFPQRVNAGFMQVVSRHEVNLRVYE
DAPF_NEIMB      YGVHLESGIQPVSCVNMGNPHAVIVVDDVECAPVRETGSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFE
DAPF_NEIMA      YGVHLESGIQPVSCVNMGNPHAVIVVDDVECAQVRETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFE
DAPF_BLOPB      YILFLPTQIILCGVVSMGNPHCIILVEKIENIQVTSLGSALEDHHCFPERVNVSFMQIINCNNIRLRVYE
DAPF_VESOH      YQIE----GFDLGAISIGNPHCVMLVKDVNTIDVNTIALKIQQSELLPNQANIGFMQILNTHEINLRVYE
DAPF_RUTMC      YQIE----GFDLGAVSIGNPHCVMLVEDVNTVDVSSIALRIQQSELLPNQANIGFMQILNTHEINLRVYE
DAPF_XANCP      YALPVHGETVRFGAVSMGNPHAVVEVGRVDAAPVERVGALLQQNAAFPESVNVGFAQVVDPAHVRLRVYE
DAPF_XANCB      YALPVHGETVRFGAVSMGNPHAVVEVGRVDAAPVERVGALLQQNAAFPESVNVGFAQVVDPAHVRLRVYE
DAPF_XANC8      YALPVHGETVRFGAVSMGNPHAVVEVGRVDAAPVERVGALLQQNAAFPESVNVGFAQVVDPAHVRLRVYE
DAPF_BLOFL      YVLFVPNFTILCGVVSIGNPHCVILVEQVDLVPVTVLGSILENHHCFPKKANISFMQIISQNNIKLRVYE
DAPF_HALOH      FPLKIGNKKLNINCVSMGNPHTIIFVEDVNQIPVSTWGQEIEHNPLFPQKTNVEFIQIQSEDEIIMRVWE
DAPF_SYNJA      QPLQVGGREWAVTAVSMGNPHCVVXXXXXXXXXXXRVGPLFEHHPAFPERTNTEFAQVLGPNYLRLRVWE
DAPF_LEPBA      QVIEVQGKQYHFTAVSMGNPHCVIYVDDADDFPVREIGPIIENHPFFPRRVNVEFVSIKGKDHLYQRTWE
DAPF_ACAM1      QPLEVAGQSWPVTCVSMGNPHCITFVDDLEAIDFQTLGPQFEHHPVFPQRINTEFIQVIRPDYLKMLVWE
DAPF_SYNJB      QPLAVAGREWRVTAVSMGNPHCVVXXXXXXXXXXAAVGPLFEHHPAFPERTNTEFVQVLSPTRLRLRVWE
DAPF_CARHZ      IPLEVLGQKFYFTAVSMGNPHAVIFVDSLAKIELEKYGPLIETHPLFPRKTNVEFVEILSPAKVKVFVWE
DAPF_XANAC      YALPVHGETVRFGAVSMGNPHAVVEVGRVDAAPVERVGALLQQNAAFPDSVNVGFAQVVDPVHVRLRVFE
DAPF_BUCAP      FSVKLINKNLKCSLVSIGNPHCVIKVESINNAPVKKIGELLEKNSIFPQGINVGFMKVINKNHIQLRVYE
DAPF_CYAP4      VPLQVGGRSWSVTCVSMGNPHCITFVENVAAIDLHTLGPQFEHHPAFPQRINTEFIEVIRPDYLKMRVWE
DAPF2_ANASP     QPLEVEGQTWEVTCVSMGNPHCITFVEDVAAIPLEIIGPKFEHHPAFPQRTNTEFIQVVSRDYLKMRVWE
DAPF_XANC5      YALPVHGETVRFGAVSMGNPHAVVEVGRVDAAPVERVGALLQQNAAFPDSVNVGFVQVVDPAHVRLRVFE
DAPF_HELMI      VNQELGDAVVRVTALSMGNPHCLIYVNDIDEAPVTTLGPKVEVHPAFPAKTNVEFVQVVAPDEVQMRVWE
DAPF_CLOTH      TEVEIDGKEFKVTCVSMGNPHAVSYVKNVDIFPLEKIGPKMEHHPLFPKRINAEFVEVIDRTTLKMRVWE
DAPF_TRIEI      QLLEVGGKSWFVTCVSMGNPHCITFVEDVTAIDLAKIGPKFEHNPVFPERTNTEFIQVISPKYVKMRVWE
DAPF_LEPBL      QTFEIAGKNLKFTAVSMGNPHCVIFVDDCDQFPVTGIGPLIERHPIFPKRINVEFVTVRGKDHFYQRTWE
DAPF_LEPBJ      QTFEIAGKNLKFTAVSMGNPHCVIFVDDCDQFPVTGIGPLIERHPIFPKRINVEFVTVRGKDHFYQRTWE
DAPF_NOSP7      VPLEVAGKTWEVTCVNMGNPHCITFVEDVAAIELESIGPKFEHHPAFPQRINTEFIQVVRRDYLKMRVWE
DAPF_XYLFM      YVLSLQGEVLRCGAVSMGNPHAVVEVDLIDVAPVERIGPLLQQHVAFPESVNVGFVQVIDPGLVRLRVYE
DAPF_LEPIC      QPLEIGDKNLKFTAVSMGNPHCVIFVDDSDEFPVRGIGPLIERHSIFPKRVNVEFVTIRGKDHLYQRTWE
DAPF_XANOM      YALPVHGDTVRFGAVSMGNPHAVVEVGRVDAAPVERVGTLLQQNAAFPDSVNVGFVQVVDPTHVRLRVFE
DAPF_SYNP6      VDLEVGDRPWKVTTVSMGNPHCITFVEDVAAVPLAEIGPLFEHHPVFPQRTNTEFVEVVRPDYLKMRVWE
DAPF_SYNE7      VDLEVGDRPWKVTTVSMGNPHCITFVEDVAAVPLAEIGPLFEHHPVFPQRTNTEFVEVVRPDYLKMRVWE
DAPF_MICAN      VPLEVEGKDWLVTCVSMGNPHCVTFVGDLASIPLETIGPKFEHHPVFPQRTNVEFVEVIAPDYMKMRVWE
DAPF_DESHD      GALDVDGQEFEFTAVSMGNPHCVLFVEDYETLDFERIGPAIEKHPLFPRKTNVEFIIVNSPRELTMKVWE
DAPF_RHOCS      DTLRVPGPLQDACCVGMGNPHAVFFVDDAEAVDLATLGPVLEHHSLFPQRCNIEVAQVLAPDHIRMRVWE
DAPF_ORYSJ      ADLAVDGSTWQVTCVSMGNPHCVLKVLHVDDLKLSDIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
DAPF_ORYSI      ADLAVDGSTWQVTCVSMGNPHCVLKVLHVDDLKLSDIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
DAPF_MAGSM      APLEVGGQSYRMTALSMGNPHGVVRVADAEGFELAKVGPLVEHHALFPNRINFEVVQVLSRSRIRMRVWE
DAPF_LEPIN      QPLEIGDKNLKFTAVSMGNPHCVIFVDDSDEFPVRGIGPLIERHSIFPKRVNVEFVTIRGKDHLYQRTWE
DAPF_XYLFA      YVLSLQGEVLRCGAVSMGNPHAVVEVDLIDVAPVERIGSLLQQHVAFPESVNVGFVQVIDPGLVRLRVYE
DAPF_XYLFT      YVLSLQGEVLCCGAVSMGNPHAVVEVDLIDVAPVERIGPLLQQHSAFPESVNVSFVQVIDPGLVRLRVYE
DAPF_XYLF2      YVLSLQGEVLCCGAVSMGNPHAVVEVDLIDVAPVERIGPLLQQHSAFPESVNVSFVQVIDPGLVRLRVYE
DAPF_CYAP8      HSLEVAGQTWLVTCVSMGNPHCITFVKDVWGIDLPTLGPQFEHHPGFPERTNTEFIEVVRRDYVKMRVWE
DAPF_BUCAI      FSIKLMNENLICNLVSIGNPHCIIKVQSVKNAPVNIIGDSIEKNPIFPEGVNVSFMEILNKKHIKLRVYE
DAPF_SYNY3      LPLAVAGQTWAVTCVSMGNPHCLTFVDDVDSLNLTEIGPLFEHHPQFSQRTNTEFIQVLGSDRLKMRVWE
DAPF_DESDA      SQVDVNGQLYEITAVSMGNPHAVIFMKGIDDLDLPRIGPRFEHHPLFPKRTNTEFAEVISSTKVRMRVWE
DAPF_BUCA5      FSIKLINENLICNLVSIGNPHCIIKVQSIKNAPVNIIGDNIEKNPIFPEGVNVSFMEILNKKHIKLRVYE
DAPF_SYNP2      QPLEVAGKTWMVTCVSMGNPHCITFVEDVAAIALEVIGKDFEHHPAFPQRINTEFIEVVRPDYIKMRVWE
DAPF_GRABC      LPLEAPGLKMP-AACSMGNPHATFFVADLAELDIPVTGPLLERHPLFPERANIGHAQMLSRSHIRLRVWE
DAPF_BUCAT      FSIKLMNENLICNLVSIGNPHCIIKVQSIKNAPVNIIGNNIEKNPIFPEGVNVSFMEILNKKHIKLRVYE
DAPF_ARATH      AELVVDGVSWNVTCVSMGNPHCITFGKKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
DAPF_THEEB      VPLTVGDRQWLVTCVSMGNPHCVTFVEDVAALDLAVLGPQFEHHPAFPQRTNTEFVQVLGSDRLRMRVWE
DAPF_GLUOX      LHLPLH----DAAACSMGNPHATLFGDAFRAEAL---GPGLERDPLFPERANIGFAQILSPIHMRLRVWE
DAPF_CYAP7      VPIEVAGQSWLVTCVSMGNPHCITFVEDVKSIALETIGPQFEHHVAFPQRTNTEFIEVLRPDYLKMRVWE
DAPF_METTH      RFLPVEGEDIKLTALSVGNPHAIIFVDDAEGVDLDRLGPAIENHPLFPERINVHFVEVVSPSEIIMVTWE
DAPF_SPHWW      RAMPVAWEELEAPAANVGNPHVVFFVPETDAVALDRLGPRIETDPLFPARINVNVATVDDRANIRLRVWE
DAPF_METM6      IDEEITAKDYNFTCVSIGNPHAITYIENVEEFPLEKIGPLFEIHEKFPRKTNVEFVELIDDSTVKMRVWE
DAPF_METMP      IDEEITAKDYNFTCVSMGNPHAITYIENVDEFPLEKIGPLFEIHEKFPRKTNVEFVELIDKNTVKMRVWE
DAPF_METM7      IDEEITAKDYNFTCVSMGNPHAITYIENVSEFPLEKIGPLFEFHEKFPRKTNVEFVELIDDSTIKMRVWE
DAPF_PELTS      GELETGGAVYRITAVSMGNPHCVIFVQDLDAVPFQTAGPLIETHPAFPRRTNVEFIQVLTPEEIKMRVWE
DAPF_BACV8      ETIPADGKEYKGTFVCMGNPHVVIFVDDIKEVDLPAVGPKLENHPLFPERTNVEFVEILPDQSLRMRVWE
DAPF_PHEZH      HHADL---MAPPGCVSMGNPHVVFFVXXXXXXXXXXXXXXXXGHPLFPEHVNVGFAQVKAPDRIRLRVWE
DAPF_METM5      IDEEITAKDYNFTCVSMGNPHAITYIENVEEFPLEKIGPLFEVHEKFPKKTNVEFVELIDDSTVKMRVWE
DAPF_SPHAL      RDMPVAWDELEHGAVNVGNPHIVFFVPEADAVALDQLGPRIETDPLFPERVNVNVASLDGENQLQLRVWE
DAPF_DESAP      GELDAGERSFMVTAVSMGNPHCVVFGADLDDAGFRKYGPLLEVHPAFPARTNVEFVEVLSPGEVAVRVWE
DAPF_ERYLH      LSLPVGWGELEAAAVNVGNPHXXXXXXXXXXXPLDTMGPGIETDPLFPERINVNIASLTGDDALKLHVWE
DAPF_PROMM      GECHLGSTSLHVAAVGMGNPHLIVPVEDLENIPFENWGQRLEKHHAFPAKTNVHFLKIHSPNQLEIRVWE
DAPF_ELUMP      IPVKLEGGKIKGTGVSMGNPHFVIFVEDIKKTDVAKTGKEVENNTAFPQKTNVEFVQVITPSRLCMKVWE
DAPF_BACFR      -TIDFDGEFPFLSTVSMGNPHLVTFVDDIRIVNLSEMGPKLEKHPLFPDRTNVEFAQITGENTIRMRVWE
DAPF_DESAH      EQIQVKGETVSITAVSMGNPHAVIFVDDVKKIDLENLGRAIETHELFPAKTNVEFVTVLNDQELVMRVWE
DAPF_OCEIH      VNFVVAGETQYITAVSMGNPHGVFFVDDIEKAPLETLGPTIEKDMRFPESINVEFIEVVSPTELNFRVWE
DAPF_BUCBP      HSIKFVNKIINYDLVSIGNPHCIIYVNNLKKYPVKKIGFYLSTHKIFPEGINVNFVEVLSKNEIALRVYE
DAPF_PROM1      GVITLKDQILNVYAASMGNPHMIVFVNDIEGIPFQEWGSFLEKHNTFPNDTNVHFVEIIDKSNIKVKVWE
DAPF_DESRM      IGEELNGKVYLVTAVSMGNPHCIIFVPDLEDISLTQVGPQIEVHPAFPKKTNVEFVQVLGPNEVRMVVWE
DAPF_MOOTA      EPIEVNGETWRGTCVSMGNPHCVFFVEDXXXXXXXXXXXXXEHHPLFPRRTNVEFIQVLNREELRMRVWE
DAPF_GEOTN      VSFAIDGREYEITAVSMGNPHVIFYVDDIEKAPVTTLGPVVEKDARFPEGVNVEFVEVVSERELHFRVWE
DAPF_PROMT      GVITLKDQILNVYAASMGNPHMIVFVNDIEGIPFQEWGSFLEKHNTFPNDTNVHFVEIIDKSNIKVKVWE
DAPF_BACCN      IREDFHNQRYAFTAVSMGNPHAVIFVDDVEKAPLTTLGPVLENHEMFPERVNVEFIEILNETEMNFRVWE
DAPF_EUBR3      RVIDAGNREWHMTCVSMGNPHAVVFVDDVAGFELEKYGPLFENHKMFPKRTNTEFVEILSRNEAKMRVWE
DAPF_ZYMMO      LSMPVAWEDLEPTAVNMGNPHXXXXXXXXXXXXXGRLGNMIEHDQLFPERINVNIVMVTGKDHLKMRTWE
DAPF_RHOPT      RMIELQIGPIDASVVSMGNPHAIFWVDDVNAYDLGRFGPLLENHPIFPERANITLAHIVDRQHITMRTWE
DAPF_CAUSK      VGIELQVGPIDAGCVSMGNPHVVFFVDAVSDAFARGTGSLVEHHPLFPEGVNVGFAHIAARDHIKLKVWE
DAPF_BACCR      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEKAPLTTLGPVLETHEMFPERVNVEFIEILNEDEMNFRVWE
DAPF_BACC1      INFLYNNHRYAFTAVSMGNPHAVIFVDDVDQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_BACC4      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEKAPLTTLGPVLETHEMFPERVNVEFIEILNDDEMNFRVWE
DAPF_ALKMQ      FQLMIDGEKYTISTVLLGVPHTIIFMETLDLDRVKRVGKIIENHQLFPENTNVNFAQIINQNTIRVRTWE
DAPF_RHOPS      RSIELQIGPIDASVVSMGNPHAIFWVDDIEAHDLGRFGPLLENHPIFPERANITLAHIVDRDHITMRTWE
DAPF_PARD8      YTGTV---------ISMGNPHLVIFVDEMDQVGLASVGPLLECLPLFPDRTNVEFVQVLKPDEVRMRVWE
DAPF_BACCZ      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_BACC2      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNDAEMNFRVWE
DAPF_BACAN      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_BACAC      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_BACAA      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_BACWK      INFLYNNHRYAFTAVSMGNPHAVIFVDDVENAPLTTLGPVLETHEMFPERVNVEFIEILNDEEMNFRVWE
DAPF_BACHK      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_BACC7      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_BACC3      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_BACC0      INFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_THETN      EPVKIDGKTYRLSSVRVGVPHTILFVSSFEESFMKELGPKIEKSSLFPEGTNVDFVKVEDEENISVRTWE
DAPF_CAUCR      VELQIDAPLVHTPVVSMGNPHVVFFVDAPVTDDFARGGSLVEHHPLFPEGVNVGFAHIASRDHIRLKVWE
DAPF_CAUCN      VELQIDAPLVHTPVVSMGNPHVVFFVDAPVTDDFARGGSLVEHHPLFPEGVNVGFAHIASRDHIRLKVWE
DAPF_BACAH      INFLYNNHRYAFTAVSMGNSHAVIFVDDVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWE
DAPF_RHOPA      RMIELQIGPIDASVVSMGNPHAIFWVDDVNAYDLGRFGPLLENHPIFPERANITLAHIVDRQHITMRTWE
DAPF_RHOP2      RGIELQIGPIDASVVSMGNPHAIFWVDDIHAYDLGQFGPLLENHPIFPERANITLAHIVDRQHITMRTWE
DAPF_BRAJA      IELQIGPIDNPISVVSMGNPHAIFWVDDVNAYDLARFGPLLENHPIFPERANITLAHIVDRDHITIRTWE
DAPF_BACP2      GTTTLNGT-----AVSMGNPHIVFYLEDIEKAPLDTLGPIIEKHDMFPEGVNVEFVEVVSETELHFRVWE
DAPF_BACA2      GETELSGT-----AVSMGNPHIVFPVADINQAPLTTLGPVIEKDPRFPEGVNVEFVETVSADELHFRVWE
DAPF_GEOSW      VPFEVDGKQYEITAVSMGNPHVIFYVDDITTAPVTTLGPIVEKDERFPEGXXXXXXXXXXDHELHFRVWE
DAPF_BACHD      VAFTIGEKEYRLTAVSMGNPHAIMFIDTIEDAPVEQVGPLLEKHEAFPDWVNVEFVQVVSPTEIHFRVWE
DAPF_BACSU      INETMAFGEVELTAVSMGNPHIVFPIADIEQAPLTTLGPVIEKDPRFPEGINVEFVETVNEQELHFRVWE
DAPF_RHOS4      -SLPLEGTP---SAVGMGNPHCIYFVEDAEAVDLAGRGAAVETDPLFPERTNVEFASLIGPDRLRLRVWE
DAPF_RHOPB      RSIELQIGPIDASVVSMGNPHAIFWVDDVNAHDLARFGPLLENHPIFPERANITLAQIVDRDHIVIRTWE
DAPF_BACLD      INEKMGGREMKGTAVSMGNPHIVFYLDDIEKAPLTTMGPLIEKDERFPXXXXXXXXXXXXXXXLHFRVWE
DAPF_GEOKA      VVAEIAGGEYEITAVSMGNPHVIFYVDDIQKAPVTTLGPLVEKDPRFPXXXXXXXXXXXXXXXLHFRVWE
DAPF_WOLWR      LPIELEMLKDPV-AVNIGNPHIVFFVDSVNEIPLQSLGPKLENHALFPQKINISIAQVEKSGEIALRVWE
DAPF_AZOPC      YTIDFSSEQWILTAVSMGNPHVVIFVEKVSRLDVKRIGKEIEHHPMFPEKINVDFVEILSLYHAKMRVWE
DAPF_ARCFU      YEVEHDGRKFRIYAANTGVPHVAVFVDSLDIVPLAR---KIRYSEIFPEGTNVNFAK-VDGDTITVRTYE
DAPF_BACTN      FGDQFPFQSTR---VSMGNPHLVTFVEDITQINLPEIGPQLENYHLFPDRTNVEFAQIVGKDTIRMRVWE
DAPF_ACICJ      LSLRLAGPVQNPAACSMGNPHATFFVDDLTHLQIETIGPKLEHARLFPERANIGFARIDAPDRIRLRVWE
DAPF_WOLTR      LPIELEMLKDPV-AVNIGNPHMVFFVDNISEIPLQSLGPKLEKHTLFPKKVNVNIAQVEKSGEISLRVWE
DAPF1_ANASP     EKIFLDEGIFTFCAATIGNPHCVILLDDINSEVARNFGPIFEGYPLFPNRTNVQFMKVLDRSTIQIEIWE
DAPF_METJA      LNGELKLKKVKLSVVNVGNPHAVIFVENIDLDFVREHGKEIEHHEAFPERINVHFVKVLNPNEIRIVTWE
DAPF_NITHX      IELQVGPIDAPVSVVSMGNPHAIFWVDDVNAHDLERFGPLLENHPIFPERANITLAHIAGRDRIVMRTWE
DAPF_RHOP5      RMIELQIGPIDASAVSMGNPHAIFWVDDVHAHDLGRFGPLLENHPIFPERANITLAHIVDRTHIVIRTWE
DAPF_BRASB      IELQIGPIDAPISVVNMGNPHAVFWVDGVNSYDLERFGPLLENHPIFPERANITLAHIVDRDHITMRTWE
DAPF_BEII9      AVLPVDPDALKASMVNMGNPHAVLFVADQDACDLALVGPVLEHHPLFPDRANISIATVVSPDHIVLKVWE
DAPF_BRUME      RKIELQVDPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BRUSU      RKIELQVGPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BRUSI      RKIELQVGPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BRUO2      RKIELQVGPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BRUMB      RKIELQVGPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BRUC2      RKIELQVGPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BRUAB      RKIELQVGPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BRUA2      RKIELQVGPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BRUA1      RKIELQVGPADAPVLSMGNPHAVFWVDKVWSYELDKFGPLLENHPIFPERANISIAHVTSSDTIDLRTWE
DAPF_BARQU      YVKITAGPLKDACLVSIGNLHAIFFVDNIQQIPLEKYGPKLEHDPLFPERCNISIASVTSHKSLNLRTWE
DAPF_BRASO      IELQIGPIDAPISVVSMGNPHAVFWVDNVNSYDLERFGPLLENHPIFPERANITLAQIVDRDHITMRTWE
DAPF_UNCMA      INKPLHG--YEVTAVNTGVPHAVIFVDDVNAVDLMKVAPEIRYDLKFPKGINVNFVQ--REGHLRVRTYE
DAPF_BARBK      ----IDTNHVDITAVSVGNLHAIFFIESIQNIPLEKYGPKLEHDPLFPERCNISIAQITSKKSLTLRTWE
DAPF_METC4      RRIELQVGPIDDAAVSMGNPHAIFFVERPDSYDLGRIGPLLEAHPIFPERANISIAEVTSRDTIKLRVWE
DAPF_OLICO      IELQIGPIDAPVSVVSMGNPHAIFWVDDIEAYDLERLGPLLENHPIFPERANITLAHVVDRNHIRMRTWE
DAPF_CLOPE      KKVSVGNGNFEITSLLMGVPHTI--IFEEEKYPI-ECGRDIEKYELFPQGTNVNFCKVIDRNTMEVRTWE
DAPF_METEP      RRIELQVGPIDDAAVSMGNPHAIFFVERPDSYDLGRIGPLLEAHPIFPERANISIAEVTGRDTIKLRVWE
DAPF_META3      NDVFLD-EEIELXXXXXXXPHAVLKAPFIRT-HLNILGKEIEHHSVFPEKINVHFVEIVNPQEIKIITWE
DAPF_METS4      RRIELQIGPIDAGVVSMGNPHAVFFVDRPETYDLGRIGPLLEAHPLFPERANISLAQVVAADRIRLRVWE
DAPF_RHILW      SRIELQIGPIDNSAMSMGNPHAIFWVDRVMSYDLARFGPLLENHPMFPERANITLAQVTSPTSMTTRTWE
DAPF_AGRRK      RRIELQIGPIDNSVMSMGNPHAIFWVDKDPMSDLARFGPLLENHPMFPERANITLAQVLSPTLLRTRTWE
DAPF_METNO      RRIELQIGPIDDGVVSMGNPHAVFRDPA--SYDLARIGPLLEAHPIFPERANISVAQVRGPEHIVLRVWE
DAPF_BRAHW      FT-----------AVSMGNPHAVIFVNDLHNMDISSIGSYMENNSIFPNRTNVEFVEIINRGEVKQRTWE
DAPF_BARHE      ----IDTNHVELTAVSIGNLHAIFFVENIQYIPLEKYGSKLEHDPLFPQRCNISIACVTSQESLNLRTWE
DAPF_OCHA4      RMIELQVGPIDASVASMGNPHAIFWVDRVWSYELEKFGPLLEHHPIFPERANISIAHVTSPETIDLRTWE
DAPF_METSB      SAVDLSFGPADSAVVNMGNPHAIFFVEDIGAYDLAAIGPVLEHDPLFPERANISLARIVSPERIELKVWE
DAPF_BART1      NHIDITGPLKDACLISIGNLHAIFFVENVQHIPLEKYGPKLEHDPLFPERCNISIACITSKKSLNLRTWE
DAPF_METTP      LKVPLHG--FEVSAVNTGVPHAVIFVENLD-IPVEQIAPKIRHSSCFPEGANVNFVRL--GNHLEVRTFE
DAPF_ALKOO      FKITVGGQDFIITAVSMGVPHVIIFTEKLDLEQIKFFGPLIEKHAIFPKKTNVNFVHRIDKDNIAVRTWE
DAPF_AGRT5      SRIELQIGPIDAAVMSMGNPHAIFWVDRDPTFDLERFGPLLENHPMFPEKANITLAQVISDSALRTRTWE
DAPF_METPB      RRIELQVGPIDDAAVSMGNPHAIFFVERPDTFDLGRIGPLLEAHPIFPERANISIAQVTSRDTIKLRVWE
DAPF_RHIEC      SRIELQIGPIDNSAMSMGNPHAIFWVDKVMSYDLARFGPLLENHPMFPERANITLAQVTSPTTMTTRTWE
DAPF_RHILO      RMIELQIGPIDASAVSMGNPHAIFWVDRVWSYELERFGPLLENHPIFPERANITIAQVTSPESMIIRTWE
DAPF_PELUB      LKIEIIDRNKHIGAINVGNPHIIFFVDDIEAFDLKNIGPKIENHPLFPEKCNVTLAKVINRNLIKVKVWE
DAPF_MESSB      RKIELQVGPIDKSVASMGNPHAIFWVEDDPYSDLERFGPMLENHPIFPERANITIARVDSPEELTMRTWE
DAPF_NATTJ      RPIDTPYGIYYLTEVSTGPPHAVIFVQXXXXXXXXXXXXXXXKHDLFPYGTNVEFVKVESSNHLRVQVWE
DAPF_RHIME      RRIELQIGPIDASVASMGNPHAIFWVEDVWSYELDRFGPLLENHPIFPEXXXXXXXXXXXXQEMDLRTWE
DAPF_THEFY      -SARLADGPVHGTRISVGNPHLACRV-ARPVAEVDLSAPPLLRAEEFPQGANVEVFREVASGVLEMRVYE
DAPF_AQUAE      KTLTVDGEEVIGVFINTGVPHFXXXXXXXXXXXXIKLGRAIRFHEEFPKGTNVNFVQPVSEDTIKVRTYE
DAPF_LEIXX      RAKELPVARLGLG-IDLGNPHVVVALADESELESADLTYIPHLEPAPQGGANVEFVVPHEPGRIRMRVHE
DAPF_CORGL      STCDINGQVFAGLGVDMGNPHLACVVPGLSASALADMAPTFDQE-FFPHGVNVEIVTELEDDAVSMRVWE
DAPF_CLAM3      RAKDLQVARPGLG-IDVGNPHVVVALSSEDELAEADLAFVPQLDPEPAAGANVELVVPADPGHITMRVHE
DAPF_AGRVS      SRIELQIGPIDAAVMSMGNPHAVFWV---DRDPMSYFGPLLENHPLFPEKANITLAQVXXXXXXXXXXWE
DAPF_CORGB      STCDINGQVFAGLGVDMGNPHLACVVPGLSASALADMAPTFDQE-FFPHGVNVEIVTELEDDAVSMRVWE
DAPF_MYCA9      GEAIVGGRRFSGLAIDVGNPHCVDAVLTTEQLRILDVGPVTFDEQLFPDGVNVEVLTAPSAGTVHMRVHE
DAPF_MYCMM      --AVVGGRRLSGVAVDVGNPHLACLDPGLTPEQLAAGAPVSFDHAQFPEGVNVEVLTAPAAGVVCMRVHE
DAPF_MYCUA      --AVVGGRRLSGVAVDVGNPHLACLDPGLTPEQLAAGAPVSFDHAQFPEGVNVEVLTARAAGVVCMRVHE
DAPF_RICBR      YMIDLK----ETICVDVGNPHLVIKLELQDQKIV---GEKLQDKALFADGVNVNFAE-VRDNKIYLSVWE
DAPF_RICB8      YMIDLK----ETICVDVGNPHLVIKLELQDQKIV---GEKLQDKALFADGVNVNFAE-VRDNKIYLSVWE
DAPF_HYDS0      FKGHF---------VNTGVPHFVIXXXXXXXXXXXKVGRAIRYHEYFPKGTNVNFVAKTKNGSFRIRTYE
DAPF_RICPU      YMIDLK----ETICVDIGNPHVVIKLEPQDQKIV---GERLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_RICCN      YMIDLK----ETICVDIGNPHVVIKLEPQDQKIV---GERLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_RICAE      YMIDLK----ETICVDIGNPHVVIKLEPQDQKIV---GERLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_CLAMS      RAKDLQVARPGLG-IDVGNPHVVVXXXXXXXXXXXXXXFAPQLDPEPAEGANVELVVPADPGHITMRVHE
DAPF_RICRS      YMIDLK----ETICVDIGNPHVVIKLEPQDQKIV---GERLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_RICRO      YMIDLK----ETICVDIGNPHVVIKLEPQDQKIV---GERLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_RHOSR      SAATIDGKVFNGIGIDVGNPHCVXXXXXXXXXXXXXXXXXPGFDPGFPHGVNVEILTRIDSGAVDMRVHE
DAPF_RICFE      YMIDLK----ETICVDIGNPHLVIKLEPQDQKIV---GEKLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_RHOOB      SAATIDGKVFNGIGIDVGNPHCVXXXXXXXXXXXXXXXXXPGFDPGFPHGVNVEILTRIDSGAVDMRVHE
DAPF_CHLTE      WNCHF---------VDTGSPHAIAYVNNLDQLDVTEGGNIRHNKELFPDGTNVNFLEITAPDALSIRTFE
DAPF_RICAH      YMIDLK----ETICVDIGNPHLVIKLEPQDQKIV---GEKLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_STRCO      -------REWPARNVNMGNPHAVAFVADLDHAGDLYAPPSHAPAGAYPDGVNVEFVVDRGPRHVAMRVHE
DAPF_RICPR      YMLDLK----EMLCVDIGNPHLII-FSKLEPQDKTIIGQKLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_RICCK      YMIDLK----ETICVDVGNPHLVIKLESQDQKIV---GETLQAKELFANGVNVNFAEI-KDNKINLSVWE
DAPF_CORA7      STASMAGESFAGLGVDMGNPHLAAVIPAEDLAAKRLEQPVFDA-DFFPAGVNVELVTPLCDGVIHMRVFE
DAPF_CLOAB      FKIPELSDEFDFTAVSITNPHLIAIVNNIDSDKLVEIGKKGNSTKSLPQGVNVSFVKVIDSSNIYVKTYE
DAPF_WIGBR      IILRIFKKKITCYFVFVGNPHCIIISKNIEYNNFSLLSKYLLKNNIFPNKINISIMNILDFDLIKLKVYE
DAPF_RICM5      YMIDLK----ETICVDIGNPHLIIKLEPQDQKIV---GEKLQAKELFADGVNVNFAE-VKDNKIYLSVWE
DAPF_MYCLE      FAVTVGGRRFSGVAVDVGNPHLACMDPQLELAALDLGAPVHLDRVQFPDGVNIEVLTAPVDGMVQMRVHE
DAPF_MYCLB      FAVTVGGRRFSGVAVDVGNPHLACMDPQLELAALDLGAPVHLDRVQFPDGVNIEVLTAPVDGMVQMRVHE
DAPF_RICTY      YMLDLK----ETMCVDIGNPHLII-FSKLEPQDQKIIGQKLQAKELFVDGVNVNFAE-VKDNKIYLSVWE
DAPF_LISMF      NQVELDA-ELAFSAVSVPNPHLITFVAVLDSNKQEKLASYLNSNPYFPDGVNVSFVKRLSDDAIYVRTFE
DAPF_LISMC      NQVELDA-ELAFSAVSVPNPHLITFVAVLDSNKQEKLASYLNSNPYFPDGVNVSFVKRLSDDAIYVRTFE
DAPF_GEMAT      PIAPATAQGRRVGFAVAGIPHLVILCEXXXXXXXXXXXPALRRHEATPAGANVNWVSPRPDGSWRYRTFE
DAPF_MYCPA      FEATVGGRRFAGLAVDVGNPHLACLDPELSVDELAALAPVSFDAAQFPDGVNIEVLTAPAAGVVHMRVHE
DAPF_LISMH      NQVELD-TELAFSAVSVPNPHLITFVSVLDSDKQEKLASYLNSNPYFPDGVNVSFVKRLSDDAIYVRTFE
DAPF_LISW6      NQVELD-EELAFSAVSVPNPHLITFVTVLDSDKQEKLASFLNSNPYFPDGVNVSFVKRLNEDAIYVRTFE
DAPF_CHLPN      HRLESDPLPKEVVCIHTGVPHAVVILPEISTLDLSILGPFLRYHQTFPDGVNVNFVQILGHCQLRVRTYE
DAPF_MYCSK      GSAVVGGRRFTGLGIDVGNPHCVAELAALDVAAPVDFDP-----AQFPDGVNVEVLTALRDGAVSMRVHE
DAPF_MYCSJ      GSAVVGGRRFTGLGIDVGNPHCVAELAALDVAAPVDFDP-----AQFPDGVNVEVLTALRDGAVSMRVHE
DAPF_METKA      KKV------VELGEVDAGVPHFVRRDPIHDFGGLTDEAKTIFSEYEPKGGVNVTYA-APSVDELRVRTFE
DAPF_MYCA1      FEATVGGRRFAGLAVDVGNPHLACLDPELSVDELAALAPVSFDAAQFPDGVNVEVLTAPAAGVVHMRVHE
DAPF_ACIC1      -RARFDGRMLEGVRVSVGNPHLVCVVDTLADVDFTR-APVLDS-DEFPDGANVEVVEIERPGVLRMRVYE
DAPF_COREF      STCMIADQPFAGMGVDLGNPHLACVVPGLTPAAIALEAPVFDT-AFFPRGVNVELVTELADGAIHMRVWE
DAPF_MYCS2      GSAVVGGRSFDGLAVDVGNPHACVGITXXXXXXXXXXXPVSFDPALFPDGVNVEVLTASVDGAVSMRVHE
DAPF_FLAPJ      HD--------NYVFLNTGSPHHVQFADNLSNFDVKNEGAKIRYSDLYGQASNINFVHQTSPTQFSIRTYE
DAPF_LACPL      IKIPALSADLKFSAVAVPNPHLIAFVDH-DTLVGPELGRIGEKNQIFPDGVNVSFVEVLGPNSIFVRTFE
DAPF_LISMO      NQVELDA-ELAFSAVSVPNPHLITFVTVLDSDRQETLASYLNSNPYFPDGVNVSFVKRLSDDAIYVRTFE
DAPF_MYCTU      EAV-VGGRRFHGLAVDVGNPHCVDSQLTVDGLAALDVGPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHE
DAPF_MYCTA      EAV-VGGRRFHGLAVDVGNPHCVDSQLTVDGLAALDVGPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHE
DAPF_MYCBT      EAV-VGGRRFHGLAVDVGNPHCVDSQLTVDGLAALDVGPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHE
DAPF_MYCBP      EAV-VGGRRFHGLAVDVGNPHCVDSQLTVDGLAALDVGPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHE
DAPF_MYCBO      EAV-VGGRRFHGLAVDVGNPHCVDSQLTVDGLAALDVGPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHE
DAPF_LISIN      NQVELD-SELAFSAVSVPNPHLITFVTVLDSDKQETLASYLNSNPYFPDGVNVSFVKRLSDDAIYVRTFE
DAPF_NITSB      ----------------------------------------------------------------------
DAPF_LACS1      YIPEL-SKAIKFSAVAVPNPHLIAFVDH-ETLMGEELGRIASNNPIFPDGVNVSFVEILEPGKIFVRTFE
DAPF_CHLTR      V---LPGMPEQVFFIDTGVPHVVVFVSDLSKVPVQEWGSFLRYHEDFPEGVNVDFVQRKKDDLLLVYTYE
DAPF_CHLTB      V---LPGMPEQVFFIDTGVPHVVVFVSDLSKVPVQEWGSFLRYHEDFPEGVNVDFVQRKKDDLLLVYTYE
DAPF_CHLTA      V---LPGMPEQVFFIDAGVPHVVVFVSDLSKVPVQEWGSFLRYHEDFPEGVNVDFVQRKKDDLLLVYTYE
DAPF_CHLT2      V---LPGMPEQVFFIDTGVPHVVVFVSDLSKVPVQEWGSFLRYHEDFPEGVNVDFVQRKKDDLLLVYTYE
DAPF_MYCVP      GAATVGGRQFNGLAVDVGNPHLACVDAAMSSRELAALAPVVFDAAQFPDGVNVEVLTAPEDGAVSMRVHE
DAPF_CAMJ8      -TFEELGKTWQL--CNTGVPHLVHFCQNLD-----EFDTMLCQKMRQKYNANVNFVKILDENHLKVRTYE
DAPF_CAMJD      -TFEKLGKTWQL--CDTGVPHLVHFCQSLD-----EFDTMLCQKMRQKYNANVNFVKILDENHLKVRTYE
DAPF_CAMJE      -TFEELGKTWQL--CNTGVPHLVHFCQNLD-----EFDTMLCQKMRQKYNANVNFVKILDENHLKVRTYE
DAPF_CAMJJ      -TFEELGKTWQL--CNTGVPHLVHFCQNLD-----EFDTMLCQKMRQKYNANVNFVKILDENHLKVRTYE
DAPF_CAMJR      -TFEELGKTWQL--CDTGVPHLVHFCQNLD-----EFDTILCQKMRQKYNANVNFVKILDENHLKVRTYE
DAPF_MYCGI      GTATVGGRRFSGLAVDVGNPHLACVDEELTDAGLASLSPVAFDSTQFPHGVNVEILTAPRDGAVAMRVHE
DAPF_HELPY      ----------------------------------------------------------------------
DAPF_HELPS      ----------------------------------------------------------------------
DAPF_RHOE4      SSATIDGRVFAGVGIDVGNPHCVDELSALDLSVSPGFDPGF-----FPHGVNIEIVTPIHDGGVHMRVHE
DAPF_ENTFA      EIVPALSNTIRFTAVAVPNPHLVAFVDHETLN-----GPEFEENPYFPEGINVSFVEILGKNQLFVRTYE
DAPF_HELPH      ----------------------------------------------------------------------
DAPF_HELP2      ----------------------------------------------------------------------
DAPF_HELPJ      ----------------------------------------------------------------------
DAPF_HELPG      ----------------------------------------------------------------------
DAPF_CHLMU      XXHVLPGMPEEVFFIDTGXXXXXXXXXXXXXXXXQEWGAFLRYHEDFPNGVNVDFVQTKKEDTLLVYTYE
DAPF_CAMLR      KDRIWQG-------CNTGVPHIVTFVDDLSEFDIN-----LCKEVRKKYNANVNFAKVEDDEFIRVRTYE


                         .         .         .         +         .         .         .:280
query           RXXXXXXXXXXXXXXXXVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL
DAPF_NITOC      RXXXXXXXXXXXXXXXXVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL
DAPF_THISH      RGVGETLACGTGACAAVVSGRIQGLLDETVAVDLPGGRLVINWAGQEEAVMMTGPATQVFTGSIDI
DAPF_ALHEH      RGAGETLACGTGACAAVVSGRLRGWLEEAVDVDLPGGRLVIHWAGDGEHVWMTGPAETVFEGEIRL
DAPF_CELJU      RGAGETLACGTGACAAVVTGRLRGLLNDTVKVNLPGGSLRISWPGEGHSVIMTGPAVTVFHGQIKL
DAPF_NITMU      RXXXXXXXXXXXXXXXXXXXIQRGLLESPVRVSFSTGDLFIRWEGENQPVWMTGPAVAVFDGEIEL
DAPF_PSEAE      RGVGETQXXXXXXXXXXXXXIRQGWLQSPVQIDLPGGRLHIEWAGPGQPVMMTGPAVRVYEGQVRL
DAPF_PSEA8      RGVGETQXXXXXXXXXXXXXIRQGWLQSPVQIDLPGGRLHIEWAGPGQPVMMTGPAVRVYEGQVRL
DAPF_PSEAB      RGVGETQXXXXXXXXXXXXXIRQGWLQSPVQIDLPGGRLHIEWAGPGQPVMMTGPAVRVYEGQVRL
DAPF_PSEA7      RGVGETQXXXXXXXXXXXXXIRQGWLQSPVQIDLPGGRLHIEWAGPGQPVMMTGPAVRVYEGQVRL
DAPF_PSEU5      RXXXXXXXXXXXXXXXXXXXIRQGWMDSPVQIELPGGRLSIEWAGPGQPVMMTGPAVRVFEGQVRL
DAPF_PSEMY      RXXXXXXXXXXXXXXXXXXXIRQGWMDSPVQLELPGGKLSIEWAGEGQPVMMTGPAARVYEGQVRL
DAPF_DECAR      RGSGETMXXXXXXXXXXXXXIRRGLLDSPVRVTTRGGDLTIAWGGDERPVLMTGPAVTVFTGEIEL
DAPF_AZOVD      RXXXXXXXXXXXXXXXXXXXIRQGWMDSPVLVDLPGGRLSIAWAGPDQSVMMTGPAVRVYEGQVRL
DAPF_SHEON      RXXXXXXXXXXXXXXXXXXXQIQGKLDQQVQVDLPGGSLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_SHESR      RXXXXXXXXXXXXXXXXXXXQIQGKLDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_SHESM      RXXXXXXXXXXXXXXXXXXXQIQGKLDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_SHESA      RXXXXXXXXXXXXXXXXXXXQIQGKLDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_NITEU      RGTGETLACGTGACAAVVSGISRGLLDSEVQVTMRGGNLRIRWEGEDQPVWMTGPAVSVFEGTIDL
DAPF_SHEFN      RXXXXXXXXXXXXXXXXXXXXXXDKLDKQVRVDLPGGSLIINWEGEGKPLWMTGPAEHVYDGQIQL
DAPF_PSE14      RXXXXXXXXXXXXXXXXXXXISQGWMDSPLLIDLPGGRLSIEWAGPGHSVMMTGPAVRVYEGQVRL
DAPF_SHEDO      RXXXXXXXXXXXXXXXXXXXXXXDKLSRQVRVDLPGGTLHIDWDGEGKPLWMTGPAEHVYDGQIQL
DAPF_ALCBS      RGAGETLACGSGACAAVVIGQRRDWLDDTVTVHLPGGTLHVCYDGQG-GIQMTGPASHVYDGAIEI
DAPF_AZOSB      RXXXXXXXXXXXXXXXXXXXXXRGLLVSPVRVETRGGELEIAWAGPGTPVVMTGPAVTVFEGELEL
DAPF_PSEU2      RXXXXXXXXXXXXXXXXXXXISQGWMDSPLLIDLPGGRLSIEWAGPGHSVMMTGPAVRVYEGQVRL
DAPF_PSEPK      RXXXXXXXXXXXXXXXXXXXISQGWMDSPVSLDLPGGRLHIEWAGPGKPVMMTGPAVRVYEGQVRL
DAPF_PSEE4      RXXXXXXXXXXXXXXXXXXXXXXXWMDSPVTIDLPGGRLSIEWAGPGKPVLMTGPAVRVFEGQVRL
DAPF_PSEPG      RXXXXXXXXXXXXXXXXXXXISQGWMDSPVSLDLPGGRLHIEWAGPGKPVLMTGPAVRVYEGQVRL
DAPF_PSEPW      RXXXXXXXXXXXXXXXXXXXISQGWMDSPVSLDLPGGRLNIEWAGPGTSVLMTGPAVRVYEGQVRL
DAPF_NITEC      RXXXXXXXXXXXXXXXXXXXILRGLLDTTVQVAMHGGNLQIRWDGKDKPVWMTGPAITVFEGTIDL
DAPF_PSESM      RXXXXXXXXXXXXXXXXXXXISQGWMDSPLLIDLPGGRLSIEWAGPGHPVMMTGPATRVYEGQVRL
DAPF_SHEAM      RGAAETLXXXXXXXXXXXXXQLQGKLGSRVRVDLPGGSLTINWEGEGKPLWMTGPAQQVYDGQIQL
DAPF_SHESH      RXXXXXXXXXXXXXXXXXXXQLQGKLDNCVRVDLPGGTLTINWEGEGKPLWMTGPAEHVYDGQIQ-
DAPF_AERS4      RGVGEXXXXXXXXXXXXVIGISQGKLKERVTVSLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEL
DAPF_TOLAT      RXXXXXXXXXXXXXXXXXXXIQQEKLKGRVKVNLPGGSLYISWNGPGSPVYMTGPAEHVFDGQIEL
DAPF_SHEB9      RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_SHEB8      RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_SHEB5      RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_SHEB2      RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_HAHCH      RXXXXXXXXXXXXXXXXXXXRLRGLLDRKVEIKLPGGNLKISWEGEGHPVMMTGPAVRVFDGQVRI
DAPF_AERHH      RGVGETLXXXXXXXXXXXXXISQGKLKERVTVTLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEL
DAPF_PSEFL      RXXXXXXXXXXXXXXXXXXXISQGWMDSPLLIDLPGGRLSIEWAGPGQPVMMTGPAVRVYEGQVRL
DAPF_ACIAD      RGVGEXXXXXXXXXXXXVSGMRRGLLANEVEVELAGGKLQIAWQ-EGDVVWMTGPTANVYEGRLDL
DAPF_SHESW      RXXXXXXXXXXXXXXXXXXXQIQGKLDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_SHEPC      RXXXXXXXXXXXXXXXXXXXQIQGKLDQQVRVDLPGGTLTINWEGEGKPLWMTGPAQHVYDGQIQL
DAPF_PSEPF      RXXXXXXXXXXXXXXXXXXXISQGWMDSPLLIDLPGGRLSIEWAGPGQPVLMTGPAVRVYEGQVRL
DAPF_PSEHT      RGVNETLACGTGACAAMVIGFIQNKLISTVQVDLPGGSLQIRWNGEGHPVRMTGPAEHVFDGQVAL
DAPF_SHELP      RGAAETLXXXXXXXXXXXXXQLQGKLARRVRVDLPGGSLTINWEGEGKPLWMTGPAEHVYDGQIQ-
DAPF_SACD2      RXXXXXXXXXXXXXXXXXXXRLQGLLENTVKVNLPGGSLSITWEGVDSPVMMTGPATTVFHGQVKI
DAPF_CHRSD      RGSGETLACGTGACAAVAHGIRRGWLESPVDVHLPGGTLTLAWPAPDASLMMTGPATSVFEGRIAL
DAPF_METPP      RXXXXXXXXXXXXXXXXXXXIRLGWLRAPVDVDTRGGELTIEWAGRSDAVWMTGPAESVYVGEIDL
DAPF_HALHL      RGVGETPXXXXXXXXXXXXXRLRDWLDAPVTVELTGGVLVIHWLGPGRSVWMTGPARTVFRGEIEL
DAPF_AZOSE      RGAGETLACGTGACAAVVTVILRELAQSPVRVETRGGELDIAWEGPGQPVLMTGPAVTVFAGEIDV
DAPF_ACIBS      RCVGEXXXXXXXXXXXXVSGMRRGLLANSVEVELAGGKLQIEWQ-EGDVVWMTGPTTHVYDGRLDL
DAPF_ERWT9      RGAGETQXXXXXXXXXXXXXIQQASLAEKVRVDLPGGSLHIAWKGPGHPLYMTGPATHVYDGFIHL
DAPF_ENTS8      RGAGETQXXXXXXXXXXXXXIQQGLLAAQVRVDLPGGRLDIAWKGPGNPLFMTGPATHVYDGFIHL
DAPF_ACIBY      RGVGEXXXXXXXXXXXXVSGMRRGLLANSVEVELAGGKLQIEWQ-EGDVVWMTGPTTHVYDGRLDL
DAPF_ACIBC      RGVGEXXXXXXXXXXXXVSGMRRGLLANSVEVELAGGKLQIEWQ-EGDVVWMTGPTTHVYDGRLDL
DAPF_ACIB5      RGVGEXXXXXXXXXXXXVSGMRRGLLANSVEVELAGGKLQIEWQ-EGDVVWMTGPTTHVYDGRLDL
DAPF_ACIB3      RGVGEXXXXXXXXXXXXVSGMRRGLLANSVEVELAGGKLQIEWQ-EGDVVWMTGPTTHVYDGRLDL
DAPF_SHEWM      RXXXXXXXXXXXXXXXXXXXXXXXKLNKMVRVDLPGGTLTINWEGEGNPLWMTGPAEHVYDGQI--
DAPF_ACIBT      RGVGEXXXXXXXXXXXXVSGMRRGLLANSVEVELAGGKLQIEWQ-EGDVVWMTGPTTHVYDGRLDL
DAPF_SALTY      RGAGETRXXXXXXXXXXXXXIQQGLLAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHIYDGFIHL
DAPF_SALTI      RGAGETRXXXXXXXXXXXXXIQQGLLAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHIYDGFIHL
DAPF_SALSV      RGAGETRXXXXXXXXXXXXXIQQGLLAEEVRVELPGGRLDI