[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA56902.1

[Show Plain Result]


## Summary of Sequence Search
    1::696
  176::712     3e-35  26%  735 aa  Y3085_AZOC5 RecName: Full=Uncharacterized protein AZC_3085;
  249::800     1e-33  26%  827 aa  Y4LL_RHISN RecName: Full=Uncharacterized protein y4lL;
  337::756     2e-33  24%  783 aa  Y3311_PSEAE RecName: Full=Uncharacterized signaling protein PA3311;
  417::847     1e-32  28% 1276 aa  PHY2_SYNY3 RecName: Full=Phytochrome-like protein cph2;AltName:
  222::651     3e-32  25%  661 aa  GMR_ECOLI RecName: Full=Protein gmr;
  353::784     2e-31  24%  800 aa  YKOW_BACSU RecName: Full=Signaling protein ykoW;
  499::734     6e-30  32%  747 aa  YFGF_ECOLI RecName: Full=Inner membrane protein yfgF;
  255::781     2e-29  24%  809 aa  Y091_CAUCR RecName: Full=Uncharacterized signaling protein CC_0091;
  333::755     5e-28  26%  791 aa  MBAA_VIBCH RecName: Full=Biofilm architecture maintenance protein
  255::674     2e-25  24%  685 aa  Y1727_PSEAE RecName: Full=Uncharacterized signaling protein PA1727;
  262::685     5e-25  22%  692 aa  YPH5_THIVI RecName: Full=Uncharacterized 76.5 kDa protein in phbC
  368::781     7e-25  24%  799 aa  DOS_ECOLI RecName: Full=Heme-regulated cyclic di-GMP, cyclic AMP
  512::1089    2e-23  23% 1105 aa  YEGE_ECOLI RecName: Full=Uncharacterized protein yegE;
  495::724     4e-22  30%  729 aa  YFEA_ECOLI RecName: Full=Uncharacterized protein yfeA;
  180::559     1e-20  25%  623 aa  Y1389_MYCBO RecName: Full=Uncharacterized protein Mb1389c;
  180::559     1e-20  25%  623 aa  Y1354_MYCTU RecName: Full=Uncharacterized protein Rv1354c/MT1397;
  246::637     6e-19  24%  651 aa  YHJK_ECOLI RecName: Full=Protein yhjK;
  281::515     1e-18  27%  528 aa  YJCC_ECOLI RecName: Full=Uncharacterized protein yjcC;
  300::626     2e-18  25%  646 aa  YHDA_ECOLI RecName: Full=Uncharacterized protein yhdA;
  534::777     2e-17  30%  782 aa  YLIE_ECOLI RecName: Full=Uncharacterized protein yliE;
  291::675     2e-17  22%  696 aa  Y1895_SYNY3 RecName: Full=Uncharacterized protein sll1895;
   70::293     2e-16  30%  307 aa  Y1392_MYCBO RecName: Full=Uncharacterized protein Mb1392c;
   70::293     2e-16  30%  307 aa  Y1357_MYCTU RecName: Full=Uncharacterized protein Rv1357c/MT1400;
  266::500     8e-16  27%  518 aa  RTN_ECOLI RecName: Full=Protein rtn;
  253::490     1e-15  26%  507 aa  YCGG_ECOLI RecName: Full=Uncharacterized protein ycgG;
  274::496     5e-15  26%  516 aa  YLAB_ECOLI RecName: Full=Uncharacterized protein ylaB;
  144::407     7e-14  27%  410 aa  YDAM_ECOLI RecName: Full=Uncharacterized protein ydaM;
  144::407     7e-14  27%  410 aa  YDAM_ECO57 RecName: Full=Uncharacterized protein ydaM;
  279::440     6e-13  32%  452 aa  YCDT_ECOLI RecName: Full=Inner membrane protein ycdT;
  282::501     2e-12  28%  532 aa  YOAD_ECOLI RecName: Full=Uncharacterized protein yoaD;
  141::354     4e-12  25%  362 aa  YAHA_ECOLI RecName: Full=Cyclic di-GMP phosphodiesterase yahA;     
  150::352     2e-11  29%  359 aa  YHCK_BACSU RecName: Full=Uncharacterized protein yhcK;
  331::486     4e-11  28%  491 aa  YEAI_ECOLI RecName: Full=Inner membrane protein yeaI;
  203::368     1e-10  25%  371 aa  ADRA_ECOLI RecName: Full=Protein adrA;
  203::368     1e-10  25%  371 aa  ADRA_ECOL6 RecName: Full=Protein adrA;
  401::558     5e-09  26%  570 aa  YEDQ_SALTY RecName: Full=Cellulose synthesis regulatory protein;
  398::555     5e-09  26%  567 aa  YEDQ_SALTI RecName: Full=Cellulose synthesis regulatory protein;
  401::558     5e-09  26%  570 aa  YEDQ_SALPA RecName: Full=Cellulose synthesis regulatory protein;
  401::558     5e-09  26%  570 aa  YEDQ_SALCH RecName: Full=Cellulose synthesis regulatory protein;
  161::283     7e-09  27%  296 aa  YDEH_ECOLI RecName: Full=Uncharacterized protein ydeH;
    6::238     9e-09  24%  407 aa  YKUI_BACSU RecName: Full=Uncharacterized EAL-domain containing
  292::449     5e-08  26%  454 aa  PLED_CAUCR RecName: Full=Response regulator pleD;AltName:
  298::457     2e-07  22%  460 aa  YDDV_SHISS RecName: Full=Diguanylate cyclase yddV;       
  298::457     3e-07  22%  460 aa  YDDV_SHIBS RecName: Full=Diguanylate cyclase yddV;       
  298::457     3e-07  22%  460 aa  YDDV_ECOLI RecName: Full=Diguanylate cyclase yddV;       
  298::457     3e-07  22%  460 aa  YDDV_ECO57 RecName: Full=Diguanylate cyclase yddV;       
  134::269     4e-07  26%  315 aa  YNEF_ECOLI RecName: Full=Uncharacterized protein yneF;
  134::269     4e-07  26%  315 aa  YNEF_ECO57 RecName: Full=Uncharacterized protein yneF;
  417::572     9e-07  23%  579 aa  YTRP_BACSU RecName: Full=Uncharacterized protein ytrP;
  177::290     1e-04  23%  341 aa  YEAP_ECOLI RecName: Full=Probable diguanylate cyclase yeaP;        
    1::696

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y3085_AZOC5     ----------------------------------------------------------------------
Y4LL_RHISN      ----------------------------------------------------------------------
Y3311_PSEAE     ----------------------------------------------------------------------
PHY2_SYNY3      ----------------------------------------------------------------------
GMR_ECOLI       ----------------------------------------------------------------------
YKOW_BACSU      ----------------------------------------------------------------------
YFGF_ECOLI      ----------------------------------------------------------------------
Y091_CAUCR      ----------------------------------------------------------------------
MBAA_VIBCH      ----------------------------------------------------------------------
Y1727_PSEAE     ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
DOS_ECOLI       ----------------------------------------------------------------------
YEGE_ECOLI      ----------------------------------------------------------------------
YFEA_ECOLI      ----------------------------------------------------------------------
Y1389_MYCBO     ----------------------------------------------------------------------
Y1354_MYCTU     ----------------------------------------------------------------------
YHJK_ECOLI      ----------------------------------------------------------------------
YJCC_ECOLI      ----------------------------------------------------------------------
YHDA_ECOLI      ----------------------------------------------------------------------
YLIE_ECOLI      ----------------------------------------------------------------------
Y1895_SYNY3     ----------------------------------------------------------------------
Y1392_MYCBO     ----------------------------------------------------------------------
Y1357_MYCTU     ----------------------------------------------------------------------
RTN_ECOLI       ----------------------------------------------------------------------
YCGG_ECOLI      ----------------------------------------------------------------------
YLAB_ECOLI      ----------------------------------------------------------------------
YDAM_ECOLI      ----------------------------------------------------------------------
YDAM_ECO57      ----------------------------------------------------------------------
YCDT_ECOLI      ----------------------------------------------------------------------
YOAD_ECOLI      ----------------------------------------------------------------------
YAHA_ECOLI      ----------------------------------------------------------------------
YHCK_BACSU      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YKUI_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVRDVVLKSRPLRLQSVIKRELQDLENRRARRHSEMV
Y3085_AZOC5     --------------------------------------------------------------ARSGTEGL
Y4LL_RHISN      ------------------------------------------------------VEDIDDRRKMFEA---
Y3311_PSEAE     ----------------------------------------------------------------------
PHY2_SYNY3      ----------------------------------------------------------------------
GMR_ECOLI       ----------------------------------------------------------------------
YKOW_BACSU      ----------------------------------------------------------------------
YFGF_ECOLI      ----------------------------------------------------------------------
Y091_CAUCR      ----------------------------------------------------------------------
MBAA_VIBCH      ----------------------------------------------------------------------
Y1727_PSEAE     ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
DOS_ECOLI       ----------------------------------------------------------------------
YEGE_ECOLI      ---------------------------------GIRHIALANRVLNKEGEVERLLGNMDMTEVKQLNEAL
YFEA_ECOLI      ----------------------------------------------------------------------
Y1389_MYCBO     ----------------------------------------------------------------------
Y1354_MYCTU     ----------------------------------------------------------------------
YHJK_ECOLI      ----------------------------------------------------------------------
YJCC_ECOLI      ----------------------------------------------------------------------
YHDA_ECOLI      ----------------------------------------------------------------------
YLIE_ECOLI      ----------------------------------------------------------------------
Y1895_SYNY3     ----------------------------------------------------------------------
Y1392_MYCBO     ----------------------------------------------------------------------
Y1357_MYCTU     ----------------------------------------------------------------------
RTN_ECOLI       ----------------------------------------------------------------------
YCGG_ECOLI      ----------------------------------------------------------------------
YLAB_ECOLI      ----------------------------------------------------------------------
YDAM_ECOLI      ----------------------------------------------------------------------
YDAM_ECO57      ----------------------------------------------------------------------
YCDT_ECOLI      ----------------------------------------------------------------------
YOAD_ECOLI      ----------------------------------------------------------------------
YAHA_ECOLI      ----------------------------------------------------------------------
YHCK_BACSU      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YKUI_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGESERQVRALLESSRDAVGYVHEGMHIYANRAYLELFGYHELDEIEGMPLLDMIAPEEHNRFKAFLKEY
Y3085_AZOC5     VSEAAR--RAMLDTSIDAVIVADEGAIVEFNHAAEAIFG-HTREGVIGRPMTETIIPAHYRHRQGFMRHL
Y4LL_RHISN      LKESEARFRAIADDAPVMIWVTGEGADDYHSRLWLETTG-QTAEQAAGKGWLNAVHPDDRNAVRVFYQAF
Y3311_PSEAE     ----------------------------------------------------------------------
PHY2_SYNY3      ----------------------------------------------------------------------
GMR_ECOLI       ----------------------------------------------------------------------
YKOW_BACSU      ----------------------------------------------------------------------
YFGF_ECOLI      ----------------------------------------------------------------------
Y091_CAUCR      ------RIRRLANAAYEGLVVVQSGRINDANAAFCDLVGA-PLAELVGRPLFEILTFDEADPSREDVRRE
MBAA_VIBCH      ----------------------------------------------------------------------
Y1727_PSEAE     ----------------------------------------------------------------------
YPH5_THIVI      ----------------------------------------------------------------------
DOS_ECOLI       ----------------------------------------------------------------------
YEGE_ECOLI      FQEKER-LHITLDSIGEAVVCIDMAMKITFMNPVAEKMSGWTQEEALGVPLLTVLHITFGDNGPLMENIY
YFEA_ECOLI      ----------------------------------------------------------------------
Y1389_MYCBO     ----------------------------------------------------------------------
Y1354_MYCTU     ----------------------------------------------------------------------
YHJK_ECOLI      ----------------------------------------------------------------------
YJCC_ECOLI      ----------------------------------------------------------------------
YHDA_ECOLI      ----------------------------------------------------------------------
YLIE_ECOLI      ----------------------------------------------------------------------
Y1895_SYNY3     ----------------------------------------------------------------------
Y1392_MYCBO     ----------------------------------------------------------------------
Y1357_MYCTU     ----------------------------------------------------------------------
RTN_ECOLI       ----------------------------------------------------------------------
YCGG_ECOLI      ----------------------------------------------------------------------
YLAB_ECOLI      ----------------------------------------------------------------------
YDAM_ECOLI      ----------LIDPSRD-------GQIVDANLAALNFYGYHETMCQKHTWEINMLG----RRVMPIMHEI
YDAM_ECO57      ----------LIDPSRD-------GQIVDANLAALNFYGYHETMCQKHTWEINMLG----RRVMPIMHEI
YCDT_ECOLI      ----------------------------------------------------------------------
YOAD_ECOLI      ----------------------------------------------------------------------
YAHA_ECOLI      ----------------------------------------------------------------------
YHCK_BACSU      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YKUI_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GASEGKSAHFTLRAHKADGHTFTAAWEFTPASIEGEFCTQIVIRDKTYDLAAEERIKQVQQRDILTGFFS
Y3085_AZOC5     ATGENHIMRVEVEALRADGSVFPAELTVNEHRAGGRRLFSAFVRDISDRITSRRALERLAFTDMHTGLSN
Y4LL_RHISN      DLREPVRMEYRLK--RAGGGS---AWVIDIGASDGTFLGFVGINAEQERLLAQKQIHHMARHDALTGLPN
Y3311_PSEAE     ---------------------------------------------------AHASLRQMARYDSLTGLQN
PHY2_SYNY3      -------------------------------AITQQFVTRLITQQTAYD-----PLTQLPNWII----FN
GMR_ECOLI       --------------------------------------------DITEERRAQERLRILANTDSITGLPN
YKOW_BACSU      ----------------------------------------VICKDMTKQYKAEKEIHRMAHYDSLTDLPN
YFGF_ECOLI      ----------------------------------------------------------------------
Y091_CAUCR      GRLRP-----LVGGREIPVEVFSRLMD-DGARVETSGLTVLAVRDLRERRAAEEKIRYLAEHDGLTGLLN
MBAA_VIBCH      -----------------------------------------------------QRTKALAENDHLTKLAN
Y1727_PSEAE     ---------------------------------------------------ANRELIQLALHDNLTKLPN
YPH5_THIVI      ----------------------------------------------------QDRRTLVNRRETAGGFLP
DOS_ECOLI       ---------------------------------------------------SRQHIEQLIQFDPMTGLPN
YEGE_ECOLI      SADTSRSAEQDVVLHCRSGGSYDVHYSITPLSLDGSIGSVLVIQDVTESRKMLRQLSYSASHDALTHLAN
YFEA_ECOLI      ----------------------------------------------------------------------
Y1389_MYCBO     -------------------------------------------------------LRYLADHDDLTGLHN
Y1354_MYCTU     -------------------------------------------------------LRYLADHDDLTGLHN
YHJK_ECOLI      ----------------------------------------------------------------------
YJCC_ECOLI      ----------------------------------------------------------------------
YHDA_ECOLI      ----------------------------------------------------------------------
YLIE_ECOLI      ----------------------------------------------------------------------
Y1895_SYNY3     ----------------------------------------------------------------------
Y1392_MYCBO     ----------------------------------------------------------------------
Y1357_MYCTU     ----------------------------------------------------------------------
RTN_ECOLI       ----------------------------------------------------------------------
YCGG_ECOLI      ----------------------------------------------------------------------
YLAB_ECOLI      ----------------------------------------------------------------------
YDAM_ECOLI      SHLPGGHKPLNFVHKLADGSTRHVQTYAGPIEIYGDKLMLCIVHDITEQKRLEEQLEHAAHHDAMTGLLN
YDAM_ECO57      SHLPGGHKPLNFIHKLADGSTRHVQTYAGPIEIYGDKLMLCIVHDITEQKRLEEQLEHAAHHDAMTGLLN
YCDT_ECOLI      --------------------------------------------------------KNIAHRDPLTNIFN
YOAD_ECOLI      ----------------------------------------------------------------------
YAHA_ECOLI      ----------------------------------------------------------------------
YHCK_BACSU      -----------------DLHSYELHLYFWIISIAGGMLSLYIIDHETNAHLLFKQYKFQAHFDFLTGVYN
YEAI_ECOLI      --------------------------------------------------------------DVLTNIYN
ADRA_ECOLI      ----------------------------------------------------KRRLQVMSTRDGMTGVYN
ADRA_ECOL6      ----------------------------------------------------KRRLQVMSTRDGMTGVYN
YEDQ_SALTY      --------------------------------------------------------------DPLTRLYN
YEDQ_SALTI      --------------------------------------------------------------DPLTRLYN
YEDQ_SALPA      --------------------------------------------------------------DPLTRLYN
YEDQ_SALCH      --------------------------------------------------------------DPLTRLYN
YDEH_ECOLI      ----------------------------------------------------------------------
YKUI_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      --------------------------------------------------------------DQLTGLHN
YDDV_SHISS      --------------------------------------------------------------DVLTKLLN
YDDV_SHIBS      --------------------------------------------------------------DVLTKLLN
YDDV_ECOLI      --------------------------------------------------------------DVLTKLLN
YDDV_ECO57      --------------------------------------------------------------DVLTKLLN
YNEF_ECOLI      --------------------------------------------------AINSLMKQVALRDFLTQVYS
YNEF_ECO57      --------------------------------------------------AINSLMKQVALRDFLTQVYS
YTRP_BACSU      -----------------------------------------------------DRLEHLVKTDQLTELYS
YEAP_ECOLI      --------------------------------------------------------------DSLTGLPN


                         .         *         .         .         .         .         +:350
query           RPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGIGASDLVVVDVARILQQYCDEKVILARFGD
Y3085_AZOC5     RTGLLRL------CTGRPTRPSGAVVLMLRDLGVVKTSFGDDWAEPMIVETANLLSRMLPQEACLGRTGE
Y4LL_RHISN      RQFLREEFER-LSDHIAPSTRLAILCLDLDGFKAINDAYGRATGDLLLRHVTERLRNFLKQSDILCRLGD
Y3311_PSEAE     RTAFNEVFVQHLENCRLRGKGLAVMFLDLDHFKRINDSLGHDSGDQLLKIVSERIRSVLRDSDVVARFAG
PHY2_SYNY3      RQLTLALLDALYEGKMVG-----VLVIAMDRFKRINESFGHKTGDGLLQEVADRLNQXXXXXXXXXRWHG
GMR_ECOLI       RNAMQDLIDHAI--NHADNNKVGVVYLDLDNFKKVNDAYGHLFGDQLLRDVSLAILSCLEHDQVLARPGG
YKOW_BACSU      RRHAISHLTKVLNREHSLHYNTVVFFLDLNRFKVINDALGHNVGDQLLQFAAKRLSSVVPDNGFIARLGG
YFGF_ECOLI      ----------------------------------------------------------------------
Y091_CAUCR      RNSLQMRLAAAIDRVEASGESLAVICIDLDHFKEANDQHGHLAGDALLVETARRLQSAVQAPSFAARLGG
MBAA_VIBCH      R--YQFQVQADLLLSRCYDTQHIVMYIDLDNFKYVNDKYGHQIGDSLLVSFATHVRQLCNTYSIAARLSG
Y1727_PSEAE     RMLLDDRLEQAIQQAIRDDRRFAVLFMDLDGFKAVNDAYGHHLGDLLLIEVAERIRANVRAQDTIARLGG
YPH5_THIVI      RDVFMRHLEQITRAREAQGGVHGLVIIDVDGSQGILNALGLTATXXXXXXXXXXXXXTMTPEESATRMDD
DOS_ECOLI       RNNLHNYLDDLVDKA-----VSPVVYIGVDHIQDVIDSLGYAWADQALLEVVNRFREKLKPDQYLCRIEG
YEGE_ECOLI      RASFEKQLRILLQTVNSTHQRHALVFIDLDRFKAVNDSAGHAAGDXXXXXXXXXXXXXXXXXDVLARLGG
YFEA_ECOLI      ----------------------------------------------------------------------
Y1389_MYCBO     RRALLQHLDQRLAPGQPGP--VAALFLDLDRLKAINDYLGHAAGDQFIHVFAQRIGDALVGESLIARLGG
Y1354_MYCTU     RRALLQHLDQRLAPGQPGP--VAALFLDLDRLKAINDYLGHAAGDQFIHVFAQRIGDALVGESLIARLGG
YHJK_ECOLI      ----MEMLEQVV----ARKQTTALMIITCETLRDTAGVLKEAQREILLLTLVEKLKSVLSPRMILAQISG
YJCC_ECOLI      ----------------------------------------------------------------------
YHDA_ECOLI      ---------------------------------------------------------------LLARYHR
YLIE_ECOLI      ----------------------------------------------------------------------
Y1895_SYNY3     --------------------QSSVLGLVLLGFRELQSLLGHSVADEVLKIITERLSAHVRLEDLLCRWRG
Y1392_MYCBO     ----------------------------------------------------------------------
Y1357_MYCTU     ----------------------------------------------------------------------
RTN_ECOLI       ----------------------------------------------------------------------
YCGG_ECOLI      ----------------------------------------------------------------------
YLAB_ECOLI      ----------------------------------------------------------------------
YDAM_ECOLI      RRQFYHITEPGQMQHLAIAQDYSLLLIDTDRFKHINDLYGHSKGDEVLCALARTLESCARKGDLVFRWGG
YDAM_ECO57      RRQFYHITEPGQMQHLAIAQDYSLLLIDTDRFKHINDLYGHSKGDEVLCALARTLESCARKGDLVFRWGG
YCDT_ECOLI      RNYFFN--ELTVQSASAQKTPYCVMIMDIDHFKKVNDTWGHPVGDQVIKTVVNIIGKSIRPDDLLARVGG
YOAD_ECOLI      ----------------------------------------------------------------------
YAHA_ECOLI      ----------------------------------------------------------------------
YHCK_BACSU      RRKFEETTKAYQQAADTPHFQFALIYMDIDHFKTINDQYGHHEGDQVLKELGLRLKQTIRNTDPAARIGG
YEAI_ECOLI      RRYFFNSVES--LLSRPVVKDFCVMLVDINQFKRINAQWGHRVGDKVLVSIVDIIQQSIRPDDILARLEG
ADRA_ECOLI      RRHWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGG
ADRA_ECOL6      RRHWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGG
YEDQ_SALTY      RGALFEKASRLAKRYREARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTIRAHDIAGRVGG
YEDQ_SALTI      RGALFEKASRLAKRYREARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTIRAHDIAGRVGG
YEDQ_SALPA      RGALFEKASRLAKRYREARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTIRAHDIAGRVGG
YEDQ_SALCH      RGALFEKASRLAKRYREARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTIRAHDIAGRVGG
YDEH_ECOLI      -----------------------LMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGG
YKUI_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      RRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRAIDLPCRYGG
YDDV_SHISS      RRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNVHSSDYVFRYGG
YDDV_SHIBS      RRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNVRSSDYVFRYGG
YDDV_ECOLI      RRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNVRSSDYVFRYGG
YDDV_ECO57      RRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNVRSSDYVFRYGG
YNEF_ECOLI      RSGLYEALKS---PSLKQTQHLTVMLLDIDYFKSINDNYGHECGDKVLSVFARHIQKIVGDKGLVARMGG
YNEF_ECO57      RSGLYEALKS---PSLKQTQHLTVMLLDIDYFKSINDNYGHECGDKVLSVFARHIQKIVGDKGLVARMGG
YTRP_BACSU      RAYLDEKIQYSMKIHQKG----VFILVDIDNFKNVNDTYGHQTGDEILIQVASVIKSNIRKHDVGARWGG
YEAP_ECOLI      RRAIFENLTTLFSLARHLNHKIMIAFIDLDNFKLINDRFGHNSGDLFLIQVGERLNTLQQNGEVIGRLGG


                         .         .         .         .         *         .         .:420
query           EVFTLLLPHGSDEQEDALAEQLRQAVDRHLVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLKA
Y3085_AZOC5     SEFTVVTPGAAAELAETLIGRLRSAI-----ESGGRRFYLRVGLGVVE----RPGDATYLLR--DAEMAA
Y4LL_RHISN      EFVVLRVGINSNAEARLLAQQLIDVIEAPY-ELAGTHVDLQVVVGLAAASKSDQSLDELIKTADIALERA
Y3311_PSEAE     DEFCVLADLTQDHEAHILSQRLMQKM-KEPIALDGRTLVMTASVGVSLYPNDGEQCEELLKNAGLALHQS
PHY2_SYNY3      DGFTILLTQISDNQEMILCERLLSTFQEPFF-LQGQPIYLTASMGISTAPYDGETAESLLKFAEIALTRA
GMR_ECOLI       DEFLVLASNTSQSALEAMASRILTRL-RLPFRIGLIEVYTSCSVGIALSPEHGSDSTAIIRHADTAMYTA
YKOW_BACSU      DEFIIILTDANTGEADVLARXXXXXXXXXXXXXDHTLVT-SVSIGIAISPKDGTDGLELXXXXXXXXXXX
YFGF_ECOLI      ----------------------------------------------------------------------
Y091_CAUCR      DEFIVVQIAGGDQP--AVAAELAGRLIEMLVPFDGQELAMGSSLGVSLYPDDGRTAEALMANADMALYRA
MBAA_VIBCH      DEFAILLV--SPKRFNDCAKIFAQRLLAPIQNKDNSPLSITASIGIATFPKDGEHIEKLLLNADTAMYQA
Y1727_PSEAE     DEFVLLIEAREPADAATLAEKLVKRISQPY-QISRHEVRISASIGIALYPGDGQTRHELMINADAAMYHA
YPH5_THIVI      FRYGLLAKRETLSKLEALASTLCQQLSGLKPQDRDIKLEVSVSVGVGLFDPPADDAFAMVSRXXXXXXXX
DOS_ECOLI       TQFVLVSLENDVSNITQIADELRNVVSKPIM-IDDKPFPLTLSIGISY--DLGKNRDYLLSTAHNAMDYI
YEGE_ECOLI      DEFGLLLPDCNVESARFIATRIISAVNDYHFIWEGRVHRVGASAGITLIDDNNHQAAEVMSQADIACYAS
YFEA_ECOLI      ----------------------------------------------------------------------
Y1389_MYCBO     DEFVLISPMSADAAQP-LAERLRDQLKDH-VAIGGEVLTRTVSIGVASPGQHTPSXXXXXXXXXXXXXK-
Y1354_MYCTU     DEFVLISPMSADAAQP-LAERLRDQLKDH-VAIGGEVLTRTVSIGVASPGQHTPSXXXXXXXXXXXXXK-
YHJK_ECOLI      YDFAVIA-NGVQEPWHALGQQVLTIMSERL-PIERIQLRPHCSIGVAMFYGDLTA-EQLYSRAISAAFTA
YJCC_ECOLI      ----------------------------------------------------------------------
YHDA_ECOLI      SDFAALLPHRTLKEAESIAGQLIKAVDNKMLDRDDM-----IHIGICA-WRSGQDTEQVMEHAESATRNA
YLIE_ECOLI      ----------------------------------------------------------------------
Y1895_SYNY3     DTFILLIQSCRNLDEIEVFVRRLLAVLKRPFFIANNPLYLQGYAGIACYPNHGDNVEILLNRVGIALNEV
Y1392_MYCBO     ----------------------------------------------------------------------
Y1357_MYCTU     ----------------------------------------------------------------------
RTN_ECOLI       ----------------------------------------------------------------------
YCGG_ECOLI      ----------------------------------------------------------------------
YLAB_ECOLI      ----------------------------------------------------------------------
YDAM_ECOLI      EEFVLLLPRTPLDTALSLAETIRVSVAKVSISGLPR---FTVSIGVAH-HEGNESIDELFKRVDDALYRA
YDAM_ECO57      EEFVLLLPRTPLDTALSLAETIRVSVAKVSISGLPR---FTVSIGVAH-HEGNESIDELFKRVDDALYRA
YCDT_ECOLI      EEFGVLLTDIDTERAKALAERIRENVERLTGDNPEYAIKVTISIGAVVTQENALNPNEIYRLADNALYEA
YOAD_ECOLI      ----------------------------------------------------------------------
YAHA_ECOLI      ----------------------------------------------------------------------
YHCK_BACSU      EEFAVLLPNCSLDKAARIAERIRSTVDAPIVLTNGDELSVTISLGAAHYPNNTPGSLPIL--ADQMLYKA
YEAI_ECOLI      EVFGLLFTELNSAQAKIIAERMRKNVELLTGFSNRYDVQMTISIGTVFSTGDTRNISLVMTEADKALREA
ADRA_ECOLI      DEFAVIM--SGTPAESAITAMLRVHEGLNTLRLNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKA
ADRA_ECOL6      DEFAVIM--SGTPAESAITAMLRVHEGLNTLRLNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKA
YEDQ_SALTY      EEFCIVLPGATKAQALQIAERIRQRIDKEILVTKSTTLRISASMGISSAEEYGDDFEQLQSLADKRLYYA
YEDQ_SALTI      EEFCIVLPGATKAQALQIAERIRQRIDKEILVTKSTTLRISASMGISSAEEYGDDFEQLQSLADKRLYYA
YEDQ_SALPA      EEFCIVLPGATKAQALQIAERIRQRIDKEILVTKSTTLRISASMGISSAEEYGDDFEQLQSLADKRLYYA
YEDQ_SALCH      EEFCIVLPGATKAQALQIAERIRQRIDKEILVTKSTTLRISASMGISSAEEYGDDFEQLQSLADKRLYYA
YDEH_ECOLI      EEFIIIVKAANDEEACRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEEP-LDVVIGRADRAMYEG
YKUI_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      EEFVVIMPDTALADALRIAERIRMHVSPFTVAHGREMLNVTISIGVSATAGEGDTPEALLKRADEGVYQA
YDDV_SHISS      DEFIIVLTEASENETLRTAERIRSRVEKKLKAANGEDIALSLSIGAAMF-NGHPDYERLIQIADEALYIA
YDDV_SHIBS      DEFIIVLTEASENETLRTAERIRSRVEKKLKAANGEDIALSLSIGAAMF-NGHPDYERLIQIADEALYIA
YDDV_ECOLI      DEFIIVLTEASENETLRTAERIRSRVEKKLKAANGEDIALSLSIGAAMF-NGHPDYERLIQIADEALYIA
YDDV_ECO57      DEFIIVLTEASENETLRTAERIRSRVEKKLKAANGEDIALSLSIGAAMF-NGHPDYERLIQIADEALYIA
YNEF_ECOLI      EEFAVAVPSVNPVDGLLMAEKIRKGVELQPFTWQQKTLYLTVSIGV------------------------
YNEF_ECO57      EEFAVAVPSVNPVDGLLMAEKIRKGVELQPFTWQQKTLYLTVSIGV------------------------
YTRP_BACSU      EELAIYLPNVPVAVGKRITERLVYAVRKN----TKPEVTISCGIS-CWTTETKKSLKELVHEADEALYSA
YEAP_ECOLI      DEFLVVSLNNENADISSLRERIQQQIEYHLGDVD------------------------------------


                         .         .         +         .         .         .         .:490
query           QEAGGNRIERYRPVIEDLTDQEKIKQWEVQLREAMNNKDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAG
Y3085_AZOC5     RDCRDGHLLHFAEHMR--AQHQQRLELEMALRDVIQRRSALSLHYQPVVSARTGGLVGFEALVRWYSETH
Y4LL_RHISN      KTGGGGTIVQYEPKMDDLRARQRMK---VSLRHALA-KGELEVRYQPLANLRTGQITTFEALARWPHPER
Y3311_PSEAE     KACGRNNAQFFSRQLLVRATQEL--QMEEELRQALRD-DQLELHYQPILALDGEVHQL-EALVRWRHPTQ
PHY2_SYNY3      KCQGKNTYQFYRP--QDSAPMLDRLTLESDLRQALTNQE-FVLYFQPQVALDTGKLLGVEALVRWQHPRL
GMR_ECOLI       KEGGRGQFCVFTP---EMNQRVFEYLWDTNLRKALEN-DQLVIHYQPKITWRGEVRSL-EALVRWQSPER
YKOW_BACSU      XERNKSK---YRYYSFSIGNKETVKNQEMVLREAIEN-DRFVLHYQPQFSVKKQKMTGAEALIRLVTPDG
YFGF_ECOLI      -----------------------------RLQQALEHNH-FFLMAQPITGMRGDVYH--EILLRMKGEND
Y091_CAUCR      KESGRGVYRFFKREMDD-TIRER-RNLARDLRQGIADNE-LIVHYQPLARAADGEVCGFEALVRWKHPTR
MBAA_VIBCH      KNAGKNQVAYYSQALDQIVQRRN--NIERALRLGLFDQE-FNLAYQPYFTCSGKRLVGFEVLLRWQSELL
Y1727_PSEAE     KDQGRNGYCFFESSM-NANAQEQLQLLH-DLRQALERRQ-LVLHYQPKVLAPNGPMIGVEALLRWEHPQH
YPH5_THIVI      XXXXXNQAH----VWSAASRQNGAPEAESVIKRLVSTQDGFLLFFQPILSLNQQEDELYEAQIRMKTLDG
DOS_ECOLI       RKNGGNGWQFFSPAMNEMVKERLVLG--AALKEAISNNQ-LKLVYQP--QIFAETGELYEALARWHDPLH
YEGE_ECOLI      KNGGRGRVTVYEPQQAAAHSERAAMSLDEQWRMIKEN--------QLMMLAHGEARNLWLISLKLWSCEG
YFEA_ECOLI      ------------------------------IRTALDQGD-LLLYAQPIRNKEGEGYD--EILARLKYD-G
Y1389_MYCBO     -HAGGDSVAIFTADMS--VSGELRNDIELHLRRGIES-DALRLVYLPEVDLRTGDIVGTEALVRWQHPTR
Y1354_MYCTU     -HAGGDSVAIFTADMS--VSGELRNDIELHLRRGIES-DALRLVYLPEVDLRTGDIVGTEALVRWQHPTR
YHJK_ECOLI      RHKGKNQIQFFDP--QQMEAAQKRLTEESDILNALENHQ-FAIWLQPQVEMTSGKLVSAEVLLRIQQPDG
YJCC_ECOLI      -------------------------------------KHQLCLYYQPIIDIKTEKCIGAEALLRWPGEQG
YHDA_ECOLI      GLQGGNSWAIYD---DSLPEKGRGNVRWRTLIEQMLSRGGPRLYQKPAVTREGQVHHR-ELMCRIFD-GN
YLIE_ECOLI      ------------------------------IRHAMEIGELF-LVYQPIVDINTRAILGAEALCRWVSAER
Y1895_SYNY3     KDIGSRQYCFYEESMN--SDHLERIQLEHALHQALE-RDEFLLYYQPIIDVQSGRLCGVEALIRWQHPIH
Y1392_MYCBO     ----------------------------------------FFLVYQPIIRLADNRIIGAEALLRWEHPTL
Y1357_MYCTU     ----------------------------------------FFLVYQPIIRLADNRIIGAEALLRWEHPTL
RTN_ECOLI       -------------------------------REIMTKREQFYVAYQPVVDTQALRVTGLEVLLRWRHPVA
YCGG_ECOLI      ------------------------------LRRAINNGE-IVPFYQPVVNGREGTLRGVEVLARWKQPHG
YLAB_ECOLI      -----------------------------RLQDAIENRD-ICVHYQPIVSLANGKIVGAEALARWPQTDG
YDAM_ECOLI      KNDGRNRV--------------------------------------------------------------
YDAM_ECO57      KNDGRNRV--------------------------------------------------------------
YCDT_ECOLI      KETGRNKV--------------------------------------------------------------
YOAD_ECOLI      ----------------------------------------FELFCQPLLNARSQQCIGVEILLRWNNPRQ
YAHA_ECOLI      -----------------------------------------------------------EVLVRWEHPQT
YHCK_BACSU      KETGRNRV--------------------------------------------------------------
YEAI_ECOLI      KSEGGNKV--------------------------------------------------------------
ADRA_ECOLI      KKAGRNRTE-------------------------------------------------------------
ADRA_ECOL6      KKAGRNRTE-------------------------------------------------------------
YEDQ_SALTY      KQSGRNRI--------------------------------------------------------------
YEDQ_SALTI      KQSGRNRI--------------------------------------------------------------
YEDQ_SALPA      KQSGRNRI--------------------------------------------------------------
YEDQ_SALCH      KQSGRNRI--------------------------------------------------------------
YDEH_ECOLI      KQTGRNR---------------------------------------------------------------
YKUI_BACSU      --------------------------------DILTNIDDVLPYYQAIFSAEEQKVVGYEVLGRILADSE
PLED_CAUCR      KASGRNAV--------------------------------------------------------------
YDDV_SHISS      KRRGRNRVELWK----------------------------------------------------------
YDDV_SHIBS      KRRGRNRVELWK----------------------------------------------------------
YDDV_ECOLI      KRRGRNRVELWK----------------------------------------------------------
YDDV_ECO57      KRRGRNRVELWK----------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
YTRP_BACSU      KRSGKNRL--------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GYILPEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLSDPSIHDKNLLPWLKKHLQES
Y3085_AZOC5     GPVSPALFVPLAEAGGFAERLGAWVIETAISACNVRRRAHGLAPWHINLSATEVVAPDLIERVRQTMAFH
Y4LL_RHISN      GQVSPAEFIAVAEETGLIGPLGEWILRQACT---EAVKWPPYVSVAVNLSPLQFRNQRLASTVRNSLEDT
Y3311_PSEAE     GLLGPDRFIGLAEANGMIDQLDDWVLRRACRDLRSLHLAGERLRVAVNCCASNLGRASLVDEVRHALEQA
PHY2_SYNY3      GQVAPDVFIPLAEELGLINHLGQWVLETACATQHFFRETGRRLRMAVNISARQFQDEKWLNSVLECLKRT
GMR_ECOLI       GLIPPLDFISYAEESGLIVPLGRWVILDVVRQVAKWRDKGINLRVAVNISARQLADQTIFTALKQVLQEL
YKOW_BACSU      QLRPPGEFIGVAEETGLIIDIGKWIIDEACKQARIWHDKGYDLSVAINISARQFQSKDLIPLIKDTLNKY
YFGF_ECOLI      ELISPDSFLPVAHEFGLSSSIDMWVIEHTLQFMAENRAKMPAHRFAINLSPTSVCQARFPVEVSQLLAKY
Y091_CAUCR      GMIPPLDFIPVAEENGLIEALGDWVLRRACADAAAWEKP---LRIAVNLSPIQLHNPALPTLVHEVLITT
MBAA_VIBCH      GEVSPEEFIPIAEQTGLFGTIDRWVISKAFQEISTLQAVKEPIQVSINLSSAELNSLKLAQFIHRQAEQF
Y1727_PSEAE     GLITPGQFLPLAEKTGLIVQIGEWVLDEACRQMRLWLDGGHADNIAVNLSALQFAHAGLVDSVRNALLRH
YPH5_THIVI      EQMPPAEFLSVAERAEMMPRIDRWVLRRAFEVMHAERVAHPRLRLLVHQNVMTLAAPEWFPWFRDQIIKR
DOS_ECOLI       GHVPPSRFIPLAEEIGEIENIGRWVIAEACRQLAERSQNIHIPALSVNLSALHFRSNQLPNQVSDAMHAW
YEGE_ECOLI      EIIDEQTFRRSFSDPALSHALDRRVFHEFFQQA-AKAVASKGISISLPLSVAGLSSATLVNDLLEQLENS
YFEA_ECOLI      GIMTPDKFLPLIAQFNLSARFDLQVLESLLKWLATHPCDKKGPRFSVNLMPLTLLQKNIAGRIIRLFKRY
Y1389_MYCBO     GLLAPGCFIPVAESINLAGELDRWVLRRACNEFSEWQSAGALLR--INVSAGQLVTGGFVDFVADTIGQH
Y1354_MYCTU     GLLAPGCFIPVAESINLAGELDRWVLRRACNEFSEWQSAGALLR--INVSAGQLVTGGFVDFVADTIGQH
YHJK_ECOLI      SWDLPDGLIDRIECCGLMVTVGHWVLEESCRLLAAWQERGIMLPLSVNLSALQLMHPNMVADMLELLTRY
YJCC_ECOLI      QIMNPAEFIPLAEKEGMIEQITDYVIDNVFRDLGDYLATHADRYVSINLSASDFHTSRLIARINQKTEQY
YHDA_ECOLI      EEVSSAEYMPMVLQFGLSEEYDRLQISRLIPLLRYWPEENLAIQVTVE----SLIRPRFQRWLRDTLMQC
YLIE_ECOLI      GIISPLKFITIAEDIGFINELGYQIIKTAMGEFRHFSQRASLKDDFLQLNEPHFHER-----FTTIMKEN
Y1895_SYNY3     GLVSPGLFIGLLETTGLIIPVGEWIMRTAFQHFHHAPAVDDDFRIAINLSPQQFQAPDLLPTILRILAES
Y1392_MYCBO     GTLLPGRFIDRAENNGLMVPLTAFVLEQACRHVRSDHSTDPQPFVSVNVSASTICDPGFLVLVEGVLGET
Y1357_MYCTU     GTLLPGRFIDRAENNGLMVPLTAFVLEQACRHVRSDHSTDPQPFVSVNVSASTICDPGFLVLVEGVLGET
RTN_ECOLI       GEIPPDAFINFAESQKMIVPLTQHLIARDAAELEKVLPVG--VKFGINIAPDHLHSESFKADIQKLLTSL
YCGG_ECOLI      GYISPAAFIPLAEKSGLIVPLTQSLVARQMNAIASKLPEG--FHIGINFSASHIISPTFVDECLNFRDSF
YLAB_ECOLI      SWLSPDSFIPLAQQTGLSEPLTLLIIRSVFEDMGDWLRQHPQQHISINLESPVLTSEKIPQLLRDMINHY
YDAM_ECOLI      ----------------------------------------------------------------------
YDAM_ECO57      ----------------------------------------------------------------------
YCDT_ECOLI      ----------------------------------------------------------------------
YOAD_ECOLI      GWISPDVFIPIAEEHHLIVPLTRYVMAET---IRQRHVFPMSSQFHVGINVAPSHFRRGV--LIKDLNQY
YAHA_ECOLI      GIIPPDQFIPLAESSGLIVIMTRQLMKQTADILMPKHLLPDNFHIGINVSAGCFLAAGFEKECLNLVNKL
YHCK_BACSU      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YKUI_BACSU      IQSLGPFFLDAGIPEEYKLEVDNRIIRQALD------------RFLEADSDLLIQDANLLMLLLKEYEAK
PLED_CAUCR      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GLDARSLIFEISESSALNYLKRVQQLVEGLRVLGCQFALEHVGTGLDTSNCLKHINVDYLKIDGAFIENL
Y3085_AZOC5     GLPPQCVCFELTESAILNQPEIAIETLSRLRALGCTTAIDDFGTGYSSLSYLQRLPMDVLKIDRSFVLDM
Y4LL_RHISN      GLDASRLQLEITESVLLEECDSNLQTLKEIRQLGVIVAIDDFGTGYSSLSYLRTFPFDKIKVDRSFIADL
Y3311_PSEAE     GLAACFLELEVTEDALMYNIDQTIPLLERLRELGVSLSIDDFGTGYSSLAYLRRLPLDALKVDRSFIMDI
PHY2_SYNY3      GMPPEDLELEITESLMMEDIKGTVVLLHRLREEGVQVAIDDFGTGYSSLSILKQLPIHRLKIDKSFVNDL
GMR_ECOLI       NFEYCPIDVELTESCLIENDELALSVIQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQVFVRDI
YKOW_BACSU      QLPPQLLEVEVTESMTMDNLNHSKKVLSSLTELGIRISIDDFGTGHSSLSYLKDFPIHRLKIDKSFIDDI
YFGF_ECOLI      QIEAWQLIFEVTESNALTNVKQAQITLQHLQELGCQIAIDDFGTGYASYARLKNVNADLLKIDGSFIRNI
Y091_CAUCR      GLSPSRLELEITESALFKDYQRALDNLRRLKALGVRIAMDDFGTGFSSLSTLQSFPFDKIKIDKSFVENI
MBAA_VIBCH      GVSPAWIDFEITETFAAD--SQSFPLLHELSRLGYGLTIDDFGSGYTSITQLVQYPVQKIKFDRHFLDTL
Y1727_PSEAE     SLEPSHLILEVTESTAMRDADASLVILEQLSAMGVGISIDDFGTGYSSLLYLKRLPASELKIDRGFINEL
YPH5_THIVI      NLTQIYPVLELQMADVRQNRAEAKVFIERLRKYGIQVCVANVTGIREEISLLARIGATLAKL-------A
DOS_ECOLI       GIDGHQLTVEITESMMMEHDTEIFKRIQILRDMGVGLSVDDFGTGFSGLSRLVSLPVTEIKIDKSFVDRC
YEGE_ECOLI      XXXXXXXXXXXXAEAILDHAESVQKL----RLAGCRIVLSQVGRDLQIFNSLKANMADYLLLDGELCANV
YFEA_ECOLI      HISPQAVILEITEEQAFSNAESSMYNIEQLHKFGFRIAIDDFGTGYANYERLKRLQADIIKIDGVFVKDI
Y1389_MYCBO     GLDASSVCLEITENVVVQDLHTARATLARLKEVGVHIAIDDFGTGYSAISLLQTLPIDTLKIDKTFVRQL
Y1354_MYCTU     GLDASSVCLEITENVVVQDLHTARATLARLKEVGVHIAIDDFGTGYSAISLLQTLPIDTLKIDKTFVRQL
YHJK_ECOLI      RIQPGTLILEVTESRRIDDPHAAVAILRPLRNAGVRVALDDFGMGYAGLRQLQHMKIDVLKIDKMFVEGL
YJCC_ECOLI      AVRPQQIKFEVTEHAFLD-VDKMTPIILAFRQAGYEVAIDDFGIGYSNLHNLKSLNVDILKIDKSFVETL
YHDA_ECOLI      EKSQRKIIIELAEADVGQHISRLQPVIRLVNALGVRVAVNQAGLTLVSTSWIKELNVELLKLHPGLVRNI
YLIE_ECOLI      GLKANSLCVEITETVIERINEHFYLNIEQLRKQGVRISIDDFGTGLSNLKRFYEINPDSIKVDSQFTGDI
Y1895_SYNY3     SLPPHRLEVEITENIVMQNVTATQNLLNALQSHGIRLSMDDFGTGYSSLSYLKTFPFNTLKIDRSFTKDI
Y1392_MYCBO     GLPAHALQLELAEDARLSRDEKAVTRLQELSALGVGIAIDDFGIGFSSLAYLPRLPVDVVKLGGKFIECL
Y1357_MYCTU     GLPAHALQLELAEDARLSRDEKAVTRLQELSALGVGIAIDDFGIGFSSLAYLPRLPVDVVKLGGKFIECL
RTN_ECOLI       PAHHFQIVLEITERDMLKE-QEATQLFAWLHSVGVEIAIDDFGTGHSALIYLERFTLDYLKIDRGFINAI
YCGG_ECOLI      TRRDLNLVLEVTEREPLNVDESLVQRLNILHENGFVIALDDFGTGYSGLSYLHDLHIDYIKIDHSFVGRV
YLAB_ECOLI      QVNPRQIALELTEREFADP-KTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDAL
YDAM_ECOLI      ----------------------------------------------------------------------
YDAM_ECO57      ----------------------------------------------------------------------
YCDT_ECOLI      ----------------------------------------------------------------------
YOAD_ECOLI      WFSAQQLILEITERDAL--LDVDYRIARELHRKNVKLAIDDFGTGNSSFSWLETLRPDVLKIDKSFTAAI
YAHA_ECOLI      GNDKIKLVLELTERNPIPVTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFPVDFIKIDKSFVQMA
YHCK_BACSU      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YKUI_BACSU      GIELHRFVLEITEHNFEGDIEQLYHMLAYYRTYGIKIAVDNIGKESSNLDRIALLSPDLLKIDLQALKVS
PLED_CAUCR      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LQDEQNQEAVKIIIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQEPNQFLSYEFSGxx
Y3085_AZOC5     VDNSRSREIVRVMIEMAHGLGMSVVAEGVETTGALQILRQMGCDRAQG------------------
Y4LL_RHISN      PKSKESLAIVRAVAAIGRSLGIITTVEGVERQDQLDTIKAEGFDEAQG------------------
Y3311_PSEAE     PASQRDMEXXXXXXXXXXKLHLKVVAEGVETPQQLAFLRENHCELVQGYLFSRP------------
PHY2_SYNY3      LNEGADTAIIQYVIDLANGLNLETVAEGIESEAQLQRLQKMGCHLGQGYFLTRP------------
GMR_ECOLI       HKQPVSQSLVRAIVAVAQALNLQVIAEGVESAKEDAFLTKNGINERQGFLFAKPMPAVAFE-----
YKOW_BACSU      QTHPKSEQITGAIIAMGHQLSLQVIAEGVENAAQKQLLFEKGCDHLQGFFFSRP------------
YFGF_ECOLI      VSNSLDYQIVASICHLARMKKMLVVAEYVENEEIREAVLSLGIDYMQGYLIGKPQPLI--------
Y091_CAUCR      HRHDRATAIVRAVLGLGRSLEIPVVAEGVETEEQILFLRGEDCAELQGYAIGRP------------
MBAA_VIBCH      IATNK-QNVIRPLIDLCHSQSMKVTAEGIESETMHQWLADYECDYMQGFYFGYP------------
Y1727_PSEAE     AHDSDDAAIVSAIVALGRTLNLKIVAEGVETEAQQEFLTRLGCNSLQGFLLGRP------------
YPH5_THIVI      FQTIRNADRIQLIVQALQARGVAVIAAGIDDQATVSRVWTCRPDFIQGNYLQLPQPELSFDF----
DOS_ECOLI       LTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRKIHCRVIQGYFFSRP------------
YEGE_ECOLI      QGNLMDEMLITIIQGHAQRLGMKTIAGPVVLPLVMDTLSGIGVDLIYGEVIAD-------------
YFEA_ECOLI      VTNTLDAMIVRSITDLAKAKSLSVVAEFVETQQQQALLHKLGVQYLQGYLIGRP------------
Y1389_MYCBO     GTNTSDLVIVRGIMTLAE------------------------------------------------
Y1354_MYCTU     GTNTSDLVIVRGIMTLAE------------------------------------------------
YHJK_ECOLI      PGD---SSMIAAIIMLAQSLNLQMIAEGVETEAQRDWLAKAGVGIAQGFLFARP------------
YJCC_ECOLI      TTHKTSHLIAEHIIELAHSLGLKTIAEGVETEEQVNWLRKRGVRYCQGWFFAKPQVFMQW------
YHDA_ECOLI      EKRTENQLLVQSLVEACSGTSTQVYATGVRSRSEWQTLIQRGVTGGQGDF----------------
YLIE_ECOLI      FGTAG--KIVRIIFDLARYNRIPVIAEGVESEDVARELIKLGCVQAQGYLYQKPMPFSAWDKSG--
Y1895_SYNY3     LHTPKDAAIIQAMXXXXXXXXXXIIAEGIEEEPQARCLYDLGCREMQGYWFSHP------------
Y1392_MYCBO     DGDIQNEQITRAMIDLGDKLGITVTAKLVETPSQAARLRAFGCKAAQG------------------
Y1357_MYCTU     DGDIQNEQITRAMIDLGDKLGITVTAKLVETPSQAARLRAFGCKAAQG------------------
RTN_ECOLI       GTETITSPVLDAVLTLAKRLNMLTVAEGVETPEQARWLSERGVNFMQGYWISRP------------
YCGG_ECOLI      NADPESTRILDCVLDLARKLSISIVAEGVETKEQLDYLNQNYITFQQGYYFYKPVTYI--------
YLAB_ECOLI      ----EYKNVTPHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQG------------------
YDAM_ECOLI      ------------------------------------------------------------------
YDAM_ECO57      ------------------------------------------------------------------
YCDT_ECOLI      ------------------------------------------------------------------
YOAD_ECOLI      GSDAVNSTVTDIIIALGQRLNIELVAEGVETQEQAKYLRRHGVHILQGYLYAQP------------
YAHA_ECOLI      SVDEISGHIVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHFLQG-YLYSPNKFIS-------
YHCK_BACSU      ------------------------------------------------------------------
YEAI_ECOLI      ------------------------------------------------------------------
ADRA_ECOLI      ------------------------------------------------------------------
ADRA_ECOL6      ------------------------------------------------------------------
YEDQ_SALTY      ------------------------------------------------------------------
YEDQ_SALTI      ------------------------------------------------------------------
YEDQ_SALPA      ------------------------------------------------------------------
YEDQ_SALCH      ------------------------------------------------------------------
YDEH_ECOLI      ------------------------------------------------------------------
YKUI_BACSU      QPSPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYLVSPSE----------
PLED_CAUCR      ------------------------------------------------------------------
YDDV_SHISS      ------------------------------------------------------------------
YDDV_SHIBS      ------------------------------------------------------------------
YDDV_ECOLI      ------------------------------------------------------------------
YDDV_ECO57      ------------------------------------------------------------------
YNEF_ECOLI      ------------------------------------------------------------------
YNEF_ECO57      ------------------------------------------------------------------
YTRP_BACSU      ------------------------------------------------------------------
YEAP_ECOLI      ------------------------------------------------------------------