[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA56917.1

[Show Plain Result]


## Summary of Sequence Search
    1::454
    1::453     e-119  47%  454 aa  GABD_SYNY3 RecName: Full=Probable succinate-semialdehyde
   15::461     e-108  46%  477 aa  GABD_DEIRA RecName: Full=Succinate-semialdehyde dehydrogenase
   11::458     e-104  44%  462 aa  YNEI_ECOLI RecName: Full=Aldehyde dehydrogenase-like protein yneI; 
    1::457     e-103  45%  472 aa  GABD1_MYCPA RecName: Full=Succinate-semialdehyde dehydrogenase
    1::457     e-103  45%  472 aa  GABD1_MYCA1 RecName: Full=Succinate-semialdehyde dehydrogenase
    1::457     e-101  45%  458 aa  GABD1_MYCUA RecName: Full=Succinate-semialdehyde dehydrogenase
    1::456     2e-90  39%  457 aa  GABD1_MYCTU RecName: Full=Succinate-semialdehyde dehydrogenase
    1::456     2e-90  39%  457 aa  GABD1_MYCTA RecName: Full=Succinate-semialdehyde dehydrogenase
    1::456     2e-90  39%  457 aa  GABD1_MYCBP RecName: Full=Succinate-semialdehyde dehydrogenase
    1::456     2e-90  39%  457 aa  GABD1_MYCBO RecName: Full=Succinate-semialdehyde dehydrogenase
    1::456     5e-87  38%  457 aa  GABD1_MYCLE RecName: Full=Succinate-semialdehyde dehydrogenase
   27::480     7e-71  35%  482 aa  GABD_ECOLI RecName: Full=Succinate-semialdehyde dehydrogenase
   25::478     2e-66  34%  487 aa  BETB1_RHIME RecName: Full=Betaine aldehyde dehydrogenase 1;        
   25::478     5e-64  33%  487 aa  BETB_SINMW RecName: Full=Betaine aldehyde dehydrogenase;       
   30::486     1e-63  31%  494 aa  AL9A1_MOUSE RecName: Full=4-trimethylaminobutyraldehyde
   25::478     2e-63  34%  487 aa  BETB_RHIE6 RecName: Full=Betaine aldehyde dehydrogenase;       
   25::478     4e-63  34%  487 aa  BETB_RHIEC RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     5e-63  32%  490 aa  BETB_YERPY RecName: Full=Betaine aldehyde dehydrogenase;       
   25::478     9e-63  33%  487 aa  BETB_RHIL3 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-62  32%  490 aa  BETB_ACIBT RecName: Full=Betaine aldehyde dehydrogenase;       
   25::478     3e-62  33%  487 aa  BETB_RHISN RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     3e-62  32%  490 aa  BETB_PSEA7 RecName: Full=Betaine aldehyde dehydrogenase;       
   30::484     3e-62  33%  493 aa  BETB_AGRT5 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     4e-62  32%  490 aa  BETB_ACIBY RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     4e-62  32%  490 aa  BETB_ACIB5 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     4e-62  32%  490 aa  BETB_ACIB3 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     5e-62  32%  490 aa  BETB_ACIBC RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     8e-62  31%  490 aa  BETB_PSEAE RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     8e-62  31%  490 aa  BETB_PSEA8 RecName: Full=Betaine aldehyde dehydrogenase;       
  100::516     1e-61  35%  523 aa  SSDH_RAT RecName: Full=Succinate-semialdehyde dehydrogenase,
   24::482     1e-61  31%  490 aa  BETB_PSEFS RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-61  31%  490 aa  BETB_PSEAB RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-61  32%  490 aa  BETB_ACIBS RecName: Full=Betaine aldehyde dehydrogenase;       
   30::486     2e-61  31%  494 aa  AL9A1_RAT RecName: Full=4-trimethylaminobutyraldehyde
  100::516     3e-61  37%  523 aa  SSDH_MOUSE RecName: Full=Succinate-semialdehyde dehydrogenase,
   24::482     3e-61  32%  490 aa  BETB_PSEMY RecName: Full=Betaine aldehyde dehydrogenase;       
   74::518     4e-61  34%  528 aa  SSDH_ARATH RecName: Full=Succinate-semialdehyde dehydrogenase,
   27::474     5e-61  32%  483 aa  BETB_RHOS5 RecName: Full=Betaine aldehyde dehydrogenase;       
   21::477     9e-61  31%  486 aa  BETB_VIBPA RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-60  31%  490 aa  BETB_ACIAD RecName: Full=Betaine aldehyde dehydrogenase;       
   43::495     1e-60  32%  503 aa  BADH_GADCA RecName: Full=Betaine aldehyde dehydrogenase;       
   21::477     3e-60  30%  486 aa  BETB_VIBSL RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     3e-60  31%  490 aa  BETB_ECO45 RecName: Full=Betaine aldehyde dehydrogenase;       
   49::506     3e-60  33%  512 aa  AL1A3_HUMAN RecName: Full=Aldehyde dehydrogenase family 1 member
   24::482     6e-60  31%  490 aa  BETB_KLEP3 RecName: Full=Betaine aldehyde dehydrogenase;       
   21::476     1e-59  30%  486 aa  BETB_VIBHB RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-59  31%  490 aa  BETB_ECO27 RecName: Full=Betaine aldehyde dehydrogenase;       
   49::506     4e-59  33%  512 aa  AL1A3_RAT RecName: Full=Aldehyde dehydrogenase family 1 member A3; 
   24::482     5e-59  31%  490 aa  BETB_ECOL6 RecName: Full=Betaine aldehyde dehydrogenase;       
   25::478     5e-59  32%  487 aa  BETB_AGRRK RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     8e-59  31%  490 aa  BETB_ECOHS RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-58  31%  490 aa  BETB_SHIF8 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-58  31%  490 aa  BETB_ECOLU RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-58  31%  490 aa  BETB_ECO24 RecName: Full=Betaine aldehyde dehydrogenase;       
  112::528     2e-58  37%  535 aa  SSDH_HYLLA RecName: Full=Succinate-semialdehyde dehydrogenase,
  112::528     2e-58  37%  535 aa  SSDH_HUMAN RecName: Full=Succinate-semialdehyde dehydrogenase,
   24::482     2e-58  31%  490 aa  BETB_ECOLC RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-58  31%  490 aa  BETB_ECO8A RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-58  31%  490 aa  BETB_ECO7I RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-58  31%  490 aa  BETB_ECO5E RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-58  31%  490 aa  BETB_ECO57 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-58  31%  490 aa  BETB_ECO55 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-58  31%  490 aa  BETB_ECOSE RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-58  31%  490 aa  BETB_ECOLI RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-58  31%  490 aa  BETB_ECODH RecName: Full=Betaine aldehyde dehydrogenase;       
   35::490     3e-58  34%  497 aa  UGA2_YEAST RecName: Full=Succinate-semialdehyde dehydrogenase
  112::528     3e-58  37%  535 aa  SSDH_PANPA RecName: Full=Succinate-semialdehyde dehydrogenase,
  112::528     3e-58  37%  535 aa  SSDH_GORGO RecName: Full=Succinate-semialdehyde dehydrogenase,
   22::481     3e-58  32%  489 aa  BETB_BURP8 RecName: Full=Betaine aldehyde dehydrogenase;       
   68::478     5e-58  35%  487 aa  BETB_RHILW RecName: Full=Betaine aldehyde dehydrogenase;       
  112::528     7e-58  37%  535 aa  SSDH_PANTR RecName: Full=Succinate-semialdehyde dehydrogenase,
   24::481     7e-58  31%  489 aa  BETB_BURXL RecName: Full=Betaine aldehyde dehydrogenase;       
   62::516     9e-58  31%  519 aa  ALDH4_YEAST RecName: Full=Potassium-activated aldehyde
  112::528     1e-57  37%  535 aa  SSDH_PONPY RecName: Full=Succinate-semialdehyde dehydrogenase,
   24::482     1e-57  31%  490 aa  BETB_ECOSM RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-57  31%  490 aa  BETB_ECOL5 RecName: Full=Betaine aldehyde dehydrogenase;       
   27::478     1e-57  32%  479 aa  ALDA_ECOLI RecName: Full=Lactaldehyde dehydrogenase;       
   26::474     2e-57  35%  485 aa  ALDH5_BACSU RecName: Full=Putative aldehyde dehydrogenase yfmT;    
   24::481     3e-57  32%  489 aa  BETB_BURPP RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     6e-57  30%  490 aa  BETB_YERP3 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     8e-57  30%  490 aa  BETB_PECCP RecName: Full=Betaine aldehyde dehydrogenase;       
   38::495     8e-57  32%  501 aa  AL1A1_HUMAN RecName: Full=Retinal dehydrogenase 1;       
   79::495     1e-56  34%  503 aa  YF19_SCHPO RecName: Full=Putative aldehyde dehydrogenase-like
   67::474     1e-56  32%  483 aa  BETB_RHOS1 RecName: Full=Betaine aldehyde dehydrogenase;       
   37::494     1e-56  32%  500 aa  AL1A1_HORSE RecName: Full=Retinal dehydrogenase 1;       
   24::482     2e-56  30%  490 aa  BETB_YERPP RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-56  30%  490 aa  BETB_YERPN RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-56  30%  490 aa  BETB_YERPE RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-56  30%  490 aa  BETB_YERPB RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     2e-56  30%  490 aa  BETB_YERPA RecName: Full=Betaine aldehyde dehydrogenase;       
   35::488     2e-56  30%  491 aa  GABD_RHISN RecName: Full=Probable succinate-semialdehyde
   67::474     2e-56  32%  483 aa  BETB_RHOSK RecName: Full=Betaine aldehyde dehydrogenase;       
   30::486     2e-56  30%  494 aa  AL9A1_HUMAN RecName: Full=4-trimethylaminobutyraldehyde
   67::474     3e-56  32%  483 aa  BETB_RHOS4 RecName: Full=Betaine aldehyde dehydrogenase;       
   30::486     3e-56  30%  494 aa  AL9A1_PONAB RecName: Full=4-trimethylaminobutyraldehyde
   58::510     3e-56  28%  518 aa  A9A1B_DANRE RecName: Full=Aldehyde dehydrogenase family 9 member
   35::491     5e-56  30%  493 aa  SSDH2_SCHPO RecName: Full=Putative succinate-semialdehyde
   24::482     5e-56  29%  490 aa  BETB_PSEPW RecName: Full=Betaine aldehyde dehydrogenase;       
   42::494     5e-56  32%  500 aa  ALDH_AGABI RecName: Full=Aldehyde dehydrogenase;       
   24::482     6e-56  30%  490 aa  BETB_YERPS RecName: Full=Betaine aldehyde dehydrogenase;       
   49::506     6e-56  32%  512 aa  AL1A3_MOUSE RecName: Full=Aldehyde dehydrogenase family 1 member
   55::512     6e-56  32%  518 aa  AL1A2_HUMAN RecName: Full=Retinal dehydrogenase 2;       
   37::491     8e-56  30%  495 aa  ALDH4_BACSU RecName: Full=Putative aldehyde dehydrogenase dhaS;    
   55::512     8e-56  32%  518 aa  AL1A2_RAT RecName: Full=Retinal dehydrogenase 2;       
   24::482     1e-55  30%  490 aa  BETB_PSESM RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-55  29%  490 aa  BETB_PSEPG RecName: Full=Betaine aldehyde dehydrogenase;       
   55::512     1e-55  32%  518 aa  AL1A2_MOUSE RecName: Full=Retinal dehydrogenase 2;       
   24::482     1e-55  30%  490 aa  BETB_ERWCT RecName: Full=Betaine aldehyde dehydrogenase;       
   36::490     2e-55  31%  496 aa  YLX7_SCHPO RecName: Full=Putative aldehyde dehydrogenase-like
   29::477     2e-55  30%  481 aa  BETB2_RHIME RecName: Full=Betaine aldehyde dehydrogenase 2;        
   24::482     3e-55  30%  490 aa  BETB_PSEU2 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     4e-55  29%  490 aa  BETB_PSEPK RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     4e-55  29%  490 aa  BETB_PSEP1 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     4e-55  30%  490 aa  BETB_PSE14 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     6e-55  29%  490 aa  BETB_PSEPF RecName: Full=Betaine aldehyde dehydrogenase;       
   56::513     6e-55  32%  519 aa  AL1B1_MOUSE RecName: Full=Aldehyde dehydrogenase X, mitochondrial; 
   54::511     7e-55  32%  517 aa  ALDH2_PONAB RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   54::511     7e-55  32%  517 aa  ALDH2_HUMAN RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   30::486     7e-55  30%  494 aa  AL9A1_BOVIN RecName: Full=4-trimethylaminobutyraldehyde
   24::482     9e-55  30%  490 aa  BETB_PSEU5 RecName: Full=Betaine aldehyde dehydrogenase;       
  498::922     9e-55  31%  923 aa  AL1L2_MOUSE RecName: Full=Probable 10-formyltetrahydrofolate
  118::491     1e-54  33%  495 aa  PUUC_ECOLI RecName: Full=Gamma-glutamyl-gamma-aminobutyraldehyde
   55::512     1e-54  32%  518 aa  AL1A2_CHICK RecName: Full=Retinal dehydrogenase 2;       
   24::481     2e-54  32%  489 aa  BETB_BURA4 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::483     2e-54  33%  501 aa  BADH1_ARATH RecName: Full=Betaine aldehyde dehydrogenase 1,
   24::482     2e-54  29%  490 aa  BETB_PSEF5 RecName: Full=Betaine aldehyde dehydrogenase;       
   43::495     2e-54  31%  500 aa  BADH_SCHPO RecName: Full=Probable betaine aldehyde dehydrogenase;  
   66::483     3e-54  33%  501 aa  BADH_AMAHP RecName: Full=Betaine aldehyde dehydrogenase,
   64::490     3e-54  32%  496 aa  AL1A1_RABIT RecName: Full=Retinal dehydrogenase 1;       
   24::482     4e-54  29%  490 aa  BETB_STRMK RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     4e-54  29%  490 aa  BETB_PSEE4 RecName: Full=Betaine aldehyde dehydrogenase;       
   71::524     5e-54  31%  534 aa  AL2B7_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member
   69::495     5e-54  33%  501 aa  AL1A1_MACFA RecName: Full=Retinal dehydrogenase 1;       
   24::482     6e-54  29%  490 aa  BETB_STRM5 RecName: Full=Betaine aldehyde dehydrogenase;       
    9::436     1e-53  31%  462 aa  GABD_BACSU RecName: Full=Succinate-semialdehyde dehydrogenase
   24::481     1e-53  32%  489 aa  BETB_BURCM RecName: Full=Betaine aldehyde dehydrogenase;       
   63::480     1e-53  32%  497 aa  BADH_SPIOL RecName: Full=Betaine aldehyde dehydrogenase,
   26::486     1e-53  29%  487 aa  AL8A1_DANRE RecName: Full=Aldehyde dehydrogenase family 8 member
  498::922     2e-53  31%  923 aa  AL1L2_HUMAN RecName: Full=Probable 10-formyltetrahydrofolate
   21::476     2e-53  28%  485 aa  BETB_MARMS RecName: Full=Betaine aldehyde dehydrogenase;       
   66::485     2e-53  33%  502 aa  BADH_ATRHO RecName: Full=Betaine aldehyde dehydrogenase,
   29::489     2e-53  32%  496 aa  ALDH_CLAHE RecName: Full=Aldehyde dehydrogenase;       
   69::495     2e-53  33%  501 aa  AL1A1_SHEEP RecName: Full=Retinal dehydrogenase 1;       
   24::482     3e-53  29%  490 aa  BETB_SERP5 RecName: Full=Betaine aldehyde dehydrogenase;       
   69::495     3e-53  32%  501 aa  AL1A1_MOUSE RecName: Full=Retinal dehydrogenase 1;       
  439::901     5e-53  29%  902 aa  FTHFD_XENTR RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
   69::495     5e-53  33%  501 aa  AL1A1_BOVIN RecName: Full=Retinal dehydrogenase 1;       
   29::487     7e-53  33%  488 aa  ALDH_BACST RecName: Full=Aldehyde dehydrogenase, thermostable;     
   72::495     7e-53  32%  501 aa  ALDH1_MACPR RecName: Full=Aldehyde dehydrogenase, cytosolic 1;     
   37::494     2e-52  31%  500 aa  ALDH2_MESAU RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   26::486     3e-52  28%  487 aa  AL8A1_HUMAN RecName: Full=Aldehyde dehydrogenase family 8 member
   55::511     3e-52  31%  517 aa  AL1A2_TAEGU RecName: Full=Retinal dehydrogenase 2;       
   72::495     3e-52  31%  501 aa  ALDH1_ELEED RecName: Full=Aldehyde dehydrogenase, cytosolic 1;     
   66::483     4e-52  33%  500 aa  BADH_BETVU RecName: Full=Betaine aldehyde dehydrogenase,
   56::513     4e-52  30%  519 aa  ALDH2_RAT RecName: Full=Aldehyde dehydrogenase, mitochondrial;     
   69::495     4e-52  34%  501 aa  AL1A1_RAT RecName: Full=Retinal dehydrogenase 1;       
   41::480     6e-52  33%  499 aa  FEAB_ECOLI RecName: Full=Phenylacetaldehyde dehydrogenase;       
   27::479     6e-52  29%  487 aa  BETB_BRUMB RecName: Full=Betaine aldehyde dehydrogenase;       
   56::513     6e-52  31%  519 aa  ALDH2_MOUSE RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   69::492     6e-52  32%  501 aa  AL1A7_MOUSE RecName: Full=Aldehyde dehydrogenase, cytosolic 1;     
   23::473     6e-52  32%  474 aa  ABDH_ERWCT RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   27::479     7e-52  29%  487 aa  BETB_BRUO2 RecName: Full=Betaine aldehyde dehydrogenase;       
   27::479     7e-52  29%  487 aa  BETB_BRUME RecName: Full=Betaine aldehyde dehydrogenase;       
   27::479     7e-52  29%  487 aa  BETB_BRUAB RecName: Full=Betaine aldehyde dehydrogenase;       
   27::479     7e-52  29%  487 aa  BETB_BRUA2 RecName: Full=Betaine aldehyde dehydrogenase;       
   27::479     7e-52  29%  487 aa  BETB_BRUA1 RecName: Full=Betaine aldehyde dehydrogenase;       
   57::514     7e-52  31%  520 aa  ALDH2_BOVIN RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   81::499     1e-51  30%  500 aa  ALDH6_YEAST RecName: Full=Magnesium-activated aldehyde
   23::473     1e-51  32%  474 aa  ABDH_PECCP RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   45::497     2e-51  29%  505 aa  AL9A1_ORYLA RecName: Full=Aldehyde dehydrogenase family 9 member
   21::485     3e-51  30%  486 aa  DMPC_PSEUF RecName: Full=2-hydroxymuconic semialdehyde
   54::511     3e-51  31%  517 aa  AL1B1_PONAB RecName: Full=Aldehyde dehydrogenase X, mitochondrial; 
  476::898     4e-51  30%  902 aa  FTHFD_MOUSE RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
   27::479     5e-51  29%  487 aa  BETB_BRUSU RecName: Full=Betaine aldehyde dehydrogenase;       
   27::479     5e-51  29%  487 aa  BETB_BRUSI RecName: Full=Betaine aldehyde dehydrogenase;       
   27::479     5e-51  29%  487 aa  BETB_BRUC2 RecName: Full=Betaine aldehyde dehydrogenase;       
   75::528     5e-51  29%  538 aa  AL2B4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member
   54::511     5e-51  31%  517 aa  AL1B1_HUMAN RecName: Full=Aldehyde dehydrogenase X, mitochondrial; 
   35::490     6e-51  30%  497 aa  ALDH_ALTAL RecName: Full=Aldehyde dehydrogenase;       
   27::479     8e-51  29%  487 aa  BETB_OCHA4 RecName: Full=Betaine aldehyde dehydrogenase;       
   93::477     8e-51  32%  490 aa  BETB_BACSU RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     1e-50  31%  490 aa  BETB_XANC5 RecName: Full=Betaine aldehyde dehydrogenase;       
   48::500     1e-50  29%  508 aa  A9A1A_DANRE RecName: Full=Aldehyde dehydrogenase family 9 member
   24::481     3e-50  29%  489 aa  BETB_CHRSD RecName: Full=Betaine aldehyde dehydrogenase;       
   20::477     5e-50  26%  486 aa  BETB_VIBVU RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     5e-50  31%  489 aa  BETB_BURS3 RecName: Full=Betaine aldehyde dehydrogenase;       
   37::488     5e-50  29%  497 aa  ALDH_ASPNG RecName: Full=Aldehyde dehydrogenase;       
   24::481     7e-50  31%  489 aa  BETB_BURCH RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     7e-50  31%  489 aa  BETB_BURCA RecName: Full=Betaine aldehyde dehydrogenase;       
   31::485     7e-50  30%  495 aa  ALDA_STAAW RecName: Full=Putative aldehyde dehydrogenase aldA;     
   31::485     7e-50  30%  495 aa  ALDA_STAAN RecName: Full=Putative aldehyde dehydrogenase aldA;     
   31::485     7e-50  30%  495 aa  ALDA_STAAM RecName: Full=Putative aldehyde dehydrogenase aldA;     
   20::477     9e-50  26%  486 aa  BETB_VIBVY RecName: Full=Betaine aldehyde dehydrogenase;       
   31::485     9e-50  30%  495 aa  ALDA_STAAR RecName: Full=Putative aldehyde dehydrogenase aldA;     
   31::485     9e-50  30%  495 aa  ALDA_STAAB RecName: Full=Putative aldehyde dehydrogenase aldA;     
   56::513     9e-50  31%  519 aa  AL1B1_RAT RecName: Full=Aldehyde dehydrogenase X, mitochondrial;   
   19::451     1e-49  30%  468 aa  HPCC_ECOLX RecName: Full=5-carboxymethyl-2-hydroxymuconate
  477::898     2e-49  31%  902 aa  FTHFD_PONAB RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
   24::481     2e-49  31%  489 aa  BETB_BURP1 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     2e-49  31%  489 aa  BETB_BURP0 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     2e-49  31%  489 aa  BETB_BURMS RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     2e-49  31%  489 aa  BETB_BURMA RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     2e-49  31%  489 aa  BETB_BURM9 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     2e-49  31%  489 aa  BETB_BURM7 RecName: Full=Betaine aldehyde dehydrogenase;       
   58::515     2e-49  30%  521 aa  ALDH2_PIG RecName: Full=Aldehyde dehydrogenase, mitochondrial;     
   31::485     2e-49  30%  495 aa  ALDA_STAAS RecName: Full=Putative aldehyde dehydrogenase aldA;     
   24::481     3e-49  31%  489 aa  BETB_BURPS RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     3e-49  31%  489 aa  BETB_BURP6 RecName: Full=Betaine aldehyde dehydrogenase;       
   31::485     3e-49  30%  495 aa  ALDA_STAAC RecName: Full=Putative aldehyde dehydrogenase aldA;     
   31::485     3e-49  30%  495 aa  ALDA_STAA8 RecName: Full=Putative aldehyde dehydrogenase aldA;     
   31::485     3e-49  30%  495 aa  ALDA_STAA3 RecName: Full=Putative aldehyde dehydrogenase aldA;     
   24::481     3e-49  30%  489 aa  BETB_BURCC RecName: Full=Betaine aldehyde dehydrogenase;       
  476::898     5e-49  30%  902 aa  FTHFD_RAT RecName: Full=10-formyltetrahydrofolate dehydrogenase;   
   24::481     5e-49  30%  489 aa  BETB_BURM1 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     6e-49  30%  490 aa  BETB_XANCB RecName: Full=Betaine aldehyde dehydrogenase;       
   24::482     6e-49  30%  490 aa  BETB_XANC8 RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     6e-49  30%  489 aa  BETB_BURCJ RecName: Full=Betaine aldehyde dehydrogenase;       
  477::898     1e-48  30%  902 aa  FTHFD_HUMAN RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
   24::482     1e-48  30%  490 aa  BETB_XANCP RecName: Full=Betaine aldehyde dehydrogenase;       
   25::482     1e-48  30%  490 aa  BETB_XANAC RecName: Full=Betaine aldehyde dehydrogenase;       
   94::485     1e-48  34%  505 aa  BADH_ORYSJ RecName: Full=Betaine aldehyde dehydrogenase;       
  438::901     1e-48  28%  902 aa  FTHFD_XENLA RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
   28::483     2e-48  30%  503 aa  BADH2_ARATH RecName: Full=Betaine aldehyde dehydrogenase 2,
   73::487     2e-48  29%  497 aa  ALDH_EMENI RecName: Full=Aldehyde dehydrogenase;       
   37::494     3e-48  30%  500 aa  ALDH2_HORSE RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   23::470     3e-48  28%  475 aa  ALD1_STAHJ RecName: Full=Putative aldehyde dehydrogenase SH0913;   
   14::460     4e-48  30%  465 aa  LADH_META3 RecName: Full=Lactaldehyde dehydrogenase;       
   41::495     1e-47  28%  498 aa  SSDH1_SCHPO RecName: Full=Putative succinate-semialdehyde
   91::479     1e-47  32%  487 aa  BETB_RHILO RecName: Full=Betaine aldehyde dehydrogenase;       
   24::481     2e-47  30%  489 aa  BETB_BURVG RecName: Full=Betaine aldehyde dehydrogenase;       
   85::503     2e-47  31%  509 aa  AL1A1_CHICK RecName: Full=Retinal dehydrogenase 1;       
   35::492     4e-47  29%  497 aa  ALDH_ENCBU RecName: Full=Aldehyde dehydrogenase;       
   69::495     4e-47  30%  501 aa  AL1A7_RAT RecName: Full=Aldehyde dehydrogenase, cytosolic 1;       
   98::513     6e-47  28%  520 aa  ALDH5_YEAS7 RecName: Full=Aldehyde dehydrogenase 5, mitochondrial; 
   16::462     7e-47  29%  465 aa  LADH_METVS RecName: Full=Lactaldehyde dehydrogenase;       
   98::513     7e-47  28%  520 aa  ALDH5_YEAST RecName: Full=Aldehyde dehydrogenase 5, mitochondrial; 
   30::437     1e-46  33%  487 aa  XYLC_PSEPU RecName: Full=Benzaldehyde dehydrogenase [NAD+];        
   66::481     3e-46  30%  517 aa  GABD2_MYCS2 RecName: Full=Putative succinate-semialdehyde
   59::486     4e-46  28%  487 aa  AL8A1_BOVIN RecName: Full=Aldehyde dehydrogenase family 8 member
   62::509     5e-46  30%  512 aa  Y4UC_RHISN RecName: Full=Putative aldehyde-dehydrogenase-like
   23::473     8e-46  33%  474 aa  ABDH_CITK8 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   39::500     1e-45  28%  506 aa  ALDH3_YEAST RecName: Full=Aldehyde dehydrogenase [NAD(P)+] 2;      
   71::519     1e-45  30%  596 aa  AL221_ARATH RecName: Full=Aldehyde dehydrogenase 22A1;       
   23::473     2e-45  30%  474 aa  ABDH_SALPA RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   29::479     3e-45  29%  484 aa  IOLA1_GEOTN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   66::481     3e-45  30%  518 aa  GABD2_MYCUA RecName: Full=Putative succinate-semialdehyde
   39::500     3e-45  28%  506 aa  ALDH2_YEAST RecName: Full=Aldehyde dehydrogenase [NAD(P)+] 1;      
   63::481     4e-45  31%  518 aa  GABD2_MYCTU RecName: Full=Putative succinate-semialdehyde
   63::481     4e-45  31%  518 aa  GABD2_MYCTA RecName: Full=Putative succinate-semialdehyde
   63::481     4e-45  31%  518 aa  GABD2_MYCBP RecName: Full=Putative succinate-semialdehyde
   63::481     4e-45  31%  518 aa  GABD2_MYCBO RecName: Full=Putative succinate-semialdehyde
   59::486     4e-45  28%  487 aa  AL8A1_MOUSE RecName: Full=Aldehyde dehydrogenase family 8 member
   23::473     5e-45  30%  474 aa  ABDH_SALAR RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   56::475     7e-45  31%  483 aa  NAHF_PSEU8 RecName: Full=Salicylaldehyde dehydrogenase;       
   56::475     7e-45  31%  483 aa  NAHF_PSEPU RecName: Full=Salicylaldehyde dehydrogenase;       
   19::479     7e-45  28%  491 aa  AMNC_PSESP RecName: Full=2-aminomuconic 6-semialdehyde
   23::473     7e-45  29%  474 aa  ABDH_SHISS RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   29::479     2e-44  29%  484 aa  IOLA2_GEOKA RecName: Full=Methylmalonate semialdehyde dehydrogenase
   23::473     2e-44  29%  474 aa  ABDH_ESCF3 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECOUT RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECOSE RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECOL6 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECOL5 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECOK1 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECO8A RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECO81 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECO45 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECO24 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_SHIFL RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_SHIF8 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECOLC RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECOHS RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     2e-44  29%  474 aa  ABDH_ECO55 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     3e-44  32%  474 aa  ABDH_SALTY RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     3e-44  29%  474 aa  ABDH_ECOLI RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     3e-44  29%  474 aa  ABDH_ECODH RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     3e-44  29%  474 aa  ABDH_ECOBW RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   17::453     3e-44  33%  488 aa  ASTD_PSEF5 RecName: Full=N-succinylglutamate 5-semialdehyde
   23::473     3e-44  29%  474 aa  ABDH_ECOSM RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     3e-44  29%  474 aa  ABDH_ECOLU RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   55::473     3e-44  30%  474 aa  ABDH_ECO27 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   27::474     4e-44  28%  485 aa  ALDY_BACSU RecName: Full=Uncharacterized aldehyde dehydrogenase
   25::470     4e-44  28%  475 aa  ALD1_STAES RecName: Full=Putative aldehyde dehydrogenase SE_1720;  
   25::470     4e-44  28%  475 aa  ALD1_STAEQ RecName: Full=Putative aldehyde dehydrogenase SERP1729; 
   54::491     6e-44  30%  515 aa  ROCA_GEOSW RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   36::483     6e-44  31%  496 aa  GAPN_WHEAT RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   36::483     6e-44  31%  496 aa  GAPN_NICPL RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   67::485     6e-44  32%  505 aa  BADH_HORVU RecName: Full=Betaine aldehyde dehydrogenase;       
   23::473     6e-44  29%  474 aa  ABDH_ECO5E RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     6e-44  29%  474 aa  ABDH_ECO57 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   17::487     1e-43  30%  488 aa  ALDH1_BACSU RecName: Full=Probable aldehyde dehydrogenase ycbD;    
   29::463     2e-43  28%  488 aa  IOLA1_GEOKA RecName: Full=Methylmalonate semialdehyde dehydrogenase
   23::473     2e-43  29%  474 aa  ABDH_SALCH RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   54::491     2e-43  30%  515 aa  ROCA_GEOKA RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   23::473     2e-43  29%  474 aa  ABDH_SHIDS RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   54::491     3e-43  30%  515 aa  ROCA_GEOTN RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   27::458     3e-43  29%  488 aa  IOLA_LISMC RecName: Full=Methylmalonate semialdehyde dehydrogenase
   27::458     3e-43  29%  488 aa  IOLA_LISIN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   27::458     4e-43  29%  488 aa  IOLA_LISMH RecName: Full=Methylmalonate semialdehyde dehydrogenase
   27::458     4e-43  28%  487 aa  IOLA_BACA2 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   31::462     4e-43  29%  491 aa  IOLA1_BACSK RecName: Full=Methylmalonate semialdehyde dehydrogenase
   23::473     4e-43  29%  474 aa  ABDH_SALPC RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   23::473     4e-43  29%  474 aa  ABDH_SALPB RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   54::491     5e-43  31%  515 aa  ROCA_BACCN RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   23::473     5e-43  31%  474 aa  ABDH_SALTI RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   27::458     6e-43  29%  488 aa  IOLA_LISMF RecName: Full=Methylmalonate semialdehyde dehydrogenase
   25::470     6e-43  31%  475 aa  GAPN_STRMU RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   27::458     8e-43  29%  488 aa  IOLA_LISMO RecName: Full=Methylmalonate semialdehyde dehydrogenase
   27::458     8e-43  29%  487 aa  IOLA_BACNA RecName: Full=Methylmalonate semialdehyde dehydrogenase
   22::461     8e-43  33%  491 aa  ASTD_MARAV RecName: Full=N-succinylglutamate 5-semialdehyde
   23::470     8e-43  27%  475 aa  ALD1_STAS1 RecName: Full=Putative aldehyde dehydrogenase SSP0762;  
   17::462     2e-42  27%  465 aa  LADH_METMP RecName: Full=Lactaldehyde dehydrogenase;       
   16::461     2e-42  30%  463 aa  LADH_METJA RecName: Full=Lactaldehyde dehydrogenase;       
   28::460     2e-42  27%  484 aa  IOLA3_GEOKA RecName: Full=Methylmalonate semialdehyde dehydrogenase
   58::510     4e-42  31%  511 aa  ALDHY_YEAST RecName: Full=Aldehyde dehydrogenase 2, mitochondrial; 
   27::458     5e-42  29%  487 aa  IOLA_BACSU RecName: Full=Methylmalonate semialdehyde dehydrogenase
   17::462     7e-42  27%  465 aa  LADH_METM5 RecName: Full=Lactaldehyde dehydrogenase;       
   30::462     7e-42  27%  486 aa  IOLA_BACCN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   63::470     7e-42  29%  475 aa  ALD1_STAAW RecName: Full=Putative aldehyde dehydrogenase MW2046;   
   63::470     7e-42  29%  475 aa  ALD1_STAAS RecName: Full=Putative aldehyde dehydrogenase SAS2025;  
   54::491     9e-42  30%  515 aa  ROCA_ANOFW RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   63::470     9e-42  29%  475 aa  ALD1_STAAR RecName: Full=Putative aldehyde dehydrogenase SAR2210;  
   63::470     9e-42  29%  475 aa  ALD1_STAAN RecName: Full=Putative aldehyde dehydrogenase SA1924;   
   63::470     9e-42  29%  475 aa  ALD1_STAAM RecName: Full=Putative aldehyde dehydrogenase SAV2122;  
   63::470     9e-42  29%  475 aa  ALD1_STAAC RecName: Full=Putative aldehyde dehydrogenase SACOL2114;
   63::470     9e-42  29%  475 aa  ALD1_STAA8 RecName: Full=Putative aldehyde dehydrogenase
   63::470     9e-42  29%  475 aa  ALD1_STAA3 RecName: Full=Putative aldehyde dehydrogenase
   18::453     1e-41  31%  488 aa  ASTD_PSE14 RecName: Full=N-succinylglutamate 5-semialdehyde
   87::505     2e-41  29%  511 aa  AL1B1_BOVIN RecName: Full=Aldehyde dehydrogenase X, mitochondrial; 
   37::488     2e-41  30%  498 aa  ALDH2_LEITA RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   30::462     3e-41  27%  486 aa  IOLA1_BACHK RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::462     3e-41  27%  486 aa  IOLA1_BACAN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   36::483     3e-41  28%  496 aa  GAPN_APIGR RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   32::487     3e-41  28%  496 aa  CROM_ENTDO RecName: Full=Omega-crystallin;
   63::470     3e-41  29%  475 aa  ALD1_STAAB RecName: Full=Putative aldehyde dehydrogenase SAB2006c; 
   38::485     3e-41  30%  498 aa  GAPN_MAIZE RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   30::462     5e-41  27%  486 aa  IOLA_BACC2 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::462     5e-41  26%  486 aa  IOLA1_OCEIH RecName: Full=Methylmalonate semialdehyde dehydrogenase
   17::462     6e-41  27%  465 aa  LADH_METM7 RecName: Full=Lactaldehyde dehydrogenase;       
   37::491     6e-41  27%  501 aa  AL2C4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member
   30::468     8e-41  27%  486 aa  IOLA_BACCR RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::462     8e-41  27%  486 aa  IOLA_BACC1 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::462     8e-41  27%  486 aa  IOLA1_BACCZ RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::462     8e-41  27%  486 aa  IOLA1_BACAH RecName: Full=Methylmalonate semialdehyde dehydrogenase
   28::460     1e-40  27%  483 aa  IOLA2_GEOTN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   27::463     1e-40  31%  498 aa  ASTD1_SHEDO RecName: Full=N-succinylglutamate 5-semialdehyde
   30::462     2e-40  27%  486 aa  IOLA_BACC4 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::462     2e-40  27%  486 aa  IOLA1_BACWK RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::462     3e-40  27%  486 aa  IOLA_BACCQ RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::462     3e-40  27%  486 aa  IOLA_BACC7 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::461     3e-40  25%  486 aa  IOLA2_BACSK RecName: Full=Methylmalonate semialdehyde dehydrogenase
   43::486     3e-40  30%  488 aa  ALDH_PSESP RecName: Full=Probable aldehyde dehydrogenase;       
   54::491     4e-40  30%  515 aa  ROCA_BACC1 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   90::492     5e-40  29%  516 aa  ROCA_BACLD RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     7e-40  30%  515 aa  ROCA_OCEIH RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     7e-40  30%  515 aa  ROCA_BACWK RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   36::483     7e-40  29%  496 aa  GAPN_PEA RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   54::491     9e-40  30%  515 aa  ROCA_BACHK RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACCZ RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACCQ RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACC7 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACC3 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACC0 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACAN RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACAH RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACAC RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     9e-40  30%  515 aa  ROCA_BACAA RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::480     9e-40  31%  507 aa  ALDH_STRCO RecName: Full=Probable aldehyde dehydrogenase;       
   89::491     1e-39  29%  515 aa  ROCA2_BACSU RecName: Full=1-pyrroline-5-carboxylate dehydrogenase
   27::458     1e-39  27%  487 aa  IOLA2_BACLD RecName: Full=Methylmalonate semialdehyde dehydrogenase
   55::465     1e-39  31%  474 aa  ABDH_SERP5 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   54::491     1e-39  30%  515 aa  ROCA_BACCR RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     1e-39  30%  515 aa  ROCA_BACC4 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   54::491     1e-39  30%  515 aa  ROCA_BACC2 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   30::481     1e-39  27%  487 aa  IOLA3_BACCZ RecName: Full=Methylmalonate semialdehyde dehydrogenase
   35::487     2e-39  27%  497 aa  ALDA_STAES RecName: Full=Putative aldehyde dehydrogenase aldA;     
   35::487     2e-39  27%  497 aa  ALDA_STAEQ RecName: Full=Putative aldehyde dehydrogenase aldA;     
   26::477     7e-39  26%  497 aa  MMSA_PSEAE RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   10::467     9e-39  25%  522 aa  YOSF_SCHPO RecName: Full=Putative aldehyde dehydrogenase-like
    7::442     9e-39  30%  481 aa  ASTD_SPHAL RecName: Full=N-succinylglutamate 5-semialdehyde
   52::490     2e-38  28%  514 aa  ROCA_STAS1 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   25::461     2e-38  30%  496 aa  ASTD_LEGPH RecName: Full=N-succinylglutamate 5-semialdehyde
   24::460     2e-38  30%  495 aa  ASTD_LEGPC RecName: Full=N-succinylglutamate 5-semialdehyde
   37::496     4e-38  28%  506 aa  THCA_RHOER RecName: Full=EPTC-inducible aldehyde dehydrogenase;    
   30::481     5e-38  27%  487 aa  IOLA2_BACHK RecName: Full=Methylmalonate semialdehyde dehydrogenase
   18::453     5e-38  32%  488 aa  ASTD_PSEFS RecName: Full=N-succinylglutamate 5-semialdehyde
   42::502     5e-38  29%  512 aa  ALDB_ECOLI RecName: Full=Aldehyde dehydrogenase B;       
   31::462     6e-38  26%  485 aa  IOLA_BACHD RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::481     6e-38  27%  487 aa  IOLA2_BACAN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   31::482     8e-38  26%  488 aa  IOLA2_BACCZ RecName: Full=Methylmalonate semialdehyde dehydrogenase
   30::481     8e-38  26%  487 aa  IOLA2_BACAH RecName: Full=Methylmalonate semialdehyde dehydrogenase
   32::486     8e-38  25%  495 aa  CROM_OMMSL RecName: Full=Omega-crystallin;
   53::491     2e-37  27%  515 aa  ROCA1_BACHD RecName: Full=1-pyrroline-5-carboxylate dehydrogenase
   21::485     3e-37  28%  486 aa  XYLG_PSEPU RecName: Full=2-hydroxymuconic semialdehyde
   35::487     3e-37  27%  497 aa  ALDA_STAHJ RecName: Full=Putative aldehyde dehydrogenase aldA;     
   36::479     4e-37  29%  506 aa  DHA2_RALEH RecName: Full=Acetaldehyde dehydrogenase 2;       
   24::460     4e-37  30%  495 aa  ASTD_LEGPL RecName: Full=N-succinylglutamate 5-semialdehyde
   36::479     4e-37  28%  506 aa  ALDH_RHORT RecName: Full=Aldehyde dehydrogenase;       
   37::497     5e-37  28%  507 aa  ALDH_MYCTU RecName: Full=Probable aldehyde dehydrogenase;       
   37::497     5e-37  28%  507 aa  ALDH_MYCBO RecName: Full=Probable aldehyde dehydrogenase;       
   38::453     5e-37  28%  508 aa  AL7B4_ARATH RecName: Full=Aldehyde dehydrogenase family 7 member
   17::453     7e-37  31%  488 aa  ASTD_PSEPF RecName: Full=N-succinylglutamate 5-semialdehyde
   38::434     1e-36  28%  508 aa  AL7A1_PEA RecName: Full=Aldehyde dehydrogenase family 7 member A1; 
   27::463     2e-36  25%  492 aa  IOLA_LACCA RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::443     2e-36  28%  471 aa  ASTD_NOVAD RecName: Full=N-succinylglutamate 5-semialdehyde
   18::453     4e-36  30%  488 aa  ASTD_PSESM RecName: Full=N-succinylglutamate 5-semialdehyde
   39::435     7e-36  28%  494 aa  AL7A1_BRANA RecName: Full=Aldehyde dehydrogenase family 7 member
   20::453     1e-35  30%  488 aa  ASTD_PSEU2 RecName: Full=N-succinylglutamate 5-semialdehyde
   17::453     1e-35  29%  487 aa  ASTD_PSEPW RecName: Full=N-succinylglutamate 5-semialdehyde
   36::496     2e-35  27%  506 aa  ALDH_VIBCH RecName: Full=Aldehyde dehydrogenase;       
   36::496     2e-35  27%  506 aa  ALDH_VIBC3 RecName: Full=Aldehyde dehydrogenase;       
   66::496     3e-35  27%  511 aa  AL7A1_MOUSE RecName: Full=Alpha-aminoadipic semialdehyde
   30::462     4e-35  25%  486 aa  IOLA_BACP2 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   28::460     4e-35  26%  483 aa  IOLA2_BACWK RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::440     5e-35  32%  472 aa  ASTD1_CAUCR RecName: Full=N-succinylglutamate 5-semialdehyde
   23::473     6e-35  27%  474 aa  ABDH_ENT38 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   89::491     1e-34  27%  515 aa  ROCA_BACP2 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   40::453     1e-34  31%  487 aa  ASTD_PSEMY RecName: Full=N-succinylglutamate 5-semialdehyde
   24::460     1e-34  29%  495 aa  ASTD_LEGPA RecName: Full=N-succinylglutamate 5-semialdehyde
   20::455     1e-34  29%  489 aa  ASTD_IDILO RecName: Full=N-succinylglutamate 5-semialdehyde
   47::504     1e-34  26%  520 aa  MMSA_DROME RecName: Full=Probable methylmalonate-semialdehyde
   17::453     1e-34  29%  488 aa  ASTD2_PSEHT RecName: Full=N-succinylglutamate 5-semialdehyde
   82::488     1e-34  30%  515 aa  ALDH_DEIRA RecName: Full=Aldehyde dehydrogenase;       
   19::453     2e-34  30%  487 aa  ASTD_PSEP1 RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     2e-34  28%  486 aa  ASTD2_SHEDO RecName: Full=N-succinylglutamate 5-semialdehyde
   59::457     2e-34  28%  486 aa  ASTD_CHRVO RecName: Full=N-succinylglutamate 5-semialdehyde
   17::453     3e-34  29%  487 aa  ASTD_PSEE4 RecName: Full=N-succinylglutamate 5-semialdehyde
   19::458     3e-34  31%  487 aa  ASTD_PSEAE RecName: Full=N-succinylglutamate 5-semialdehyde
   19::460     3e-34  27%  489 aa  ASTD_ACIAD RecName: Full=N-succinylglutamate 5-semialdehyde
   38::430     3e-34  25%  508 aa  AL7A1_MALDO RecName: Full=Aldehyde dehydrogenase family 7 member
   64::496     3e-34  27%  511 aa  AL7A1_BOVIN RecName: Full=Alpha-aminoadipic semialdehyde
   25::469     4e-34  28%  476 aa  GAPN_STREI RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   36::483     5e-34  27%  496 aa  GAPN_ARATH RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   21::460     5e-34  28%  489 aa  ASTD_CHRSD RecName: Full=N-succinylglutamate 5-semialdehyde
   47::498     7e-34  25%  520 aa  MMSA_DROPS RecName: Full=Probable methylmalonate-semialdehyde
   30::484     1e-33  26%  486 aa  IOLA2_OCEIH RecName: Full=Methylmalonate semialdehyde dehydrogenase
   17::458     1e-33  30%  487 aa  ASTD_BURM1 RecName: Full=N-succinylglutamate 5-semialdehyde
   64::496     2e-33  27%  511 aa  AL7A1_HUMAN RecName: Full=Alpha-aminoadipic semialdehyde
  117::564     3e-33  28%  644 aa  YHJ9_YEAST RecName: Full=Putative aldehyde dehydrogenase-like
   51::457     3e-33  30%  492 aa  ASTD_KLEP7 RecName: Full=N-succinylglutamate 5-semialdehyde
   61::472     5e-33  24%  535 aa  MMSA_HUMAN RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   61::472     6e-33  25%  535 aa  MMSA_MOUSE RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   63::514     8e-33  24%  537 aa  MMSA_BOVIN RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   20::454     1e-32  28%  489 aa  ASTD1_PSEHT RecName: Full=N-succinylglutamate 5-semialdehyde
   48::499     1e-32  24%  521 aa  MMSA_AEDAE RecName: Full=Probable methylmalonate-semialdehyde
   24::460     1e-32  28%  491 aa  ASTD_PHOLL RecName: Full=N-succinylglutamate 5-semialdehyde
    1::234     1e-32  33%  240 aa  ALDH2_MACPR RecName: Full=Aldehyde dehydrogenase, cytosolic 2;     
   18::458     2e-32  30%  487 aa  ASTD_BURVG RecName: Full=N-succinylglutamate 5-semialdehyde
   54::458     2e-32  31%  487 aa  ASTD_BURCH RecName: Full=N-succinylglutamate 5-semialdehyde
   54::458     2e-32  31%  487 aa  ASTD_BURCA RecName: Full=N-succinylglutamate 5-semialdehyde
   16::456     2e-32  28%  485 aa  ASTD_PHOPR RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     4e-32  27%  486 aa  ASTD_SHEB9 RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     4e-32  27%  486 aa  ASTD_SHEB5 RecName: Full=N-succinylglutamate 5-semialdehyde
   21::457     4e-32  29%  495 aa  ASTD_ENT38 RecName: Full=N-succinylglutamate 5-semialdehyde
   16::456     5e-32  27%  485 aa  ASTD_VIBSL RecName: Full=N-succinylglutamate 5-semialdehyde
   24::463     5e-32  29%  492 aa  ASTD_COLP3 RecName: Full=N-succinylglutamate 5-semialdehyde
   54::458     7e-32  31%  487 aa  ASTD_BURCJ RecName: Full=N-succinylglutamate 5-semialdehyde
   61::472     9e-32  24%  535 aa  MMSA_RAT RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   51::503     9e-32  23%  528 aa  MMSA_DICDI RecName: Full=Probable methylmalonate-semialdehyde
   54::458     9e-32  31%  487 aa  ASTD_BURA4 RecName: Full=N-succinylglutamate 5-semialdehyde
   21::457     1e-31  28%  492 aa  ASTD_SALAR RecName: Full=N-succinylglutamate 5-semialdehyde
   54::491     1e-31  25%  515 aa  ROCA_BACSU RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   48::499     1e-31  24%  521 aa  MMSA_ANOGA RecName: Full=Probable methylmalonate-semialdehyde
   59::457     1e-31  30%  492 aa  ASTD_ECO5E RecName: Full=N-succinylglutamate 5-semialdehyde
   59::457     1e-31  30%  492 aa  ASTD_ECO57 RecName: Full=N-succinylglutamate 5-semialdehyde
   54::458     1e-31  31%  487 aa  ASTD_BURCC RecName: Full=N-succinylglutamate 5-semialdehyde
   54::458     2e-31  31%  487 aa  ASTD_BURCM RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     2e-31  26%  487 aa  ASTD_SHESA RecName: Full=N-succinylglutamate 5-semialdehyde
   56::455     2e-31  31%  489 aa  ASTD_AERS4 RecName: Full=N-succinylglutamate 5-semialdehyde
    2::419     2e-31  27%  453 aa  AL3A1_RAT RecName: Full=Aldehyde dehydrogenase, dimeric
   19::457     3e-31  25%  487 aa  ASTD_SHEON RecName: Full=N-succinylglutamate 5-semialdehyde
   54::458     3e-31  31%  487 aa  ASTD_BURS3 RecName: Full=N-succinylglutamate 5-semialdehyde
   52::490     4e-31  27%  514 aa  ROCA_STAES RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   52::490     4e-31  27%  514 aa  ROCA_STAEQ RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   58::457     4e-31  29%  492 aa  ASTD_ECOHS RecName: Full=N-succinylglutamate 5-semialdehyde
   29::471     6e-31  28%  505 aa  ASTD_YERPS RecName: Full=N-succinylglutamate 5-semialdehyde
   29::471     6e-31  28%  505 aa  ASTD_YERPB RecName: Full=N-succinylglutamate 5-semialdehyde
   58::457     6e-31  29%  492 aa  ASTD_ECO8A RecName: Full=N-succinylglutamate 5-semialdehyde
   58::457     6e-31  29%  492 aa  ASTD_ECO55 RecName: Full=N-succinylglutamate 5-semialdehyde
   58::457     6e-31  29%  492 aa  ASTD_ECO24 RecName: Full=N-succinylglutamate 5-semialdehyde
   16::456     7e-31  28%  485 aa  ASTD_VIBHB RecName: Full=N-succinylglutamate 5-semialdehyde
   58::457     7e-31  29%  492 aa  ASTD_SHIBS RecName: Full=N-succinylglutamate 5-semialdehyde
   21::461     7e-31  27%  490 aa  ASTD_HAHCH RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     7e-31  30%  492 aa  ASTD_ECOL5 RecName: Full=N-succinylglutamate 5-semialdehyde
   60::457     9e-31  29%  492 aa  ASTD_ENTS8 RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     9e-31  30%  492 aa  ASTD_ECOUT RecName: Full=N-succinylglutamate 5-semialdehyde
   59::457     9e-31  29%  492 aa  ASTD_ECOLI RecName: Full=N-succinylglutamate 5-semialdehyde
   59::457     9e-31  29%  492 aa  ASTD_ECOLC RecName: Full=N-succinylglutamate 5-semialdehyde
   59::457     9e-31  29%  492 aa  ASTD_ECODH RecName: Full=N-succinylglutamate 5-semialdehyde
   59::457     9e-31  29%  492 aa  ASTD_ECOBW RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     9e-31  30%  492 aa  ASTD_ECO45 RecName: Full=N-succinylglutamate 5-semialdehyde
    2::428     9e-31  26%  456 aa  ALDH2_BACSU RecName: Full=Probable aldehyde dehydrogenase ywdH;    
   48::502     1e-30  27%  523 aa  MMSA_CAEEL RecName: Full=Probable methylmalonate-semialdehyde
   29::471     1e-30  28%  505 aa  ASTD_YERPY RecName: Full=N-succinylglutamate 5-semialdehyde
   29::471     1e-30  28%  505 aa  ASTD_YERPG RecName: Full=N-succinylglutamate 5-semialdehyde
   29::471     1e-30  28%  505 aa  ASTD_YERPE RecName: Full=N-succinylglutamate 5-semialdehyde
   29::471     1e-30  28%  505 aa  ASTD_YERPA RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     1e-30  30%  492 aa  ASTD_ECO81 RecName: Full=N-succinylglutamate 5-semialdehyde
   27::460     2e-30  24%  484 aa  IOLA1_BACLD RecName: Full=Methylmalonate semialdehyde dehydrogenase
   29::471     2e-30  28%  505 aa  ASTD_YERPP RecName: Full=N-succinylglutamate 5-semialdehyde
   58::457     2e-30  29%  492 aa  ASTD_SHIB3 RecName: Full=N-succinylglutamate 5-semialdehyde
   58::457     2e-30  29%  492 aa  ASTD_ECOSE RecName: Full=N-succinylglutamate 5-semialdehyde
   17::456     2e-30  27%  485 aa  ASTD_VIBVU RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     2e-30  30%  492 aa  ASTD_ECO27 RecName: Full=N-succinylglutamate 5-semialdehyde
  134::586     3e-30  23%  607 aa  MMSA_ARATH RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   57::455     3e-30  26%  531 aa  AL7A1_CAEEL RecName: Full=Putative aldehyde dehydrogenase family 7
   54::491     4e-30  25%  515 aa  ROCA2_BACHD RecName: Full=1-pyrroline-5-carboxylate dehydrogenase
   21::456     4e-30  25%  490 aa  ASTD_PSEA6 RecName: Full=N-succinylglutamate 5-semialdehyde
   53::456     5e-30  29%  485 aa  ASTD_VIBPA RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     5e-30  27%  486 aa  ASTD_SHEPC RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     5e-30  30%  492 aa  ASTD_ECOLU RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     5e-30  30%  492 aa  ASTD_ECOL6 RecName: Full=N-succinylglutamate 5-semialdehyde
   17::456     6e-30  27%  485 aa  ASTD_VIBVY RecName: Full=N-succinylglutamate 5-semialdehyde
   56::455     6e-30  30%  489 aa  ASTD_AERHH RecName: Full=N-succinylglutamate 5-semialdehyde
   58::457     8e-30  29%  492 aa  ASTD_SHIF8 RecName: Full=N-succinylglutamate 5-semialdehyde
   63::460     8e-30  31%  490 aa  ASTD_SERP5 RecName: Full=N-succinylglutamate 5-semialdehyde
   54::458     1e-29  28%  489 aa  ASTD_SORC5 RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     1e-29  28%  490 aa  ASTD_SHIDS RecName: Full=N-succinylglutamate 5-semialdehyde
   58::457     1e-29  29%  492 aa  ASTD_SHIFL RecName: Full=N-succinylglutamate 5-semialdehyde
   39::448     2e-29  28%  485 aa  ASTD_VIBCM RecName: Full=N-succinylglutamate 5-semialdehyde
    4::419     2e-29  27%  453 aa  AL3A1_MOUSE RecName: Full=Aldehyde dehydrogenase, dimeric
   52::490     4e-29  26%  514 aa  ROCA_STAHJ RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  684::1097    4e-29  29% 1320 aa  PUTA_ECOLI RecName: Full=Bifunctional protein putA;Includes:
   18::448     4e-29  27%  485 aa  ASTD_VIBF1 RecName: Full=N-succinylglutamate 5-semialdehyde
   53::490     5e-29  25%  514 aa  ROCA_STAAW RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAAT RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAAR RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAAN RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAAM RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAAE RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAAC RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAAB RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAA9 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAA8 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAA3 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAA2 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::490     5e-29  25%  514 aa  ROCA_STAA1 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   21::457     5e-29  28%  492 aa  ASTD_SALG2 RecName: Full=N-succinylglutamate 5-semialdehyde
   21::457     5e-29  28%  492 aa  ASTD_SALEP RecName: Full=N-succinylglutamate 5-semialdehyde
  664::1097    7e-29  30% 1320 aa  PUTA_SALTY RecName: Full=Bifunctional protein putA;Includes:
   19::457     7e-29  27%  486 aa  ASTD_SHEPA RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     9e-29  26%  486 aa  ASTD_SHEHH RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     9e-29  26%  486 aa  ASTD_SHEB8 RecName: Full=N-succinylglutamate 5-semialdehyde
   18::448     1e-28  26%  485 aa  ASTD_ALISL RecName: Full=N-succinylglutamate 5-semialdehyde
  664::1097    2e-28  30% 1312 aa  PUTA_KLEAE RecName: Full=Bifunctional protein putA;Includes:
   39::448     2e-28  26%  485 aa  ASTD_VIBCH RecName: Full=N-succinylglutamate 5-semialdehyde
   39::448     2e-28  26%  485 aa  ASTD_VIBC3 RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     2e-28  26%  486 aa  ASTD_SHEPW RecName: Full=N-succinylglutamate 5-semialdehyde
   61::457     2e-28  27%  492 aa  ASTD_CITK8 RecName: Full=N-succinylglutamate 5-semialdehyde
   17::426     2e-28  27%  487 aa  ASTD_BURXL RecName: Full=N-succinylglutamate 5-semialdehyde
   18::448     3e-28  27%  485 aa  ASTD_VIBFM RecName: Full=N-succinylglutamate 5-semialdehyde
   16::457     3e-28  26%  486 aa  ASTD_SHESH RecName: Full=N-succinylglutamate 5-semialdehyde
   51::457     3e-28  29%  492 aa  ASTD_SALA4 RecName: Full=N-succinylglutamate 5-semialdehyde
   59::453     3e-28  30%  487 aa  ASTD_PSEPK RecName: Full=N-succinylglutamate 5-semialdehyde
   53::457     3e-28  27%  486 aa  ASTD_SHEFN RecName: Full=N-succinylglutamate 5-semialdehyde
   59::453     4e-28  30%  487 aa  ASTD_PSEPG RecName: Full=N-succinylglutamate 5-semialdehyde
   79::419     4e-28  28%  453 aa  AL3A1_HUMAN RecName: Full=Aldehyde dehydrogenase, dimeric
   51::457     6e-28  29%  492 aa  ASTD_SALNS RecName: Full=N-succinylglutamate 5-semialdehyde
  107::442     6e-28  26%  445 aa  ALDH3_BACSU RecName: Full=Probable aldehyde dehydrogenase aldX;    
   53::490     7e-28  25%  514 aa  ROCA_STAAS RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   53::453     7e-28  28%  489 aa  ASTD_ERWT9 RecName: Full=N-succinylglutamate 5-semialdehyde
   69::457     1e-27  29%  492 aa  ASTD_ECOSM RecName: Full=N-succinylglutamate 5-semialdehyde
   53::457     1e-27  27%  486 aa  ASTD_SHEB2 RecName: Full=N-succinylglutamate 5-semialdehyde
   21::455     1e-27  26%  484 aa  ASTD_CAUSK RecName: Full=N-succinylglutamate 5-semialdehyde
   38::433     1e-27  25%  509 aa  AL7A1_DICDI RecName: Full=Putative aldehyde dehydrogenase family 7
   19::457     2e-27  26%  486 aa  ASTD_SHESW RecName: Full=N-succinylglutamate 5-semialdehyde
   19::457     2e-27  27%  486 aa  ASTD_SHEWM RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     3e-27  29%  492 aa  ASTD_ESCF3 RecName: Full=N-succinylglutamate 5-semialdehyde
   61::457     1e-26  29%  492 aa  ASTD_SALPB RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     2e-26  28%  492 aa  ASTD_ECO7I RecName: Full=N-succinylglutamate 5-semialdehyde
   16::451     2e-26  26%  481 aa  CALB_PSEUH RecName: Full=Coniferyl aldehyde dehydrogenase;       
   61::457     3e-26  29%  492 aa  ASTD_SALPK RecName: Full=N-succinylglutamate 5-semialdehyde
   61::457     3e-26  29%  492 aa  ASTD_SALPA RecName: Full=N-succinylglutamate 5-semialdehyde
   69::457     4e-26  29%  492 aa  ASTD_SALTY RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     4e-26  29%  492 aa  ASTD_SALTI RecName: Full=N-succinylglutamate 5-semialdehyde
   61::457     4e-26  29%  492 aa  ASTD_SALPC RecName: Full=N-succinylglutamate 5-semialdehyde
   72::457     4e-26  29%  492 aa  ASTD_SALHS RecName: Full=N-succinylglutamate 5-semialdehyde
   69::457     4e-26  29%  492 aa  ASTD_SALDC RecName: Full=N-succinylglutamate 5-semialdehyde
   69::457     9e-26  29%  492 aa  ASTD_SALSV RecName: Full=N-succinylglutamate 5-semialdehyde
    2::431     9e-26  24%  468 aa  AL3B1_RAT RecName: Full=Aldehyde dehydrogenase family 3 member B1; 
   28::427     1e-25  26%  470 aa  ALDH3_DICDI RecName: Full=Aldehyde dehydrogenase family 3 comG;    
    8::419     2e-25  28%  468 aa  AL3B1_HUMAN RecName: Full=Aldehyde dehydrogenase family 3 member
    2::431     2e-25  24%  468 aa  AL3B1_MOUSE RecName: Full=Aldehyde dehydrogenase family 3 member
    5::428     5e-25  24%  485 aa  AL3A2_MACFA RecName: Full=Fatty aldehyde dehydrogenase;       
   59::426     6e-25  29%  487 aa  ASTD_BURPS RecName: Full=N-succinylglutamate 5-semialdehyde
   59::426     6e-25  29%  487 aa  ASTD_BURP6 RecName: Full=N-succinylglutamate 5-semialdehyde
   59::426     6e-25  29%  487 aa  ASTD_BURP1 RecName: Full=N-succinylglutamate 5-semialdehyde
   59::426     6e-25  29%  487 aa  ASTD_BURP0 RecName: Full=N-succinylglutamate 5-semialdehyde
   59::426     6e-25  29%  487 aa  ASTD_BURMS RecName: Full=N-succinylglutamate 5-semialdehyde
   59::426     6e-25  29%  487 aa  ASTD_BURMA RecName: Full=N-succinylglutamate 5-semialdehyde
   39::454     6e-25  27%  483 aa  ALDH_PSEOL RecName: Full=Aldehyde dehydrogenase;       
   12::220     6e-25  34%  228 aa  ALDH9_POLMI RecName: Full=Aldehyde dehydrogenase 9;       
   87::535     8e-25  28%  572 aa  PUT2_EMENI RecName: Full=Delta-1-pyrroline-5-carboxylate
   21::456     8e-25  28%  485 aa  ASTD2_CAUCR RecName: Full=N-succinylglutamate 5-semialdehyde
    4::419     8e-25  28%  453 aa  AL3A1_CANFA RecName: Full=Aldehyde dehydrogenase, dimeric
  102::426     1e-24  29%  479 aa  ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase;       
  108::432     2e-24  28%  484 aa  AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member
    5::428     1e-23  23%  485 aa  AL3A2_HUMAN RecName: Full=Fatty aldehyde dehydrogenase;       
    5::428     3e-23  25%  485 aa  AL3A2_PONAB RecName: Full=Fatty aldehyde dehydrogenase;       
    8::419     4e-23  24%  468 aa  AL3B1_BOVIN RecName: Full=Aldehyde dehydrogenase family 3 member
   58::426     6e-23  30%  487 aa  ASTD_BURTA RecName: Full=N-succinylglutamate 5-semialdehyde
    5::428     6e-23  23%  484 aa  AL3A2_RAT RecName: Full=Fatty aldehyde dehydrogenase;       
   95::428     6e-22  27%  484 aa  AL3A2_MOUSE RecName: Full=Fatty aldehyde dehydrogenase;       
    1::233     1e-21  33%  233 aa  GAPN_SCEVA RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   67::482     1e-20  23%  529 aa  ALDH1_ENTHI RecName: Full=Aldehyde dehydrogenase 1;       
  634::1010    2e-20  31% 1224 aa  PUTA_RHIME RecName: Full=Bifunctional protein putA;Includes:
  115::449     3e-20  25%  476 aa  CALB_PSEAE RecName: Full=Probable coniferyl aldehyde dehydrogenase;
   16::454     3e-20  22%  485 aa  CALB_CAUCR RecName: Full=Probable coniferyl aldehyde dehydrogenase;
   88::527     6e-20  26%  563 aa  AL4A1_HUMAN RecName: Full=Delta-1-pyrroline-5-carboxylate
  164::476     1e-19  26%  802 aa  A16A1_RAT RecName: Full=Aldehyde dehydrogenase family 16 member A1;
   91::520     3e-19  24%  556 aa  AL4A1_DANRE RecName: Full=Delta-1-pyrroline-5-carboxylate
   93::476     1e-18  25%  802 aa  A16A1_MOUSE RecName: Full=Aldehyde dehydrogenase family 16 member
   93::476     2e-18  23%  800 aa  A16A1_BOVIN RecName: Full=Aldehyde dehydrogenase family 16 member
   49::434     2e-18  26%  681 aa  MAOC_ECOLI RecName: Full=Protein maoC;AltName: Full=Phenylacetic
   83::512     4e-18  26%  548 aa  PUT2_SCHPO RecName: Full=Probable delta-1-pyrroline-5-carboxylate
   18::338     4e-18  25%  385 aa  AL3B2_HUMAN RecName: Full=Aldehyde dehydrogenase family 3 member
   61::476     7e-18  22%  802 aa  A16A1_HUMAN RecName: Full=Aldehyde dehydrogenase family 16 member
  129::538     3e-17  27%  575 aa  PUT2_YEAST RecName: Full=Delta-1-pyrroline-5-carboxylate
  104::526     3e-17  27%  562 aa  AL4A1_MOUSE RecName: Full=Delta-1-pyrroline-5-carboxylate
   87::526     1e-16  24%  563 aa  AL4A1_RAT RecName: Full=Delta-1-pyrroline-5-carboxylate
   88::527     1e-16  26%  563 aa  AL4A1_BOVIN RecName: Full=Delta-1-pyrroline-5-carboxylate
  104::431     4e-16  26%  484 aa  AL3F1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member
   80::518     4e-15  26%  558 aa  AL4A1_DICDI RecName: Full=Delta-1-pyrroline-5-carboxylate
   97::491     1e-14  22%  550 aa  AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member
   74::509     2e-14  25%  546 aa  PUT2_AGABI RecName: Full=Delta-1-pyrroline-5-carboxylate
  156::378     1e-13  28%  532 aa  HFD1_YEAST RecName: Full=Putative fatty aldehyde dehydrogenase
    1::205     3e-12  28%  239 aa  AL3A1_BOVIN RecName: Full=Aldehyde dehydrogenase, dimeric
   62::408     6e-12  23%  515 aa  BOXD_AZOEV RecName: Full=3,4-dehydroadipyl-CoA semialdehyde
    4::213     4e-10  30%  228 aa  AL7A1_RAT RecName: Full=Alpha-aminoadipic semialdehyde
  107::307     5e-10  28%  467 aa  EUTE_SALTY RecName: Full=Ethanolamine utilization protein eutE;
  265::503     2e-08  24%  533 aa  ALDHX_YEAST RecName: Full=Aldehyde dehydrogenase 1, mitochondrial; 
   52::386     7e-08  28%  510 aa  ALDH_VIBHA RecName: Full=NADP-dependent fatty aldehyde
  134::309     4e-06  33%  433 aa  PROA_CYAP4 RecName: Full=Gamma-glutamyl phosphate reductase;       
   57::286     8e-06  24%  467 aa  EUTE_ECOLI RecName: Full=Ethanolamine utilization protein eutE;
  132::414     9e-05  26%  551 aa  ALDH_LINUS RecName: Full=Probable aldehyde dehydrogenase;       
  113::282     1e-04  27%  416 aa  PROA_STRU0 RecName: Full=Gamma-glutamyl phosphate reductase;       
  140::279     2e-04  30%  421 aa  PROA_ACIAD RecName: Full=Gamma-glutamyl phosphate reductase;       
  135::272     2e-04  28%  415 aa  PROA_THEP1 RecName: Full=Gamma-glutamyl phosphate reductase;       
  141::298     3e-04  26%  423 aa  PROA_DESDA RecName: Full=Gamma-glutamyl phosphate reductase;       
    9::265     3e-04  19%  862 aa  ADHE_CLOAB RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
    8::280     4e-04  25%  434 aa  PROA_PELTS RecName: Full=Gamma-glutamyl phosphate reductase;       
 1345::1439    6e-04  36% 1835 aa  SEC16_NEOFI RecName: Full=COPII coat assembly protein sec16;AltName:
  134::273     6e-04  27%  415 aa  PROA_CLOPS RecName: Full=Gamma-glutamyl phosphate reductase;       
  134::273     6e-04  27%  415 aa  PROA_CLOPE RecName: Full=Gamma-glutamyl phosphate reductase;       
  135::272     8e-04  27%  415 aa  PROA_THESQ RecName: Full=Gamma-glutamyl phosphate reductase;       
  135::272     0.001  26%  415 aa  PROA_THEMA RecName: Full=Gamma-glutamyl phosphate reductase;       
    1::454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAFESVNPATGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDLSERCRLLRAAAQQLRERKEDLARLIT
GABD_SYNY3      MAIATINPATGQTVQTFIAHSQVEVNAKLDLAQETFQSFRHLPFAQRGQWLRKAADILEQRRDEWAALMT
GABD_DEIRA      --FATVNPYTGETVKTFPFLESAEIPALIERADQAYREWGQRPVTERAAIMRRAAELMLERTDELASLIT
YNEI_ECOLI      ----SINPATGEQLSVLPWAGADDIENALQLAAAGFRDWRETNIDYRAEKLRDIGKALRARSEEMAQMIT
GABD1_MYCPA     MPIATINPATGETVKTFTPASDAEVDAAIARAYERFLDYRSTTFAQRAQWXXXXXXXXXXXXXXXXXXXX
GABD1_MYCA1     MPIATINPATGETVKTFTPASDAEVDAAIARAYERFLDYRSTTFAQRAQWXXXXXXXXXXXXXXXXXXXX
GABD1_MYCUA     MPIATTNPATGETVKTFTAASNDEVDAAIARAYARFQDYRRNTFAQRAEWAHATADLIEAEADQTAALMT
GABD1_MYCTU     MPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARWXXXXXXXXXXXXXXXXXXXX
GABD1_MYCTA     MPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARWXXXXXXXXXXXXXXXXXXXX
GABD1_MYCBP     MPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARWXXXXXXXXXXXXXXXXXXXX
GABD1_MYCBO     MPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARWXXXXXXXXXXXXXXXXXXXX
GABD1_MYCLE     MSIATINPATGETVKTFTPTTQDEVEDAIARAYARFDNYRHTTFTQRAKWANATADLLEAEANQSAALMT
GABD_ECOLI      -AIDVTNPANGDKLGSVPKMGADETRAAIDAANRALPAWRALTAKERATILRNWFNLMMEHQDDLARLMT
BETB1_RHIME     ---ESIYPATGEIIARLHAATPGIVEKAIAAAKRAQPEWAAMSPTARGRILKRAAELMRQRNRELSELET
BETB_SINMW      ---ESIYPATGEVIARLYAATPAIVEKAIAAAKRAQPEWAAMSPTARGRILKRAAEIMRERNRELSELET
AL9A1_MOUSE     ---KAFEPATGRVIATFACSGEKEVNLAVENAKAAFKLWSKKSGLERCQVLLEAARIIKERKDEIATVET
BETB_RHIE6      ---ESLYPATGEVIARLHAATPAIVEKAIAAAKSAQPEWAAMSPMARGRILKRAADIMRERNRELSELET
BETB_RHIEC      ---ESLYPATGEVIARLHAATPAIVEKAIAAAKRAQPEWAAMSPMARGRILKRAADIMRERNRELSELET
BETB_YERPY      --FDAVNPANGECIAQLQXXXXXXXXXXXXXXXXGQPVWAAMTAMERSRILRRAVDILRDRNDELAAIET
BETB_RHIL3      ---ESLYPATGEVIARLHAATPAIVERAIAAAKRAQPEWAAMSPMARGRILKRAADIMRERNRVLSELET
BETB_ACIBT      --FNSINPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELARLET
BETB_RHISN      ---ESIYPATGEVIARLHAATPDIVEKAIAAAKRAQPEWAAMSPTARGRILKRAAEIMRERNRELSELET
BETB_PSEA7      --FETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDLLRERNDELAALET
BETB_AGRT5      --FESIFPATGEMIAKLHAATPAIVERAIASAKRAQKEWAAMSPMARGRILKRAADIMRERNDALSTLET
BETB_ACIBY      --FNSINPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELARLET
BETB_ACIB5      --FNSINPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELARLET
BETB_ACIB3      --FNSINPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELARLET
BETB_ACIBC      --FNSINPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELARLET
BETB_PSEAE      --FETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALET
BETB_PSEA8      --FETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALET
SSDH_RAT        --------------------------------------WKEISVKERSSLLRKWYDLMIQNKDELAKIIT
BETB_PSEFS      --FEAINPANGEVLAQVQRATKEDVERAVVSAEKGQKIWAAMTAMERSRILRRAVDILRERNDELAALET
BETB_PSEAB      --FETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALET
BETB_ACIBS      --FNSINPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELARLET
AL9A1_RAT       ---KAFEPATGREIATFKCSGEKEVNLAVENAKAAFKIWSKKSGLERCQVLLEAARIIKERRDEIAIMET
SSDH_MOUSE      --------------------------------------WKGVSVKERSLLLRKWYDLMIQNKDDLAKIIT
BETB_PSEMY      --FDSINPATGEVLAKVQRASQADVDRAVASAAEGQKVWAAMTAMQRSRILRRAVDILRERNDELAELET
SSDH_ARATH      ------NPATGEIIADVACMGTKETNDAIASSYEAFTSWSRLTAGERSKVLRRWYDLLIAHKEELGQLIT
BETB_RHOS5      -----IHPANGEEIARLHEATPAVIEAALASGARAQKDWAALRPVERARILRRASDLIRARNEELSILET
BETB_VIBPA      --FTTYNPANGEPLANIKQANQSDMEAAIESAKRGFEVWSAMTAIERSRILNKAVAILRERNDELAALEV
BETB_ACIAD      --FDSINPATGEVIATIQQASQTDIEAAVKSAAEGQKVWAAKTAVERSRILRRAVDILRERNDELAQLET
BADH_GADCA      -------PATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEV
BETB_VIBSL      --FVSINPANGEPIATLGQASSADVENAIESAKRGFAVWSAMTAVERSRILLKAVEILRARNNDLANLEV
BETB_ECO45      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
AL1A3_HUMAN     --FATCNPSTREQICEVEEGDKPDVDKAVEAAQVASP-WRRLDALSRGRLLHQLADLVERDRATLAALET
BETB_KLEP3      --FETINPATGEVLATVQAAGREDVDRAVESAQRGQKIWAAMTAMERSRILRRAVDLLRQRNDELARLET
BETB_VIBHB      --FTTYNPANGEPLANVKQANQQDMQAAIESAKRGFAIWSAMTATERSRILLKAVALLRERNDELAALEV
BETB_ECO27      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
AL1A3_RAT       --FATYNPSTLEKICEVEEGDKPDVDKAVEAAQAASP-WRRLDALSRGQLLHQLADLIERDRAILATLET
BETB_ECOL6      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_AGRRK      ---ESIYPATGEVIARLHAATPAIVEQAIAAAKRAQPEWAAMSPTARGRILKRAADIMRERNRELSELET
BETB_ECOHS      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_SHIF8      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECOLU      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNNELAKLET
BETB_ECO24      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
SSDH_HYLLA      --------------------------------------WREVSAKERSSLLRKWYNLMIQNKDDLARIIT
SSDH_HUMAN      --------------------------------------WREVSAKERSSLLRKWYNLMIQNKDDLARIIT
BETB_ECOLC      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWASMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECO8A      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECO7I      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECO5E      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECO57      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECO55      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECOSE      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECOLI      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWASMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECODH      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWASMTAMERSRILRRAVDILRERNDELAKLET
UGA2_YEAST      --FEVVDPASGEIIARVPEQPVSVVEEAIDVAYETFKTYKNTTPRERAKWLRNMYNLMLENLDDLATIIT
SSDH_PANPA      --------------------------------------WREVSAKERSSLLRKWYNLMIQNKDDLARIIT
SSDH_GORGO      --------------------------------------WREVSAKERSSLLRKWYNLMIQNKDDLARIIT
BETB_BURP8      VTFDTFDPATGELLATVQQASEADIERAVQSAREGQRAWAAMTAMQRSRILRRAVDLLRERNDELAELEM
BETB_RHILW      ----------------------------------------------RGRILKRAADIMRERNRALSELET
SSDH_PANTR      --------------------------------------WREVSAKERSSLLRKWYNLMIQNKDDLARIIT
BETB_BURXL      --FDTLDPATGETLASVQQASAADVERAVQSAREGQREWAALTAMQRSRVLRRAVEILRERNDELAALET
ALDH4_YEAST     --FEVINPSTEEEICHIYEGREDDVEEAVQAADRANGSWNGIDPIDRGKALYRLAELIEQDKDVIASIET
SSDH_PONPY      --------------------------------------WREVSAKERSSLLRKWYXLMIXNKDDLARIIT
BETB_ECOSM      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
BETB_ECOL5      --FETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLET
ALDA_ECOLI      -----VNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISALIV
ALDH5_BACSU     ---ENKNPYTQKTFTTFRKATADDVDEAYRAAALAKKKWDAVNPFEKRTILEKAVTYIEENEEAIIYLIM
BETB_BURPP      --FDTLDPATGETLASVQQASAADVDRAVRSAKQGQREWAALTAMQRSRILRRAVDLLRERNDELAALET
BETB_YERP3      --FDAVNPANGECIAQLQXXXXXXXXXXXXXXXXGQPVWAAMTAMERSRILRRAVDILRDRNDELAAIET
BETB_PECCP      --FDAVNPANGEIIAQLQSXXXXXXXXXXXXXXXXXXXXXXMTAMERSRILRRAVDILRERNDELALLET
AL1A1_HUMAN     --FPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIWRTMDASERGRLLYKLADLIERDRLLLATMES
YF19_SCHPO      --------------------------------------WRKFSSAQRGRCLSRLADCIEQNLEYLASIET
BETB_RHOS1      ---------------------------------------------ERARILRRASDLIRARNEELSLLET
AL1A1_HORSE     --FPVFNPATEEKLCEVEEGDKEAVAAARQAFQIGSP-WRTMDASERGRLLYKLADLVERDRLILATMES
BETB_YERPP      --FDAVNPANGECIAQLQXXXXXXXXXXXXXXXXGQPVWAAMTAMERSRILRRAVDILRDRNDELAAIET
BETB_YERPN      --FDAVNPANGECIAQLQXXXXXXXXXXXXXXXXGQPVWAAMTAMERSRILRRAVDILRDRNDELAAIET
BETB_YERPE      --FDAVNPANGECIAQLQXXXXXXXXXXXXXXXXGQPVWAAMTAMERSRILRRAVDILRDRNDELAAIET
BETB_YERPB      --FDAVNPANGECIAQLQXXXXXXXXXXXXXXXXGQPVWAAMTAMERSRILRRAVDILRDRNDELAAIET
BETB_YERPA      --FDAVNPANGECIAQLQXXXXXXXXXXXXXXXXGQPVWAAMTAMERSRILRRAVDILRDRNDELAAIET
GABD_RHISN      --FSVFNPSTGELLAEVPDMGXXXXXXXXXXXXXXQEPWSGLTARARSDILWKWHRFILEHSDDLAAILT
BETB_RHOSK      ---------------------------------------------ERARILRRASDLIRARNEELSLLET
AL9A1_HUMAN     ---KAFEPATGRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCXXXXXXXXXXXXXXXXXXTMEC
BETB_RHOS4      ---------------------------------------------ERARILRRASDLIRAHNEELSLLET
AL9A1_PONAB     ---KAFEPATGRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCXXXXXXXXXXXXXXXXXXTMEC
A9A1B_DANRE     -------PATGRVLCRLQTCGSAEVDAAVRNASAAFKVWRKLSGMERARVMLEAARLIEKRREEIAEMEV
SSDH2_SCHPO     --FEVDNPATGEIIGKVADVSVEETKKAISAANEAFKTYKNFTHVQRSQLLERWAELIMENKDDLVKMLT
BETB_PSEPW      --FEAINPATGEVLAHVQRATQADVEKAVESAERGQKIWAAMTAMQRSRILRRAVDILRERNDELAMLET
ALDH_AGABI      -----VNPANGKLITKISEATEADIDIAVEAAHKAETTWGLNSGSKRGDMLYKLAQLMEKNIDDLSAIEA
BETB_YERPS      --FDAVNPANGECIAQLQXXXXXXXXXXXXXXXXGQPVWAAMTAMERSRILRRAVDILRDRNDELAAIET
AL1A3_MOUSE     --FATYNPSTLEKICEVEEGDKPDVDKAVEAAQAASP-WRRLDALSRGQLLHQLADLVERDRAILATLET
AL1A2_HUMAN     --FPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRAVLATMES
ALDH4_BACSU     --FDTPNPATGETLMTLYEXXXXXXXXXXXXXXXXFDQWRTMSPASRSRLMYKLADLMEEHKTELAQLET
AL1A2_RAT       --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMES
BETB_PSESM      --FDSINPANGEVLAKIQRASKEDVERAVVAAEKGQKIWAAMTAVERSRILRRAVDILRERNDELAALET
BETB_PSEPG      --FEAINPATGEVLAHVQRATEADVEKAVESAERGQKVWAAMTAMQRSRILRRAVDILRERNDELAQLET
AL1A2_MOUSE     --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMES
BETB_ERWCT      --FDAVNPANGDIIACIQSATAADVDRAVSAATAGQKVWAAMTAMERSRILRRAVDILRERNDELALLET
YLX7_SCHPO      --WETVDPSIEEVIAKVYLAGEKEIDYAVKSAKEAFKTWKKVPGSEKGELLMKLAELTEKHADTLAAIEA
BETB2_RHIME     ----SVNPVDGEIIAKLHGATSCIIEKAIASAKRAQKEWARKEPAERGRVLSRAADIMRARNRELSVLET
BETB_PSEU2      --FDAINPANGEVLAQIQRAGKDDVERAVVAAEKGQKIWAAMTAVERSRILRRAVDILRERNDELAALET
BETB_PSEPK      --FEAINPATGEVLAHVQRATEADVEKAVESAERGQKVWAAMTAMQRSRILRRAVDILRERNDELAMLET
BETB_PSEP1      --FEAINPATGEVLAHVQRATEADVEKAVESAERGQKVWAAMTAMQRSRILRRAVDILRERNDELAMLET
BETB_PSE14      --FDAINPANGEVLAQIQRAGKEDVERAVVAAEKGQKIWAAMTAVERSRILRRAVDILRERNDELAALET
BETB_PSEPF      --FEAINPANGEVLAHVQRATKEDVERAVVSAEKGQKIWAAMTAMERSRILRRAVDILRERNDELAALET
AL1B1_MOUSE     --FPTVNPTTGEVIGHVAEGDRADVDLAVKAAREAFRLWRRMDASERGRLLNRLADLVERDRVYLASLET
ALDH2_PONAB     --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
ALDH2_HUMAN     --FPTVNPSTGEVIEGXXXXXXXXXXXXXXXFQLGSP-WRRMDASHRGRLLNRLADLIERDRTYLAALET
AL9A1_BOVIN     ---KAFEPASGRVIATFTCSGEKEVNLAVQDAKAAFKIWSQKSGMERCXXXXXXXXXXXXXXXXXXTMET
BETB_PSEU5      --FESINPXXXXXXXXXXXXXXXXXXRAVESAEQGQRIWAALTGIERARIMRRAVDLLRERNDELALLET
AL1L2_MOUSE     --------------------------------------WGRMNARDRGRLMYRLADLMEENQEELATIEA
PUUC_ECOLI      ----------------------------------------------------------------------
AL1A2_CHICK     --FPVYNPATGEQICEIQEADKVDTDKAVRAARLAFSLWRRMDASERGQLLDKLADLVERDRAVLATMES
BETB_BURA4      --FDTFDPATGELLXXXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVDLLRERNDELAAIET
BADH1_ARATH     --------------------------------------WAKAPGAVRAKYLRAIAAKVNERKTDLAKLEA
BETB_PSEF5      --FDAINPANGEVLAQVQRATKEDVERAVVSAEKGQKIWAAMTAMERSRILRRAVEILRERNDELAALET
BADH_SCHPO      -----INPATEEIIGTCANASAKDVDSAVENAYNTSGIWAKWPGKQRGLVLRKIAKMMREKRELLAGIDT
BADH_AMAHP      --------------------------------------WASASGAHRAKYLRAIAAKITEKKDYFAKLEA
AL1A1_RABIT     -----------------------------QAFQIGSP-WRTMDASERGRLLYKLADLIERDRLLLATMES
BETB_STRMK      --FKTVNPATGEVIAEVQVASQADVERAVQSASEGQKVWAAMTAMERSRILRRAVEILRERNDELAHLET
BETB_PSEE4      --FEAINPATGEVLAHVQRATQADVEKAVESAERGQKVWAAMTAMQRSRILRRAVDILRERNDELAMLET
AL2B7_ARATH     --FPTLDPRNGEVIAQVDAEDVNRAVAAARKAFDEGP-WPKMTAYERSKILFRFADLIEKHNDEIAALET
AL1A1_MACFA     -----------------------------QAFQIGSP-WRTMDASERGRLLYKLADLIERDRLLLATMES
BETB_STRM5      --FRTVNPATGDVIAEVQVASQADVERAVQSAAEGQKVWAAMTAMERSRILRRAVEILRERNDELAHLET
GABD_BACSU      ------NPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTSANERTSLLKKWYELIVEHKEELADLIT
BETB_BURCM      --FDTFDPATGELLXXXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVDLLRERNDELAAIET
BADH_SPIOL      --------------------------------------WSATSGAHRATYLRAIAAKITEKKDHFVKLET
AL8A1_DANRE     ---DSFDPSTGEVYCKVPDSGAEEVNAAVRAAKEAFPDWSAKSPADRSKVLNKLADLIEARLEEFVQAES
AL1L2_HUMAN     --------------------------------------WGRMNARERGRLMYRLADLLEENQEELATIEA
BETB_MARMS      --FETINPATGEVIATVEHAGQAELDAAVESAKQGQKVWSAMSPVERGRILKKXXXXXXXXXXXXXXXXV
BADH_ATRHO      --------------------------------------WAAL-WSHRAKYLRAIAAKITEKKDHFVKLET
ALDH_CLAHE      ----------GQEGKTFDVINPSD-ESVITQVHEATEKWRQETPENRGKLLNNLANLFEKNIDLLAAVES
AL1A1_SHEEP     -----------------------------QAFQIGSP-WRTMDASERGRLLNKLADLIERDRLLLATMEA
BETB_SERP5      --FNAVNPANGEVLAEIQSASAEDVNRAVASAASGQKVWAAMTAMARSRILRRAVDILRERNDELAALET
AL1A1_MOUSE     -----------------------------QAFQIGSP-WRTMDASERGRLLNKLADLMERDRLLLATMEA
FTHFD_XENTR     --YDTVNPTDGTAICKVSLAQVSDIDRAVAAAKEANGEWGKMNPRDRGRILYRLADIMEEHQEELATIES
AL1A1_BOVIN     -----------------------------QAFQIGSP-WRTMDASERGRLLNKLADLIERDHLLLATMEA
ALDH_BACST      ----SINPANRHDIVGYV--QRSTLEDVNEAVNEAQTSWWKRSGVERGEYLYKAAHILEQCLQDIAETMT
ALDH1_MACPR     --------------------------------QMGSP-WRTMDASERGQLIYKLADLIERDRLLLATLES
ALDH2_MESAU     --FPTVNPSTGEVICQVAEGSKEXXXXXXXXXQLGSP-WRRMDASDRGRLLNRLADLIERDRTYLAALET
AL8A1_HUMAN     ---DSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERSRVLNQVADLLEQSLEEFAQAES
AL1A2_TAEGU     --FPVYNPATGEQICDIQEADKVDTDKAVRAARLAFSLWRRMDASERGHLLDKLADLVERDRAILATMES
ALDH1_ELEED     --------------------------------QMGSP-WRTMDASERGQLIYKLADLIERDRLLLATLES
BADH_BETVU      --------------------------------------WAATSGAHRARYLRAIAAKVTERKDHFVKLET
ALDH2_RAT       --FPTVNPSTGEVICQVAEGNKEXXXXXXXXXXXXXXLWRRMDASDRGRLLYRLADLIERDRTYLAALET
AL1A1_RAT       -----------------------------QAFQIGSP-WRTMDASERGRLLNKLADLMERDRLLLATIEA
FEAB_ECOLI      ------DPATGQEIASTXXXXXXXXXXXXMSAWRASRRWAGRLPAERERILLRFADLVEQHSEELAQLET
BETB_BRUMB      -----IYPATGEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
ALDH2_MOUSE     --FPTVNPSTGEVICQVAEGNKEXXXXXXXXXQLGSP-WRRMDASDRGRLLYRLADLIERDRTYLAALET
AL1A7_MOUSE     -----------------------------QAFQIGSP-WRTMDASERGRLLNKLADLMERDRLLLATMES
ABDH_ERWCT      ------NPATGEQIAAIPQADLHQIDAAVLAAESAFAHWGQTTPKTRATLLLKIADAIEENAEVFAKLES
BETB_BRUO2      -----IYPATGEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
BETB_BRUME      -----IYPATGEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
BETB_BRUAB      -----IYPATGEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
BETB_BRUA2      -----IYPATGEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
BETB_BRUA1      -----IYPATGEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
ALDH2_BOVIN     --FPTVNPSTGDVICHVAEGDXXXXXXXXXXXQLGSP-WRRMDASERGRLLNRLADLIERDRTYLAALET
ALDH6_YEAST     --------------------------------------WATQDPRERGRLLSKLADELESQIDLVSSIEA
ABDH_PECCP      ------NPATGEQIAAIAQADLHQVDAAVLAAESAFAHWGQTTPKTRATLLLQIADAIEENAEAFARLES
AL9A1_ORYLA     -------PATGRVLCQMVPCGAEEVDEAIMSAHAAYVQWSKKSGTERARVMXXXXXXXXXXXXXXXXXXV
DMPC_PSEUF      --FEDVNPANGQVIRVHEXXXXXXXXXXXXXXXXLKGPWGKMSVSERAEILHRVADGITARFDEFLEAEC
AL1B1_PONAB     --FPTVNPTTGEVIEGXXXXXXXXXXXXXXXFRLGSP-WRRMDASERGRLLNCLADLVERDRVYLASLET
FTHFD_MOUSE     -------------------------------------LWGKINARDRGRLLYRLADLMEQHQEELATIEA
BETB_BRUSU      -----IYPATDEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
BETB_BRUSI      -----IYPATDEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
BETB_BRUC2      -----IYPATDEEIASLYSATPGIIEXXXXXXXXXQGEWAALKPVERGRILRRTAEILREKNRKLSKLET
AL2B4_ARATH     --FPTLDPRTGEVIAHVAEGDAEDINRAVKAARTAEGPWPKMSAYERSRVLLRFADLVEKHSEELASLET
AL1B1_HUMAN     --FPTVNPTTGEVIEGXXXXXXXXXXXXXXXFRLGSP-WRRMDASERGRLLNLLADLVERDRVYLASLET
ALDH_ALTAL      --FDVINPSTEEVICSVQEATEKDVDIAVAAARKANGPWRKETPENRGKLLNKLADLFEKNADLIAAVEA
BETB_OCHA4      -----IYPATGEEIARLYSATPDVIEAAYAAALKAQGEWAALKPVERGRILRRTADILREKNKKLSKLET
BETB_BACSU      ----------------------------------------------------------------------
BETB_XANC5      --FEVVNPATGEVLANVHNAGADDLDAAVDSAQAGQRQWAALTTVERSRILLRAVALLRERNDALAELET
A9A1A_DANRE     -------PATGRVLCDMIPCGEEEVDQAIKSAHSAYLKWSQLSGMERSXXXXXXXXXXXXXXXXXXXXXV
BETB_CHRSD      --FTVTNPYDGSLLATIGXXXXXXXXXXXXXXXRGQREWAAMTGMERSRILLRAVALLRERNDELAELET
BETB_VIBVU      -SFATLNPATGEVLAHIEQADERVLGHAIESAKLGFSVWSSMSAAERSRCLLKAAQLIRDHNDELAELEV
BETB_BURS3      --FDTFDPATGELLXXXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVDLLRERNDELAALET
ALDH_ASPNG      --FETINPSNEKPIVAVHEATEKDVDTAVAAARKAEGSWRQVTPSTRGRMLTKLADLFERDAEILASIEA
BETB_BURCH      --FDTFDPATGELLXXXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDELAAIET
BETB_BURCA      --FDTFDPATGELLXXXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDELAAIET
ALDA_STAAW      ---EVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
ALDA_STAAN      ---EVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
ALDA_STAAM      ---EVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
BETB_VIBVY      -SFATLNPATGEVLAHIEQADERVLAHAIESAKLGFSVWSSMSAAERSRCLLKAAQLIRDHNDELAELEV
ALDA_STAAR      ---EVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
ALDA_STAAB      ---EVTNPATGETLSHITRAKDKDVDHAVEVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
AL1B1_RAT       --FPTVNPTTGEVIEGXXXXXXXXXXXXXXXFRLGSP-WRRMDASERGRLLNRLADLVERDRVYLASLET
HPCC_ECOLX      --FLTTNPATGEVLADVASGGEAEINQAVATAKEAFPKWANLPMKERARLMRRLGDLIDQNVPEIAAMET
FTHFD_PONAB     --------------------------------------WGKISARDRGRLLYRLADLMEQHQEELATIEA
BETB_BURP1      --FDTFDPATGELLARXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDALAELEM
BETB_BURP0      --FDTFDPATGELLARXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDALAELEM
BETB_BURMS      --FDTFDPATGELLARXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDALAELEM
BETB_BURMA      --FDTFDPATGELLARXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDALAELEM
BETB_BURM9      --FDTFDPATGELLARXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDALAELEM
BETB_BURM7      --FDTFDPATGELLARXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDALAELEM
ALDH2_PIG       --FPTVNPSTGDVICHVAEGDKXXXXXXXXXXQLGSP-WRRLDASDRGRLLNRLADLIERDRTYLAALET
ALDA_STAAS      ---EVTNPATGETLSHITRAKDKDVDHAVKVAQDAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
BETB_BURPS      --FDTFDPATGELLARXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNDALAELEM
BETB_BURP6      --FDTFDPATGELLARXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVELLRERNNALAELEM
ALDA_STAAC      ---EVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
ALDA_STAA8      ---EVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
ALDA_STAA3      ---EVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIET
BETB_BURCC      --FDTFDPATGELLXXXXXXXXXXXXXXXXXXXEGQREWATMTAMQRSRILRRAVDLLRERNDELAAIET
FTHFD_RAT       -------------------------------------LWGKINARDRGRLLYRLADVMEQHQEELATIEA
BETB_BURM1      --FDTFDPATGXXXXXXXXXXXXXXXXXIASAQEGQREWAAMTAMQRSRILRRAVELLRERNDELAALET
BETB_XANCB      --FEVVNPATGEXXXXXXXXXXXXXXXXXXSAKAGQRHWAALTVVERSRILLRAVALLRERNDALAELET
BETB_XANC8      --FEVVNPATGEXXXXXXXXXXXXXXXXXXSAKAGQRHWAALTVVERSRILLRAVALLRERNDALAELET
BETB_BURCJ      --FDTFDPATGELLXXXXXXXXXXXXXXXXXXXEGQREWAAMTAMQRSRILRRAVDLLRERNDELAAIET
FTHFD_HUMAN     --------------------------------------WGKISARDRGRLMYRLADLMEQHQEELATIEA
BETB_XANCP      --FEVVNPATGEXXXXXXXXXXXXXXXXXXSAKAGQRHWAALTVVERSRILLRAVALLRERNDALAELET
BETB_XANAC      ---EVVNPATGEVLANVHNAGVDDLDAAVDSAKAGQQRWAALTTVERSRILLRAVALLRERNDALAQLET
BADH_ORYSJ      ----------------------------------------------------------------LALLET
FTHFD_XENLA     -SYDTINPTDGTAICKVSLAQISDIDRAVAAAKEANGEWGKMNPRDRGRLLYRLADLMEEHQEELATIES
BADH2_ARATH     -----VNPATEDIIGYIPAATSEDVELAVEAARKAFTRWARATGAVRAKYLRAIAAKVIERKSELANLEA
ALDH_EMENI      --------------------------------------WRQVTPSERGILINKLADLMERDIDTLAAIES
ALDH2_HORSE     --FPTVNPSTGEVICQVAAGDKEXXXXXXXXXQLGSP-WRRMDASDRGRLLNRLADLIERDRTYLAALET
ALD1_STAHJ      ---EVINPATEEVIGKVAKGNSNDVEKAVEAANNVYLEFRHSSVKERKELLDKIVEEYKNRKQDIIEAIT
LADH_META3      ---EVKNPYNNEIIGYIPSLSRNETKEAIKIAEEHKSTMKNLSPTIRYNILMKIASELSKNKRELAKLIT
SSDH1_SCHPO     --FDVENPGLNETLAPVTDMSVEETRKAIKVAHEAFLSYRNSDIKERYAILRRWYDLIMENADDLATMMT
BETB_RHILO      ---------------------------------------------------------------------T
BETB_BURVG      --FDTFDPATGELLXXXXXXXXXXXXXXXXXXXXGQREWAALTAMQRSRILRRAVDLLRERNDELAAIET
AL1A1_CHICK     --------------------------------------WRTMDASERGRLLNKLADLVERDRLTLATMEA
ALDH_ENCBU      --FATINPSTGEKLAEVQEGXXXXXXXXXXXXXXXXXXYRKHDASDRGRLLFKLADLIEAHRVQLRTLET
AL1A7_RAT       -----------------------------QAFQIGSP-WRTMDASERGCLLNKLADLMERDRVLLATMES
ALDH5_YEAS7     --------------------------------------WSIVEPEVRAKALFNLADLVEKHQETLAAIES
LADH_METVS      -----LNPYTLEIIERITALDREETKYAIEVATENKDVMKELNPSKRYSLLMKIAEHISSKKDLFANTIS
ALDH5_YEAST     --------------------------------------WSIVEPEVRAKALFNLADLVEKHQETLAAIES
XYLC_PSEPU      -----VDPSNGDILGITGVANGEDVDAAVNAAKRAQKEWAAIPFSERAAIVRKAAEKLKEREYEFADWNV
GABD2_MYCS2     -----------------------------------------RPVAERAAIMERFRDLVAKNRDFLMDVAQ
AL8A1_BOVIN     ------------------------------------PGWSSRSPQERSQVLQRLADXXXXXXXXXXXXXX
Y4UC_RHISN      ------SPYDGSLLGSVEATDPADIDRLLATARRGAEISRNLPRHKRASILEGAAQMVESRHDAFAEIIV
ABDH_CITK8      ------NPATGE---------------VILEIAEASPXWGQTTPKARAELLLTLADVIEENAQTFAELES
ALDH3_YEAST     ---ETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALET
AL221_ARATH     -------PATMKYLGYFPALSPTEVEERVTLSRKAQKTWAQSSFKLRRQFLRILLKYIIEHQELICEVSS
ABDH_SALPA      ------NPATGEVILEIAEASPAQIDAAVQAAVNTFAEWGQTTPKARAECLLKLADSIEQNALEFARLES
IOLA1_GEOTN     ------NPATGEVLAYVPISTREDLDRAVAAAKEAFKTWSKTPVPRRARILFKYQQLLVEHWEELARLVT
GABD2_MYCUA     -----------------------------------------RPVSERAEVIRRYRDLVIENREFLMDLLQ
ALDH2_YEAST     ---ETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALET
GABD2_MYCTU     --------------------------------------WAKRPVIERAAVIRRYRDLVIENREFLMDLLQ
GABD2_MYCTA     --------------------------------------WAKRPVIERAAVIRRYRDLVIENREFLMDLLQ
GABD2_MYCBP     --------------------------------------WAKRPVIERAAVIRRYRDLVIENREFLMDLLQ
GABD2_MYCBO     --------------------------------------WAKRPVIERAAVIRRYRDLVIENREFLMDLLQ
AL8A1_MOUSE     ------------------------------------PAWSSRSPQERSLVLNRLADVXXXXXXXXXXXXX
ABDH_SALAR      ------NPATGEVILEIAEASPKQVDAAVLAADNAFTAWGQTTPKVRAECLLELADSIKQNALQLAKLES
NAHF_PSEU8      --------------------------------------WKAVGPSERRRLLLKVADVMESKTPKFIEVMA
NAHF_PSEPU      --------------------------------------WKAVGPSERRRLLLKVADVMESKTPKFIEVMA
AMNC_PSESP      --FQDVTPIDGSVVAVVHEADRDLVDAAVKAGHRAEGEWGRTTAAQRVDWLRRIANEMERRQQDFLDAEM
ABDH_SHISS      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
IOLA2_GEOKA     ------NPATGEVLAYVPISSREELDEAVRAAKEAFKTWRKTPVPRRARILFKYQQLLVEHWEELARLVT
ABDH_ESCF3      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECOUT      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECOSE      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ABDH_ECOL6      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECOL5      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECOK1      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECO8A      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ABDH_ECO81      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECO45      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECO24      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ABDH_SHIFL      ------NPATGDVLLEIAEVSXXXXXXXXXXXXXXXXXWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_SHIF8      ------NPATGDVLLEIAEVSXXXXXXXXXXXXXXXXXWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECOLC      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ABDH_ECOHS      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ABDH_ECO55      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRTECLLKLADVIEENGQVFAELES
ABDH_SALTY      ------NPATGE---------------VILEIAEASPXWGQTTPKARAECLLKLADSIEQNALEFARLES
ABDH_ECOLI      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ABDH_ECODH      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ABDH_ECOBW      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ASTD_PSEF5      -AFTSVNPVTQAVIWSGNGATAAQVESAVQAARQAFPAWAKRSLEERISVLEAFAASLKSRADELARCIG
ABDH_ECOSM      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECOLU      ------NPATGEVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKARAECLLKLADVIEENGQVFAELES
ABDH_ECO27      --------------------------------------WGQTTPKARAECLLKLADVIEENGQVFAELES
ALDY_BACSU      -----LNPYDQSVITTASLATGKQLEDAFDIAQKAQKEWAKSTTEDRKAVLQKARGYLHENRDDIIMMIA
ALD1_STAES      -----INPATEEVMGKIAKGNEEDVNKAVDAADKVYLEFRHSSVEERRELLDKIVKEYQNRKNDLIEAIT
ALD1_STAEQ      -----INPATEEVMGKIAKGNEEDVNKAVDAADKVYLEFRHSSVEERRELLDKIVKEYQNRKNDLIEAIT
ROCA_GEOSW      ----SINPANKEVIGRVSKANKELAEKAMKVADEAFKWWSKTKPEARADILFRAAAIVRRRKHEFSALMV
GAPN_WHEAT      -----VNPTTRQTQYRVQACTQEEVNKVMDAAKVAQKSWARTPLWKRAELLHKAAAILKEHKTPIAESLV
GAPN_NICPL      -----INPTTRKTQYKVQACTQEEVNKVMEVAKTAQKSWAKTPLWKRAELLHKAAAILKEHKAPIAECLV
BADH_HORVU      --------------------------------------WARASGATRAKYLNAIAAKITGKIAYLALLET
ABDH_ECO5E      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ABDH_ECO57      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ALDH1_BACSU     ---EWVKSQSGDMVKVENPADVNDIVGYVQNANEAKTAWRKLTGAERGQYLYKTADIMEQRLEEIAACAT
IOLA1_GEOKA     ---EVPNPATGEVLARVPISTKEDVDQAVQAAKKAFATWKDVPVPKRARIMFSFHHLLNQHHEELAELVV
ABDH_SALCH      ------NPATGEVILEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADSIEQNALEFARLES
ROCA_GEOKA      ----SINPANGRVAKA----NKELAERAMKTADEAFRTWSRTSPEARADILFRAAAIVRRRKHEFSAWLV
ABDH_SHIDS      ------NPATGDVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKVRAECLLKLADVIEENGQVFAELES
ROCA_GEOTN      ----SVNPANAEVIGRVAKANKELAERAMKTADEAFRTWSRTSPEARADILFRAAAIVRRRKHEFSAWLV
IOLA_LISMC      -----INPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFSFQQLLIQHKEELARLIT
IOLA_LISIN      -----INPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFSFQQLLIQHKEELARLIT
IOLA_LISMH      -----INPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFSFQQLLIQHKEELARLIT
IOLA_BACA2      -----INPATKEVMCQVPISTREDVEYAVRSASEAFQTWSKTAVPRRARILFNYQQLLQQNKEELARLIT
IOLA1_BACSK     -----VNPATKEVICQVPLSTKADVEYAVEAAKTAFAKWSKVAVPRRARILFNYQQLLQRDKEELARLIT
ABDH_SALPC      ------NPATGEVILEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADSIEQNALEFARLES
ABDH_SALPB      ------NPATGEVILEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKLADSIEQNALEFARLES
ROCA_BACCN      ----SVNPANKEEIGSVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ABDH_SALTI      ------NPATGE---------------VILEIAEASPVWGQTTPKARAECLLKLADSIEQNALEFARLES
IOLA_LISMF      -----INPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFSFQQLLIQHKEKLARLIT
GAPN_STRMU      -------PASGAELGSVPAMSTEEVDYVYASAKKAQPAWRSLSYIERAAYLHKVADILMRDKEKIGAVLS
IOLA_LISMO      -----INPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFGFQQLLIQHKEELARLIT
IOLA_BACNA      -----VNPATKEVLCQVPISTKEDIDYAAQTAAEAFETWSKVAVPRRARILFNFQQLLSQHKEELAHLIT
ASTD_MARAV      --FESVQPVTGETV-----WDGNAVDAAVREARKAFLAWRRKSLAERQAVIEAFGELLEANKEELAHQIG
ALD1_STAS1      ---EVINPATEEVAGTIAKGNKEDVEKAVEAADNVYLEFRHTSVKERQDLLDQIVQEYKNRKEDLIQAIT
LADH_METMP      ------DPYTLENIEKITALDREETKNAIEVTEKHKEIMKNLSPSKRYKILMKVAEHLSSKKDFFAKTIS
LADH_METJA      -----INPYSLEVIKKIPALSREEAKEAIDTAEKYKEVMKNLPITKRYNILMNXXXXXXXXXXXXXXXXX
IOLA3_GEOKA     ------NPATGEVLAKVPLSSRXXXXXXXXXXXXXXXXWRKVPVPRRARILFRYQQLLVEHWDELARLVT
ALDHY_YEAST     --FPVYNPSTEEDITQVSEKSQHSTEEDITQVSEKSQHKAVVDISERGRLLNILADLIERDRDILAAIEH
IOLA_BACSU      -----VNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARILFNFQQLLSQHKEELAHLIT
LADH_METM5      ------DPYTLENIEKITALDREETKSAIEVAEKNKEIMKNLSPSKRYSILMKIAEQISLKKDLFAKTIS
IOLA_BACCN      ------NPATGKIIAYVPLSPKEDVERAVEAAKNAYETWSKVPVPNRSRMLYKYLQLLQENKDELSKIIT
ALD1_STAAW      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
ALD1_STAAS      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
ROCA_ANOFW      ----SINPANGRVAKA----NKDLAEKAMQTADAAFKWWSKTKPEMRADILFRAAAIVRRRKHEFSALLV
ALD1_STAAR      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
ALD1_STAAN      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
ALD1_STAAM      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
ALD1_STAAC      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
ALD1_STAA8      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
ALD1_STAA3      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
ASTD_PSE14      --FHSLNPVSQQTLWSGQAATPEQVDYAVQAARQAFPGWAQRSLDQRIAVLEAFAASLKGRADELAHCIG
AL1B1_BOVIN     --------------------------------------WRWMDALKRGWLLNHLADLVERDCVYLASLES
ALDH2_LEITA     --FEVVNPADEKVIANVAEAEKADVDLAVKAARHAFESFRMTDCQWRRNLMLRLADILEKNSKEMAALES
IOLA1_BACHK     ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKYLQLLQENKEELAKIIT
IOLA1_BACAN     ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKYLQLLQENKEELAKIIT
GAPN_APIGR      -----INPTTRMTQFKVQACTQEEVNKAMETAKKVQKQWAKTPLWKRAELLHKAAAILKEHKAAIADCLV
CROM_ENTDO      -AYSVINPCTTKKICDVQEGSKADIDKAVQACKLAGTPWRRMDASRRGHLLYRLADLFERDIAYLSSLET
ALD1_STAAB      -------------------------------------------VKERQALLDKIVKEYENRKDDIVQAIT
GAPN_MAIZE      -----VNPTTRKTQYRVQACTQEEVNKAMDAAKVAQKAWARTPLWKRADVLHKAAAILKEHKAPIAECLV
IOLA_BACC2      ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXFETWSKVPVPNRSRNLYKYLQLLQENKDELAKIIT
IOLA1_OCEIH     ------NPATGETIATVTISXXXXXXXXXXXXXXXFPEWSDIPVPNRTRYLLDYWKLLQDNKEELAKIIT
LADH_METM7      ------DPYTLKNIEKITALDREETKNAIEITEKNKEVMKNLSPSKRYSILMKIAEQISLKKDLFAKTIS
AL2C4_ARATH     --FETIDPRNGEVIATIAEGDKEDVDLAVNAARYAFDHWPRMTGFERAKLINKFADLIEENIEELAKLDA
IOLA_BACCR      ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXFETWSKVPVPNRSRNLYKYLQLLQENKDELAKIIT
IOLA_BACC1      ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKYLQLLQENKEELAKIIT
IOLA1_BACCZ     ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKYLQLLQENKEELAKIIT
IOLA1_BACAH     ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKYLQLLQENKEELAKIIT
IOLA2_GEOTN     ------NPATGEVLAKVPISSRXXXXXXXXXXXXXXXXWRKVPVPRRARILFRYQQLLVEHWEELARLVT
ASTD1_SHEDO     -SFSSVNPANGEVIWQGLGADAGQVDAAITSARAAFYTWSAMSLTERLVIVEAFAEQLKEHAELFARTIA
IOLA_BACC4      ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXFETWSKVPVPNRSRNLYKYLQLLQENKDELAKIIT
IOLA1_BACWK     ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXYKTWSKVPVPNRSRQLYKYLQLLQENKEELAKIIT
IOLA_BACCQ      ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKYLQLLQENKEELAKIIT
IOLA_BACC7      ------NPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKYLQLLQENKEELAKIIT
IOLA2_BACSK     ------NPATGEAIAYVPLSGERDVEQAVASAKRAYETWKTVPVPERTRYMFAYLEQLKKNREQLAQLIT
ALDH_PSESP      -----LNPATRQPIGQCPVASEEHVEQARAAAGDAFAVWRQVPYGKRCEQLQALAGILEAHLDELAQLLT
ROCA_BACC1      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACLD      --------------------------------------WRYTDPEERAAVLFRAVAKVRRKKHEFSALLV
ROCA_OCEIH      ----SINPSNNEVVGNVSKATKQHIEEAFTSAKEAFKEWKSWSAEDRARVLYRAAAIVRRRKHEFSAWLS
ROCA_BACWK      ----SVNPANKEELVGRVSKASRELAEKAMQVADATQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
GAPN_PEA        -----INPTTRKPQYKVQACSQEEVNKVMDSAKSAQKSWAKTPLWKRAELLHKAAAILKEHKAAIAECLV
ROCA_BACHK      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACCZ      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACCQ      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACC7      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACC3      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACC0      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACAN      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACAH      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACAC      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACAA      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ALDH_STRCO      --FENPSPVNGLPFTEIARGTADDVERALDAAHEAAPGWGRTSVTERSDILLKIADRMEANLERLAVAES
ROCA2_BACSU     --------------------------------------WRYTSPEERAAVLFRAAAKVRRRKHEFSALLV
IOLA2_BACLD     -----VNPATKEVLCQVPISTREDIEYAAQTAAEAFKTWSKVAVPRRARILFNFQQLLTQHKEELAHLIT
ABDH_SERP5      --------------------------------------WGQTTPKERAEHLLKLADLIDSHAETFARLES
ROCA_BACCR      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACC4      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
ROCA_BACC2      ----SVNPANKEELVRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
IOLA3_BACCZ     ------NPATGEVIAQVPLSTKVDVEQAVLAANEAFKSWSKTAVPKRARILFKYQQLLVDNWEDLAKLIT
ALDA_STAES      ------NPANGEDLAKVARAGKKDVDKAVQAAHDAFDSWSKISKEERADYLLEISRRIHEKTEHLATVES
ALDA_STAEQ      ------NPANGEDLAKVARAGKKDVDKAVQAAHDAFDSWSKISKEERADYLLEISRRIHEKTEHLATVES
MMSA_PSEAE      ------NPLDNSTLAEIACASAEQVEQAVASARETFASWKETPVSERARVMLRYQALLKEHHDELAKIVS
YOSF_SCHPO      -------PGDGSLLGEVKLFNKSDIDQSIILAEEAQKEWKSTSFAERRNFLKALKENIIRNQDKYAEIAC
ASTD_SPHAL      ----SFEPATGEQLWRGKVSD---VDAEVEIARRAWPEWAAKPVTFRTETLRRFADRVKAESEAFADLIA
ROCA_STAS1      --YQSINPATTEVIAEVSKATQKDVDDAFEAANEAYKSWKRWSHKDRAEFLIRVAAIIRRRKEEISAVMV
ASTD_LEGPH      LILESTNPASGTLLWQGNNATDEEIANACYVAHRALKSWANTSFEERARYTKAFVEQVEKNREQLARLIS
ASTD_LEGPC      LILESTNPASGTLLWQGNNATDEEIANACYVAHRALKSWANTSFEERARYTKAFVEQVEKNREQLARLIS
THCA_RHOER      --FENPTPVTGQNFCDVARSTXXXXXXXXXXXXXXXXXWGKTSVAERAIILNKIADRMEENLESIALAES
IOLA2_BACHK     ------NPATGEVIAQVPLSTKVDVEQAVLAANEAFKSWSKTAVPKRARILFKYQQLLVDNWEELAKLIT
ASTD_PSEFS      --FESRNPVTQHVLWAGNGATAEQVESAVQAARQAFPAWARRPLEERISVLETFAATLKNRADEIARCIG
ALDB_ECOLI      --YQNLTPVTGQLLCEVASSGKRDIDLALDAAHKVKDKWAHTSVQDRAAILFKIADRMEQNLELLATAET
IOLA_BACHD      ------NPATGEILAHVPISNREDLDRAVSVAKEAFKTWGKTPVPRRARVLFKYQQLLVENWEELARLVT
IOLA2_BACAN     ------NPATGEVIAQVPLSTKVDVEQAVLAANEAFKSWSKTAVPRRARILFKYQQLLVDNWEELAKLIT
IOLA2_BACCZ     ------NPATGEVIAQVPLSTKVDVEQAVSAANEAFKSWSKTAVPKRARILFKYQQLLVDNWEELAKLIT
IOLA2_BACAH     ------NPATGEVIAQVPLSTKGDVEQAVLAANEAFKSWSKTAVPKRARILFKYQQLLVDNWEELAKLIT
CROM_OMMSL      -AYPVYNPCDNEKVCEVQEGDKSDIDKAVQACKAAGTPWRRMDASRLGHLLYRLADLMERDIAYMASLET
ROCA1_BACHD     ---QSWNPARDQLVGSVSKANQDLAEKAIQSADEAFQTWRNVNPEERANILVKAAAIIRRRKHEFSAWLV
XYLG_PSEPU      --FDNVSPANGQVIRVHXXXXXXXXXXXXXXXXXLKGPWGKMTVAERAEILHRVADG-----------IT
ALDA_STAHJ      ------NPANGEDLAKVAKASKSXXXXXXXXXXXXXXSWSKTSKEERADYLLEISRRIHEKVEHFATIES
DHA2_RALEH      --FESTTPITGKPFTRVPRSGQQDVDXXXXXXXXXXXXXXRTSTTERANILNRIADRIEANLKLLAVAES
ASTD_LEGPL      LILESTNPASGTLLWQGNNATDEEIANACYVAHRALKSWANTSFEERARYTKAFVEQVEKNRDQLARLIS
ALDH_RHORT      --FDNVTPITGKVFCKAARSTEEDITXXXXXXXXXXXRWGRTTAAERALILNRIADRLQDNLETLAYVES
ALDH_MYCTU      --FENPTPVTGQPFCEVPRSXXXXXXXXXXXXXXXXPGWGKTAPAERAAILNMIADRIDKNAAALAVAEV
ALDH_MYCBO      --FENPTPVTGQPFCEVPRSXXXXXXXXXXXXXXXXPGWGKTAPAERAAILNMIADRIDKNAAALAVAEV
AL7B4_ARATH     ----TLNPANNQPIAQVVEASLEDYEQGLKACEEAAKIWMQVTAPKRGDIVRQIGDALRSKLDYLGRLLS
ASTD_PSEPF      -AFQSLNPVTQQVLWSGEGATAAQVESAVQAARQAFPGWARRTLEDRISVLEAFAAALKNHADELARTIG
AL7A1_PEA       ----SVNPSTNQVIASVTEATLDDYEEGLRASSEAAKTWRTVPAPKRGEIVRQIGDALRAKLDPLGRLVA
IOLA_LACCA      --FENVNPATGDVLARVPHSTSEDVADAVTAAKEAFKIWQKVSIPKRAKILFKYQQLLVEHQEELGRIVT
ASTD_NOVAD      ----SHEPATGAEVWRGKVGD---VEEVVXXXXXXXXXXXXQPLATRIELVRRFANEVRKDADNLATMIS
ASTD_PSESM      --FHSLNPVTLHVLWSGQGATAEQVDHAVQAARQAFPAWALLSLDQRIAVLDAFAVSLKAHADELANCIG
AL7A1_BRANA     ----TLNPANNQVLPIAQVVEASLEDYELKACEEAAKTWMQVPAPKRGDIVRQIGDALRSKLDYLGRLLS
ASTD_PSEU2      ----SLNPVTQQVLWSGRGXXXXXXXXXXXXXXXXFPGWALLSLDQRIAVLEAFAARLKHHADALAQCIG
ASTD_PSEPW      -ALQSLNPVTQAVVWQGQGADASQVDAAVLAARQAFPAWAQLSLEARIDVLEKFAEQLKQHSEALAYCIG
ALDH_VIBCH      --FSNTSPVNGLVFCRVARSSSQDVELALDAAHNALESWSTTSAVERSNILLRIADRIESNLETLAIVES
ALDH_VIBC3      --FSNTSPVNGLVFCRVARSSSQDVELALDAAHNALESWSTTSAVERSNILLRIADRIESNLETLAIVES
AL7A1_MOUSE     ------------------------------KAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVS
IOLA_BACP2      ------NPATGKIIAEVPLSTKKDVERAVQAAQEAFTTWSKTPVPRRARILFKYQQLLVDKWDELAELVT
IOLA2_BACWK     ------NPATGEIIARVPLSTKEDLDRAVATAKEAFKTWRKVAVPRRARILFRYQQLLIENWEGLAKLVT
ASTD1_CAUCR     ----SRDPYTGEAIADFAVNDARSIDAACHSARAAFAEWAMTPLAERRAIALRFAETVRARREEIATLIA
ABDH_ENT38      ------NPATGEVLLEIXXXXXXXXXXXXXXXXXXXXXWGHTTPKARAECLLKLADVIEEHAETFARLES
ROCA_BACP2      --------------------------------------WRYTSPEERASVIFRAAANIRRKKHEYSALLV
ASTD_PSEMY      ------------------------VDEAVNAARGAFSLWAAHSLDGRIAVLERFAAALKSHADELARAIG
ASTD_LEGPA      LILESTNPASGTLLWQGNNATDEEITHACYIAHCALKSWANTSFEERARYTIAFVEQVEKNRDQLARLIS
ASTD_IDILO      --FKSIDPARNEVIWSGEAASETQVEKAILAARAAFPDWSGRSVEERLAICQKFSELLEENKEHLARTMA
MMSA_DROME      ------DPATNQVVTRVPKATQAEMQAALESNKKAFRSWSNQSILTRQQVMFKLQALIKENMGELAKNIT
ASTD2_PSEHT     -AFASINPSNGETIWQGNGASAEQVNSAIKAARAAQLQWADTPLEQRITILENFAAQLKEHSEEFAVIIA
ALDH_DEIRA      --------------------------------------WGRTSVTERSNILLKIADRMEQNLEMLAVAET
ASTD_PSEP1      ---QSLNPVTQAVIWQGQGADASQVDTAVQAARQAFPAWAQLSLEARIDVLEKFAAQLKVHAEAMAQCIG
ASTD2_SHEDO     ----SINPATGQSIWNGVTATADQVNQAVDAARAAQFDWFMLGFEARLSIVEAYRSELEANKAQLAEVIA
ASTD_CHRVO      -------------------------------------------LEERAKVVRRFGERLTERKAELARVIA
ASTD_PSEE4      -ALQSLNPVTQAVVWTXXXXXXXXXXXXXXXXXXXFPGWASLSLEARIGVLEAFAGKLKARAEELAHCIG
ASTD_PSEAE      ---ESLDPVGQGVVWSGRGADATQVDAAVCAAREAFPAWARRPLEQRIELLERFAATLKSRADELARVIG
ASTD_ACIAD      -SWNTCNPVSQQVVWQGNEATAQQVEQACEAARQAFPQWATTSLTDRIAIIERFALLLEQNKEALAKIIS
AL7A1_MALDO     ----TVSPSNNQEIAKVTEVSMEEYEEGLRSCNDAAKTWKSLPAPKRGEIVRQIGDALREKLQHLGKLVS
AL7A1_BOVIN     ----------------------------VEKAREAWSIWADVPAPKRGEVVRQIGDALREKIQVLGSLVS
GAPN_STREI      -------PATGEELGSVPAMSQEEVDYVYXXXXXXXXXXXXLSYVERAEYLHKAADILMRDAEKIGAVLS
GAPN_ARATH      -----MNPATRKTQYKVQACTQEEVNAVMELAKSAQKSWAKTPLWKRAELLHKAAAILKDNKAPMAESLV
ASTD_CHRSD      --FAKTDPVSGETLWTATAASATQVEHAVAAARQAFPDWARRSFAERQAVVERFRECLETHREHLATAIA
MMSA_DROPS      ------DPATNKVVTRVPKATQDEMQTALESNKKAFRSWSNQSILTRQAVMFKLQALIKENMGELAKNIT
IOLA2_OCEIH     ------NPATGEVIAQVPISTTEDVHHAIEVANEAFKTWKEVPVPKRARILFKYQQLLVEHWEELAKLIT
ASTD_BURM1      -AFASRNPGTDDIAWQGASASAADVDRAIMSARRAFADWSALDFESRCAIAKRFAALLNERKEALAAAIG
AL7A1_HUMAN     ----------------------------VKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVS
YHJ9_YEAST      -------PATGQYLGSFPSKTEADIDEMVSKAGKAQSTWGNSDFSRRLRVLASLHDYILNNQDLIARVAC
ASTD_KLEP7      ------------------------------------PSWARLPFAARQAIVEKFAALLEASKAELTAVIG
MMSA_HUMAN      ------NPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLIT
MMSA_MOUSE      ------NPATNEVVGRVPQSTKAEMDAAVESCKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIARLIT
MMSA_BOVIN      ------NPATNEVIGRVPESTKAEMDAAVSSCKRTFPAWADTSILSRQQVLLRYQQLIKENLKEIARLIM
ASTD1_PSEHT     --FSSVNPANNNVIFQANSATAEQVDAAVSAAREAFYAWADKTFAERLEIVKAFAAQLKENSEELAITIA
MMSA_AEDAE      ------DPATNKVVTRVPKCTQDEMESAVESSKKAFKTWSQTSILGRQQVMFKLQHLIRNNMSELAKNIT
ASTD_PHOLL      ------SPIDQQVLWQANSADASQVRAACHAAREAFYAWSHLPASERIKVIQTFAALLNEEKETLARVIS
ALDH2_MACPR     ----------------------------------------------------------------------
ASTD_BURVG      --FASRNPGTDAIAWQGXXXXXXDVERAVASARRAFAGWSALDFDARCEIVKRFAALLTERKEALAAAIG
ASTD_BURCH      --------------------------------------WSALDFEARCEIVKRFAALLTERKEAIATAIG
ASTD_BURCA      --------------------------------------WSALDFEARCEIVKRFAALLTERKEAIATAIG
ASTD_PHOPR      -AMNSLNPFSSEEIWQGDAATAEQVEQAVSAAREALTTWRKTDLSERQAVVEKFAELVKEHSEHIAHTIA
ASTD_SHEB9      ----SINPANAQTIWTGKTATAEQVNAAVDAAREAQFDWFMLGFDARLAIVEAYRSQLEANKAELAETIA
ASTD_SHEB5      ----SINPANAQTIWTGKTATAEQVNAAVDAAREAQFDWFMLGFDARLAIVEAYRSQLEANKAELAETIA
ASTD_ENT38      ------NPVGNEALQGFDA-SPAQVEQACQAARKAFPAWAKLPFTARQAIVEKFATLLEANKAELTRVIA
ASTD_VIBSL      -AMTSVSPYNNEVVWQGDSATPAQVESAVAAARDAFLVWKKLSFAEREAIVLNFAEKVKENSEEIAQIIA
ASTD_COLP3      ----SSNPARNEVIWQGKTASKDQVNDAVLSARQAFESWANISLEARVAVVTKFAELLAENKDALATTIA
ASTD_BURCJ      --------------------------------------WSALDFEARCEIVKRFAALLTERKEAIATAIG
MMSA_RAT        ------NPATNEVVGRVPQSTKAEMEAAVAACKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIARLIT
MMSA_DICDI      ------NPATQELVTKVPVSTKEEMEAAVKAASDAFPAWRDTSVSNRSRIISNYKNLINKNMDKIAAIIT
ASTD_BURA4      --------------------------------------WSALDFEARCAIVKRFAALLTERKEAIATAIG
ASTD_SALAR      ------NPVSAEILWQGNDADTAQVAGACEAARAAFPCWARQPFAARQAIVEKFAVLLEEHKAELTAVIA
ROCA_BACSU      ----SINPANKEEIIGYASTDQELAEKAMQAALQAFDSWKKQRPEHRANILFKAAAILRRRKHEFSSYLV
MMSA_ANOGA      ------DPATNEVVTRVPKCTQDEMQTAVESSKKAYKTWRQSSILSRQQVMLKLQHIIRNNMSELAKNIT
ASTD_ECO5E      --------------------------------------------AERQAVVERFAGLLERNKGELTAIIA
ASTD_ECO57      --------------------------------------------AERQAVVERFAGLLERNKGELTAIIA
ASTD_BURCC      --------------------------------------WSALDFEARCAIVKRFAALLTERKEAIATAIG
ASTD_BURCM      --------------------------------------WSALDFEARCEIVKRFAALLTERKEAIATAIG
ASTD_SHESA      ----SSNPANSEIIWRGQTATAEQVNAAVDAAREAQFDWFMLGFDGRLKIVEAYRSQLEANKAELAETIA
ASTD_AERS4      --------------------------------------WSDLALEDRLAIVRRYADLLGEHKEALALTIA
AL3A1_RAT       ----------------------SSISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALA
ASTD_SHEON      ----SSNPANGEIIWRGQTATAEQVNAAVDAAREAQFDWFILGFDARLKIVEAYRSQLEANKAELAETIA
ASTD_BURS3      --------------------------------------WSALDFESRCAIVKRFAALLNERKEAIAAAIG
ROCA_STAES      --FNSVNPATSQLIAKVSKATQDDIEKAFESANHAYQSWKKWSHKDXXXXXXXXXXXXXXXKEEISAIMV
ROCA_STAEQ      --FNSVNPATSQLIAKVSKATQDDIEKAFESANHAYQSWKKWSHKDXXXXXXXXXXXXXXXKEEISAIMV
ASTD_ECOHS      -------------------------------------------LAERQVVVERFAGLLESNKAELTAIIA
ASTD_YERPS      VSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQFAALLEQHKQSLARTIS
ASTD_YERPB      VSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQFAALLEQHKQSLARTIS
ASTD_ECO8A      -------------------------------------------LAERQVVVERFAGLLERNKGELTAIIA
ASTD_ECO55      -------------------------------------------LAERQVVVERFAGLLERNKGELTAIIA
ASTD_ECO24      -------------------------------------------LAERQVVVERFAGLLERNKGELTAIIA
ASTD_VIBHB      -AFTSLSPYNQEVIWQGNGATAEQVNQAVSAAREAFVDWKKRPFAEREAIVLAFAEKVKENSEKIAEVIA
ASTD_SHIBS      -------------------------------------------LAERQVVVERFAGLLESNKAELTAIIA
ASTD_HAHCH      --FESLDPVTQDCLWKXXXXXXXXXXXXXXXXXXXFTSWGRLDVSRRIDIVKRFAELLEEDKERLADVIG
ASTD_ECOL5      ---------------------------------------------------------LESNKAELTAIIA
ASTD_ENTS8      ---------------------------------------------DRQAIAEKFAALLEANKTELTRIIA
ASTD_ECOUT      ---------------------------------------------------------LESNKAELTAIIA
ASTD_ECOLI      --------------------------------------------AERHAVVERFAALLESNKAELTAIIA
ASTD_ECOLC      --------------------------------------------AERQAVVERFAGLLERNKGELTAIIA
ASTD_ECODH      --------------------------------------------AERHAVVERFAALLESNKAELTAIIA
ASTD_ECOBW      --------------------------------------------AERHAVVERFAALLESNKAELTAIIA
ASTD_ECO45      ---------------------------------------------------------LESNKAELTAIIA
ALDH2_BACSU     ----------------------NSIPSIISKHKAYFAAGHTRPLESRLNILRKLKQAVRTHEADLIAALY
MMSA_CAEEL      ---ELTNPATNEVIAMVPNATQAEMQAAVDSAKNAFNTWKNTSPLTRQQCMFKLQALIKRDMKKLAESIT
ASTD_YERPY      VSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQFAALLEQHKQSLARTIS
ASTD_YERPG      VSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQFAALLEQHKQSLARTIS
ASTD_YERPE      VSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQFAALLEQHKQSLARTIS
ASTD_YERPA      VSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQFAALLEQHKQSLARTIS
ASTD_ECO81      ---------------------------------------------------------LESNKAELTAIIA
IOLA1_BACLD     ---EVVNPANGNVIAYAPLSXXXXXXXXXXXXKHAYQTWSLVPVPNRARXXXXXXXXXXXXXXXXADIIT
ASTD_YERPP      VSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQFAALLEQHKQSLARTIS
ASTD_SHIB3      -------------------------------------------LAERQVVVERFAGLLESNKAELTAIIA
ASTD_ECOSE      -------------------------------------------LAERQVVVERFAGLLERNKGELTAIIA
ASTD_VIBVU      --FTSLSPYDNQVVWRGKGATAEQVEMAVKAARQAFVGWKTLSVAEREAVVLAFAEQVKENSEEIAQVIA
ASTD_ECO27      ---------------------------------------------------------LESNKAELTAIIA
MMSA_ARATH      -----INPATQEVVSKVPLTTNEEFKAAVSAAKQAFPLWRNTPITTRQRVMLKFQELIRKNMDKLAMNIT
AL7A1_CAEEL     ---QSFAPANNSPIANVQNGNVQDYEIAISEAKKAYNDWCEVPAPRRGEIVRQIGDKLRTQLQNLGKLVS
ROCA2_BACHD     ----SVNPAMKQVIGVVSKASREIVDDAFKSAETAFHTWKNVNPEEXXXXXXXXXXXXXXXKHEFSAWLV
ASTD_PSEA6      ---ESIDPAKKRQIWQAKSASSEQVNQAVSSARKATVTWAACTFEQRLAYVKRFGELLAENKDMLALTIA
ASTD_VIBPA      --------------------------------------WKKRPFAEREAIVLAFAEKVKENSEKIAEVIA
ASTD_SHEPC      ----SINPANGETIWCGKTATAEQVNTAVEAARAAQFDWFMLGFDARLAIVEAYRSQLEANKAELAETIA
ASTD_ECOLU      ---------------------------------------------------------LESNKAELTAIIA
ASTD_ECOL6      ---------------------------------------------------------LESNKAELTAIIA
ASTD_VIBVY      --FTSLSPYDNQVVWRGKGATAEQVEMAVKAARQAFVGWKKLSVAEREAMVLAFAEQVKENSEEIAQVIA
ASTD_AERHH      --------------------------------------WSDLALDYRLAIVRRYADLLGEHKEALALTIA
ASTD_SHIF8      -------------------------------------------LAERQVVVERFAGLLESNKAELTAIIA
ASTD_SERP5      ---------------------------------------------QREQLVKRFAALLEEHKSHLAATIS
ASTD_SORC5      --------------------------------------WRDRGLEERAALVKRFAGVLGEHKARLADVIG
ASTD_SHIDS      ---------------------------------------------------------LESNKAELTAIIA
ASTD_SHIFL      -------------------------------------------LAERQVVVERFAGLLESNKAELTAIIA
ASTD_VIBCM      ------------------------VDAAVNAARRAFLDWKKRPFAEREQKVLAFAELVKANSEQIAQVIA
AL3A1_MOUSE     ------------------------ISSIVNRARDAFNSGKTRPLQFRVEQLEALQRMINENLKGISKALA
ROCA_STAHJ      --FDSINPATSELIAKVSKATKEDVDKAFESSNKAYKAWRQWSHKDXXXXXXXXXXXXXXXKEEISAVMV
PUTA_ECOLI      ------------------------VEQALESAVNNAPIWFATPPAERAAILHRAAVLMESQMQQLIGILV
ASTD_VIBF1      ---QSLSPYNSEVVWKGESATEAQVESAVNAARNAFIEWKKLPFENRQAIVERFAELVKENADSIAEVIA
ROCA_STAAW      ---KSINPATSQVIANASKATKQDVEDAFKAADEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAAT      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAAR      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAAN      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAAM      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAAE      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAAC      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAAB      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAA9      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAA8      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAA3      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAA2      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ROCA_STAA1      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ASTD_SALG2      ------NPVSAEILWQGNDANAAQVAEACQVARAAFPRWARQPFAARQAIVEKFAALLEAHKAELTEVIA
ASTD_SALEP      ------NPVSAEILWQGNDANAAQVAEACQVARAAFPRWARQPFAARQAIVEKFAALLEAHKAELTEVIA
PUTA_SALTY      -----INPAEPKDIV---GWGREAVEQALQNAVNQAPVWFATPPQERAAILQRAAVLMEDQMQQLIGLLV
ASTD_SHEPA      ----SINPANQKVIWNSKTATPEQVGVAVDAARNAQFDWFMLGFDARLAIVEAYRDQLEANKAEMAEVIA
ASTD_SHEHH      ----SINPANQEVIWNSKTATPEQVSQAVDAARNAQFDWFMLGFEGRLAIVEAYRDQLEANKAEMAEVIA
ASTD_SHEB8      ----SINPANAQTIWTGKTXXXXXXXXXXXXXXXXQFDWFMLGFDARLAIVEAYRSQLEANKAELAETIA
ASTD_ALISL      ---QSLSPYNSNVVWQGESATKDQVESAVSAARHAFIEWKKQPFEARQVIIERFAALVKENTDKIAEVIS
PUTA_KLEAE      -----VNPAVGYVREASDAEVQQALTSAINN----APIWFATPPQERAAILERAAVLMESQMPTLMGILV
ASTD_VIBCH      ------------------------VDAAVKAARRAFLDWKKRPFAEREQKVLAFAELVKANSEQIAQVIA
ASTD_VIBC3      ------------------------VDAAVKAARRAFLDWKKRPFAEREQKVLAFAELVKANSEQIAQVIA
ASTD_SHEPW      ----SINPANQEVIWNSKTATPEQVNTAVDAARNAQFDWFMLGFEARLAIVEAYRDQLEANKAEMAEVIA
ASTD_CITK8      ----------------------------------------------RQAIVEKFAALLEVHKAELTAIIA
ASTD_BURXL      -AFASRNPGTGAAVWEGNXXXXXXXXXXXXXXXXXXXXXXXXXXDERCAVVRRFAALVTERKEALAEAIG
ASTD_VIBFM      ---QSLSPYNSEVVWKGESATEAQVESAVNAARNAFIEWKKLPFENRQAIVERFAELVKDNADSIAEVIA
ASTD_SHESH      -AVTSKNPANNDVIWNSQTATPEQVNTAVEAAREVQFDWFMLGFEARLAIVEAYRAQLEENKAEIAETIA
ASTD_SALA4      ------------------------------------PRWARQPFAARQAIVEKFAALLEAHKADLTEVIA
ASTD_PSEPK      -------------------------------------------LEARIDVLEKFAAQLKVHAEAMAQCIG
ASTD_SHEFN      --------------------------------------WFMLGYEARLAIVEAYRAQLEANKAEIAETIA
ASTD_PSEPG      -------------------------------------------LEARIDVLEKFAAQLKVHAEAMAQCIG
AL3A1_HUMAN     ----------------------------------------------------------------------
ASTD_SALNS      ------------------------------------PRWTREPFAARQAIVEKFAALLEAHKAELTEVIA
ALDH3_BACSU     ----------------------------------------------------------------------
ROCA_STAAS      ---KSINPATSQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSXXXXXXXXXXXXXMV
ASTD_ERWT9      --------------------------------------WARQPFAERQAIVEKFAALLDTNRVELSEAIA
ASTD_ECOSM      ------------------------------------------------------AALLESNKAELTAIIA
ASTD_SHEB2      --------------------------------------WFMLGFDARLAIVETYRSQLEANKAELAETIA
ASTD_CAUSK      ----SVDPTTGEVIWRQXXXXXXXXXXXXXXXRKAFPAWADRSREERIAVLRRYKDVLVARTGTFAEALS
AL7A1_DICDI     -----LNPTNNKVIATVRGAAPEEYETCIQAMLAAKVKWALTPAPRRGEIVRLIGQAMREKIEPLSKLIS
ASTD_SHESW      ----SINPANGETIWCGKXXXXXXXXXXXXXXXXXXFDWFMLGFDARLAIVEAYRSQLEANKAELAETIA
ASTD_SHEWM      ----SKNPANSEVIWSSKTATAEQVNTAVEAAREVQFDWFMLGFEGRLAIVEAYKTQLEEHKAEMAEVIA
ASTD_ESCF3      ---------------------------------------------------------LESNKVELTAIIA
ASTD_SALPB      ----------------------------------------------RQAIVEKFAALLEAHKADLTEVIA
ASTD_ECO7I      ---------------------------------------------------------LESNKAELTAIIA
CALB_PSEUH      ------------------------LGSALDRMKKAHLEQGPANLELRLSRLDRAIAMLLENREAIADAVS
ASTD_SALPK      ----------------------------------------------RQAIVQKFAALLEAHKADLTEVIA
ASTD_SALPA      ----------------------------------------------RQAIVQKFAALLEAHKADLTEVIA
ASTD_SALTY      ------------------------------------------------------AALLEAHKAELTEVIA
ASTD_SALTI      ---------------------------------------------------------LEAHKADLTEVIA
ASTD_SALPC      ----------------------------------------------RQAIVEKFAVLLEAHKADLTEVIA
ASTD_SALHS      ---------------------------------------------------------LEAHKAELTEVIA
ASTD_SALDC      ------------------------------------------------------AALLEAHKAELTEVIA
ASTD_SALSV      ------------------------------------------------------AALLEAHKAELTEVIA
AL3B1_RAT       ----------------------DSFEDKLQQLREAFNAGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALA
ALDH3_DICDI     -----------------------------------------RKIDWRYSQLKAIKKMMSENKDNITAAVK
AL3B1_HUMAN     ----------------------------LRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALA
AL3B1_MOUSE     ----------------------DSFEDKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALA
AL3A2_MACFA     ----------------------------VQRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIA
ASTD_BURPS      -------------------------------------------LDARCAIVKRFAALLVERKEALATMIG
ASTD_BURP6      -------------------------------------------LDARCAIVKRFAALLVERKEALATMIG
ASTD_BURP1      -------------------------------------------LDARCAIVKRFAALLVERKEALATMIG
ASTD_BURP0      -------------------------------------------LDARCAIVKRFAALLVERKEALATMIG
ASTD_BURMS      -------------------------------------------LDARCAIVKRFAALLVERKEALATMIG
ASTD_BURMA      -------------------------------------------LDARCAIVKRFAALLVERKEALATMIG
ALDH_PSEOL      -------------------------------------------IAERIAALNLLKETIQRREPEIIAALA
ALDH9_POLMI     ----------------------------------------------------------------------
PUT2_EMENI      ------NPASHGPVATYSNATAKDVQAAIESALEARKSWASTPFADRASVFLKAADLISTKRYDVMALTM
ASTD2_CAUCR     ----STDPATGEDVWSXXXXXXXXXXXXXXXXXXXXXXXXDRPREERIAILRRYKDILVERAAPYAEALS
AL3A1_CANFA     ------------------------ISEVVQRARAAFNSGKTRPLQFRIQQLEALRRMIKEHEKDLAGALT
ALDH_CRAPL      ----------------------------------------------------------------------
AL3H1_ARATH     ----------------------------------------------------------------------
AL3A2_HUMAN     ----------------------------VRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIA
AL3A2_PONAB     ----------------------------VRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIA
AL3B1_BOVIN     ----------------------------LQRLREAFVSGRTRPAEFRDAQLKGLSRFLRENKQLLQEALA
ASTD_BURTA      ------------------------------------------DLDARCTIVKRFAALLVERKEALATMIG
AL3A2_RAT       ----------------------------VQRLRQTFRSGRSRPLRFRLQQLEALRRMVQEREKDILAAIA
AL3A2_MOUSE     ----------------------------------------------------------------------
GAPN_SCEVA      ----------------------------------------------------------------------
ALDH1_ENTHI     ------------------------IQTICKTLKESYSTNALRHLDARKEVLYCLYRMVLDNKQAISNAIR
PUTA_RHIME      -----------------------------------------------------AAELMQARMPTLLGLII
CALB_PSEAE      ----------------------------------------------------------------------
CALB_CAUCR      ------------------------MNDVLQRQKAAHLRDGPPSAEKRIQWLNRCIDLLVGHQAEIAKAVN
AL4A1_HUMAN     ----------GHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSRRAEILAKTM-
A16A1_RAT       ----------------------------------------------------------------------
AL4A1_DANRE     --------------------DKDLLNKAIEASVAARREWDLKPVSDRAQIFFKAADIISKRAEVLAKTM-
A16A1_MOUSE     --------------------------------------WSQLPGAARGQHLTRLAKVVQKHQRLLWTLES
A16A1_BOVIN     --------------------------------------WSTQPGAIRAQHLTRLAKVIQKHQRLLWTLES
MAOC_ECOLI      -------------------------------IEKGAPALRAMTFIERAAMLKAVAKHLLSEKERFYAL-S
PUT2_SCHPO      ------------------------VEDAIEAALRGKKVWESLPFADRSAIFLKAAHLISTKRYKLMAATM
AL3B2_HUMAN     ----------------------------------------------------------------------
A16A1_HUMAN     ------DPITGENLASCLXXXXXXXXXXXXXXRMAFKGWSAHPGVVRAQHLTRLAEVIQKHQRLLWTLES
PUT2_YEAST      --------------------------------------------------LKAADLISTKYRYDMLAATM
AL4A1_MOUSE     -----------------------AIDAALAARKE----WDLKPMADRAQVFLKAADMLSRRAEVLAKTM-
AL4A1_RAT       ----------GHKVAKFCYADKALLNKAIEAAVLARKEWDLKPVADRAQIFLKAADMLSRRAEILAKTM-
AL4A1_BOVIN     ----------GHKVAKFCYADKALLHRAIGAALAARKEWDLKPVADRAQVFLKAADLLSRRAEVLAKTM-
AL3F1_ARATH     ----------------------------------------------------------------------
AL4A1_DICDI     -------------LATFHQANAELLKLAVENSMESKAQWESLPFEARSAVFLKAADLLNTKRYDVLASTM
AL3I1_ARATH     ----------------------------------------------RISQLQNIARMIDEKEKCITEALY
PUT2_AGABI      -------------LCTFHEGSPELVEKATCGALQAKDGWETMPWNDRAAIFLKAAD-LASGKYRYKLMAA
HFD1_YEAST      ----------------------------------------------------------------------
AL3A1_BOVIN     ----------------------------------------------------------------------
BOXD_AZOEV      ---------------------------------------------ERAAKLAAIAELLQAKRAEYFDISL
AL7A1_RAT       ----------------------------------------------------------------------
EUTE_SALTY      ----------------------------------------------------------------------
ALDHX_YEAST     ----------------------------------------------------------------------
ALDH_VIBHA      --------------------------------------------SKRASLLRTIASELEARSDDIIARAH
PROA_CYAP4      ----------------------------------------------------------------------
EUTE_ECOLI      ------------------------------------------------QLAIAAIREAGEKHRDLAELAV
ALDH_LINUS      --------------------------------------------------------------EFFARLIQ
PROA_STRU0      ----------------------------------------------------------------------
PROA_ACIAD      ----------------------------------------------------------------------
PROA_THEP1      ----------------------------------------------------------------------
PROA_DESDA      ----------------------------------------------------------------------
ADHE_CLOAB      ------------------------LDEKLKVIKEAQKKFSCYSQEMVDEIFRNAAMAAIDARIELAKAAV
PROA_PELTS      -----------------------------RRVKEASIVLASAGTELKNRALAQIARSLQDGREEIIRANR
SEC16_NEOFI     ----------------------------------------------------------------------
PROA_CLOPS      ----------------------------------------------------------------------
PROA_CLOPE      ----------------------------------------------------------------------
PROA_THESQ      ----------------------------------------------------------------------
PROA_THEMA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LEMGKLLGEARAEIEKCAWVCEYYEEHAPRFLADEVIESDARRSYVALQPLGTVLAIMPWNFPFWQVFRF
GABD_SYNY3      LEMGKSIPQAIAEVNKCALVCRFYADKAEEYLADEVVTTDASQSFIAYQPLGVILAVMPWNFPFWQVFRF
GABD_DEIRA      LEMGKLLREAKGEVALAASILNYYGEQGPSFLEPKTIPVPQGEAAVLHAPLGVLLGIEPWNYPLYQVVRF
YNEI_ECOLI      REMGKPINQARAEVAKSANLCDWYAEHGPAMLKAEPTLVENQQAVIEYRPLGTILAIMPWNFPLWQVMRG
GABD1_MYCPA     LEMGKTLKSAKAEALKCAKGFRYYAQNAEQLLADEPADAGAARAYIRYQPLGVVLAVMPWNFPLWQAVRF
GABD1_MYCA1     LEMGKTLKSAKAEALKCAKGFRYYAQNAEQLLADEPADAGAARAYIRYQPLGVVLAVMPWNFPLWQAVRF
GABD1_MYCUA     LEMGKTIASAKAEVLKSAKGFRYYXXXXXXXXXXXXXKVGASQAYTRYQPLGVVLAVMPWNFPLWQAGRF
GABD1_MYCTU     LEMGXXXXXXXXXXXXXXXGFRYYXXXXXXXXXXXXXKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRF
GABD1_MYCTA     LEMGXXXXXXXXXXXXXXXGFRYYXXXXXXXXXXXXXKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRF
GABD1_MYCBP     LEMGXXXXXXXXXXXXXXXGFRYYXXXXXXXXXXXXXKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRF
GABD1_MYCBO     LEMGXXXXXXXXXXXXXXXGFRYYXXXXXXXXXXXXXKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRF
GABD1_MYCLE     LEMGKTLQSAKDEAMKCAKGFRYYAEKXXXXXXXXXXXXXXXXXXXXXQPLGVVLAVMPWNFPLWQTVRF
GABD_ECOLI      LEQGKPLAEAKGEISYAASFIEWFAEEGKRIYGDTIPGHQAKRLIVIKQPIGVTAAITPWNFPAAMITRK
BETB1_RHIME     LDTGKPIQETIADPTSGADSFEFFGGVAPAALNGDYIPLGGDFAYTKRVPLGVCVGIGAWNYPQQIACWK
BETB_SINMW      LDTGKPIQETIADPTSGADSFEFFGGIAPAALNGDYIPLGGDFAYTKRVPLGVCVGIGAWNYPQQIACWK
AL9A1_MOUSE     INNGKSIFEARLDVDTC-WQCEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIACWK
BETB_RHIE6      LDTGKPIQETIADPTSGADAFEFFGGVAPAGLNGSHIPLGQDFAYTKRVPLGVCVGIGAWNYPQQIACWK
BETB_RHIEC      LDTGKPIQETIADPTSGADAFEFFGGVAPAGLNGSHIPLGQDFAYTKRVPLGVCVGIGAWNYPQQIACWK
BETB_YERPY      ADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRGSAFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_RHIL3      LDTGKPIQETVADPTSGADAFEFFGGIAPAGLNGSHIPLGQDFAYTKRVPLGVCVGIGAWNYPQQIACWK
BETB_ACIBT      LDTGKAYSESTVDIVTGADVLEYYAGLATAIQGEQVPLRESSFFYTRREPLGVVAGIGAWNYPIQIALWK
BETB_RHISN      LDTGKPIQETIADPTSGADSFEFFGGIAAAALNGDYIPLGGDFAYTKRVPLGVCVGIGAWNYPQQIACWK
BETB_PSEA7      LDTGKPLAETRADIVTGADVLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWK
BETB_AGRT5      LDTGKPIQETIADPTSGADAFEFFGGIAPSALNGDYIPLGGDFAYTKRVPLGVCVGIGAWNYPQQIACWK
BETB_ACIBY      LDTGKAYSESTVDIVTGADVLEYYAGLATAIQGEQVPLRESSFFYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ACIB5      LDTGKAYSESTVDIVTGADVLEYYAGLATAIQGEQVPLRESSFFYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ACIB3      LDTGKAYSESTVDIVTGADVLEYYAGLATAIQGEQVPLRESSFFYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ACIBC      LDTGKAYSESTVDIVTGADVLEYYAGLATAIQGEQVPLRESSFFYTRREPLGVVAGIGAWNYPIQIALWK
BETB_PSEAE      LDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWK
BETB_PSEA8      LDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWK
SSDH_RAT        AESGKPLKEAQGEILYSAFFLEWFSEEARRVYGDIIYTSAKKRGLVLKQPVGVASIITPWNFPSAMITRK
BETB_PSEFS      LDTGKAFSETQVDVVTGADVLEYYAGLVPAIEGEQIPLRDTSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_PSEAB      LDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWK
BETB_ACIBS      LDTGKAYSESTVDIVTGADVLEYYAGLATAIQGEQVPLRESSFFYTRREPLGVVAGIGAWNYPIQIALWK
AL9A1_RAT       INNGKSIFEARLDVDT-SWQCEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCLGIGAWNYPFQIACWK
SSDH_MOUSE      AESGKPLKEAQGEILYSALFLEWFSEEARRIYGDIIYTSAKKRGLVLKQPVGVAAIITPWNFPSAMITRK
BETB_PSEMY      LDTGKPLSETRVDIVTGADVLEYYAGLIPAIEGEQIPLRESSFVYTRREPLGVVAGIGAWNYPIQIALWK
SSDH_ARATH      LEQGKPLKEAIGEVAYGASFIEYYAEEAKRVYGDIIPPNSDRRLLVLKQPVGVVGAITPWNFPLAMITRK
BETB_RHOS5      LDTGKPLQETLADWPSGADALEFFAGLAPA-VTGETVPLGQDFVYTIREPLGLCVGIGAWNYPSQIACWK
BETB_VIBPA      ADTGKPIQEAIADITTGADVIEYYAGLAPSLQGEQQPLNENQFFYTRREPLGICAGIGAWNYPIQIAMWK
BETB_ACIAD      LDTGKAFSESTVDIVTGADVLEYYAGLATAIQGEQVPLRESSFFYTRREPLGVVAGIGAWNYPIQIALWK
BADH_GADCA      INNGKTITEAEYDID-AAWQCEYYAGLAPTLSGQHIQLPGGAFAYTRREPLGVCAGILAWNYPFMIAAWK
BETB_VIBSL      VDTGKPLQEAEVDVASGADVIEYFAGLAPTLQGDQQPLSDTQFFYTRREPLGICAGIGAWNYPIQIAMWK
BETB_ECO45      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
AL1A3_HUMAN     MDTGKFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWK
BETB_KLEP3      LDTGKPLSEAAVDIVTGADVLEYYAGLIPALEGSQIPLRDSSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_VIBHB      ADTGKPIQEANCDIATGADVIEYYAGLAPSMHGEQQPLNESQFFYTRREPLGICAGIGAWNYPIQIAMWK
BETB_ECO27      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGCQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
AL1A3_RAT       MDTGKFLHAFFVDLEGCIKTFRYFAGWADKIQGRTIPTDDNVMCFTRHEPIGVCGAITPWNFPLLMLAWK
BETB_ECOL6      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_AGRRK      LDTGKPIQETIADPTSGADSFEFFGGIAAAGLNGSYIPLGGDFAYTKRVPLGVCVGIGAWNYPQQIACWK
BETB_ECOHS      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_SHIF8      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECOLU      LDTGKAYSESTVDIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECO24      LDTGKAYSESTVDIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
SSDH_HYLLA      AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIYTAKDRRALVLKQPIGVAAVITPWNFPSAMITRK
SSDH_HUMAN      AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGD-IIHTPARRALVLKQPIGVAAVITPWNFPSAMITRK
BETB_ECOLC      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECO8A      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETLFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECO7I      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRHEPLGVVAGIGAWNYPIQIALWK
BETB_ECO5E      LDTGKAYSESTVDIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECO57      LDTGKAYSESTVDIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECO55      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECOSE      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETLFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECOLI      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECODH      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
UGA2_YEAST      LENGKALGEAKGEIKYAASYFEWYAEEAPRLYGATIQPLNPHRVFTIRQPVGVCGIICPWNFPSAMITRK
SSDH_PANPA      AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIYTAKDRRALVLKQPIGVAAVITPWNFPSAMITRK
SSDH_GORGO      AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIYTAKDRRALVLKQPIGVAAVITPWNFPSAMITRK
BETB_BURP8      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGQQIPLRAESFVYTRREPLGVTAGIGAWNYPIQIACWK
BETB_RHILW      LDTGKPIQETIADPTSGADAFEFFGGVAPAGLNGSHIPLGQDFAYTKRVPLGVCVGIGAWNYPQQIACWK
SSDH_PANTR      AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIYTAKDRRALVLKQPXGVAAVITPWNFPSAMITRK
BETB_BURXL      RDTGKPIAETLADIATGADVIEYYAGLATAIEGQQIPLRPTSFVYTRREPLGVCAGIGAWNYPIQIACWK
ALDH4_YEAST     LDNGKAISSSRGDVDLVINYLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWK
SSDH_PONPY      AESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIYTAKDRRALVLKQPIGVAAVITPWNFPSAMITRK
BETB_ECOSM      LDTGKAYSESTVDIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_ECOL5      LDTGKAYSESTVDIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWK
ALDA_ECOLI      EEGGKIQQLAEVEVAFTADYIDYMAEWARRY-EGEIIQSDRPGENILLRALGVTTGILPWNFPFFLIARK
ALDH5_BACSU     EELGGTRLKAAFEI---GLVKNIIKEAAPIRMEGKILPSDGKENRLYRVPAGVVGVISPFNFPFFLSMKS
BETB_BURPP      RDTGKPIAETLADIVTGADVIEYYAGLATAIEGQQIPLRPTSFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_YERP3      ADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRGSAFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_PECCP      HDTGKPLSETRTDIVTGADVLEYYAGLIPMLEGQQIPLRDTSFAYTRREPLGVVAGIGAWNYPIQIALWK
AL1A1_HUMAN     MNGGKLYSNAYLDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWK
YF19_SCHPO      LDNGKSITLARGDVQAAADCFRYYGGWADKDYG-QTIETDIKRAYTRHEPIGVCGQIIPWNFPFLMCAWK
BETB_RHOS1      LDTGKPLQETLADWASGADALEFFAGLAPA-VTGETVPLGQDFVYTIREPLGLCVGIGAWNYPSQIACWK
AL1A1_HORSE     MNGGKLFSNAYLDLGGCLKTLRYCAGWADKIQGRTIPSDGNFFTYTRHEPVGVCGQILPWNFPLLMFLWK
BETB_YERPP      ADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRGSAFVYTRREPLGVVAGIGAWNYPLQIALWK
BETB_YERPN      ADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRGSAFVYTRREPLGVVAGIGAWNYPLQIALWK
BETB_YERPE      ADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRGSAFVYTRREPLGVVAGIGAWNYPLQIALWK
BETB_YERPB      ADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRGSAFVYTRREPLGVVAGIGAWNYPLQIALWK
BETB_YERPA      ADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRGSAFVYTRREPLGVVAGIGAWNYPLQIALWK
GABD_RHISN      AEMGKPLGEAKSEVQHAAAYLQWYAEEANRIYGETIAPSTDRRMLVIKQPIGVVGAITPWNFPASMVARK
BETB_RHOSK      LDTGKPLQETLADWASGADALEFFAGLAPA-VTGETVPLGQDFVYTIREPLGLCVGIGAWNYPSQIACWK
AL9A1_HUMAN     INNGKSIFEARLDID-ISWQCEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIASWK
BETB_RHOS4      LDTGKPLQETLADWASGADALEFFAGLAP-VVTGETVPLGQDFVYTIREPLGLCVGIGAWNYPSQIACWK
AL9A1_PONAB     INNGKSIFEARLDIN-ISWQCEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQITSWK
A9A1B_DANRE     INNGKSITEARLDVDSARLSIEYFAGQATTLSGQHVQLPGGSFAYTRREPFGVCVGIGAWNYPFQIAAWK
SSDH2_SCHPO     LENGKPLSQAEMEVTTCSGYLKWYAAEAVRTFGDVAPSSLQSQNFLISQPVGVSALITPWNFPAAMIARK
BETB_PSEPW      LDTGKSYSETRVDIVTGADVLEYYAGLVPAIEGEQIPLRESSFVYTRREPLGVTVGIGAWNYPIQIALWK
ALDH_AGABI      LDNGKTFLWAKSDLSLSISTIKHYAGWADKNFG-QVIETDEKKTYSRHEPIGVVGQIIPWNFPLLMLAWK
BETB_YERPS      ADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRGSAFVYTRREPLGVVAGIGAWNYPLQIALWK
AL1A3_MOUSE     MDTGKFLHAFFVDLEGCIKTFRYFAGWADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLAWK
AL1A2_HUMAN     LNGGKPFLQAYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWK
ALDH4_BACSU     LDNGKPINETNGDIPLAIEHMRYYAGWCTKITGQTIPVSGAYFNYTRHEPVGVVGQIIPWNFPLLMAMWK
AL1A2_RAT       LNGGKPFLQAYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
BETB_PSESM      LDTGKAISETRVDIVTGADVLEYYAGLVPAIEGEQIPLRDSSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_PSEPG      LDTGKSYSETRVDIVTGADVLEYYAGLVPAIEGEQIPLRESSFVYTRREPLGVTVGIGAWNYPIQIALWK
AL1A2_MOUSE     LNGGKPFLQAYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
BETB_ERWCT      HDTGKPLSETRTDIVTGADVLEYYAGLIPMLEGQQIPLRDTSFVYTRREPLGVVAGIGAWNYPIQIALWK
YLX7_SCHPO      MDSGKLVSNARGDVDGTIALLRYCAGWADKIYGQVIPTGPEKLAYAKRTPIGVCGQIVPWNYPLNMAGWK
BETB2_RHIME     RDTGKPISETLVADAASGADCLEYFGAIAATLSGDSIQFGEDWVYTRREPLGVCLGIGAWNYPIQIAAWK
BETB_PSEU2      LDTGKAISETRVDIVTGADVLEYYAGLVPAIEGEQIPLRDSSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_PSEPK      LDTGKSYSETRVDIVTGADVLEYYAGLVPAIEGEQIPLRESSFVYTRREPLGVTVGIGAWNYPIQIALWK
BETB_PSEP1      LDTGKSYSETRVDIVTGADVLEYYAGLVPAIEGEQIPLRESSFVYTRREPLGVTVGIGAWNYPIQIALWK
BETB_PSE14      LDTGKAISETRVDIVTGADVLEYYAGLVPAIEGEQIPLRDSSFVYTRREPLGVVAGIGAWNYPIQIALWK
BETB_PSEPF      LDTGKAFSETKVDIVTGADVLEYYAGLVPAIEGEQIPLRDTSFVYTRREPLGVVAGIGAWNYPIQIALWK
AL1B1_MOUSE     LDNGKPFQESYVDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWK
ALDH2_PONAB     LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
ALDH2_HUMAN     LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
AL9A1_BOVIN     INNGKSIFEARWDIDT-SWQCEYYAGLAGSMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIACWK
BETB_PSEU5      LDTGKPLSETRSDIITGADVLEYYAGLAPAIEGEQIPLRDSSFVYTRREPLGVVAGIGAWNYPIQIXXXX
AL1L2_MOUSE     LDSGAVYTLAKTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNYTKKEPLGACAIIIPWNYPLMMLAWK
PUUC_ECOLI      ----------RDDIPGAARAIRWYAEAIDKVYGEVATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWK
AL1A2_CHICK     LNSGKPFLQAYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWK
BETB_BURA4      RDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWK
BADH1_ARATH     LDCGKPLDEAVWDMDDVAGCFEFYADLAEGLDAKQKLPMESFKSYVLKQPLGVVGLITPWNYPLLMAVWK
BETB_PSEF5      LDTGKAFSETKVDIVTGADVLEYYAGLVPAIEGEQIPLRTTSFVYTRREPLGVVAGIGAWNYPIQIALWK
BADH_SCHPO      INCGKPTPYALFDIDSCADMFEYYAEVAETDNPTVKVPLPNNPGFCAFEPRGVIGVITPWNFPLKMALWK
BADH_AMAHP      MDCGKPLDEAARDIDDVAGCFEYYADQAEALDAKQALPMDTFKCHVLKQPIGVVGLISPWNYPLLMATWK
AL1A1_RABIT     LNAGKLFPNAYLDLGGCIKTLRYCAGWADKIQGRTMPMDGDFFCYTRHEPVGVCGQIIPWNFPLVMLIWK
BETB_STRMK      LDTGKALAETTVDIVTGADVVEYYAGLATAIEGIQLPLRESSFFYTRREPLGVVAGIGAWNYPIQIAMWK
BETB_PSEE4      LDTGKSYSETRVDIVTGADVLEYYAGLVPAIEGEQIPLRESSFVYTRREPLGVTVGIGAWNYPIQIALWK
AL2B7_ARATH     WDNGKPYEQAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPLLMLSWK
AL1A1_MACFA     MNGGKLYSNAYLDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWK
BETB_STRM5      LDTGKALAETTVDIVTGADVVEYYAGLATAIEGIQLPLRESSFFYTRREPLGVVAGIGAWNYPIQIAMWK
GABD_BACSU      KENGKPYQEAVGEVLYGAGYIEWFAEEAKRVYGRTVAPTTGKRIVVTRQPVGPVAAITPWNFPNAMITRK
BETB_BURCM      RDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWK
BADH_SPIOL      IDSGKPFDEAVLDIDDVASCFEYFAGQAEALKAPVTLPMERFKSHVLRQPLGVVGLISPWNYPLLMATWK
AL8A1_DANRE     KDQGKTITFARVDIPRSAYNFRFFASSVLHHTNDSQMDHMGCLNYTIRCPVGVAGLISPWNLPLYLLTWK
AL1L2_HUMAN     LDSGAVYTLAKTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNFTKKEPLGVCAIIIPWNYPLMMLAWK
BETB_MARMS      LDTGKPLQEAIVDIQTGADVIEYYAGLTDKIQGDYQDLGNGNFFYTRREPLGICAGIGAWNYPIQIAMWK
BADH_ATRHO      LDSGKPRDEAVLDIDDVATCFEYFEYFAAKQKAPVTLPMERFKSHVLRQPIGVVGLISPWNYPLLMDTWK
ALDH_CLAHE      LDNGKAISMAKGDISMCVGCLRYYGGWADKITGKVIDTTPDTFNYVKKEPIGVCGQIIPWNFPLLMWAWK
AL1A1_SHEEP     MNGGKLFSNAYLDLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWK
BETB_SERP5      LDTGKAMSETTADIVTGADVLEYYAGLIPSIEGQQIPLRDTSFVYTRREPLGVVAGIGAWNYPIQIALWK
AL1A1_MOUSE     LNGGKVFANAYSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWK
FTHFD_XENTR     IDSGAVYTLAKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNFTRREPIGVCGIVIPWNYPLMMLAWK
AL1A1_BOVIN     MNGGKLFSNAYLDLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWK
ALDH_BACST      REMGKTLAEAKAETMRGVHILRYYAGEGARKIGDVIPSSDSEGLFTTRVPLGVVGVISPWNFPVAIPIWK
ALDH1_MACPR     INAGKIFASAYLDLDYCIKVLRYCAGWADKIQGRTIPVDGEFFSYTRHEPIGVCGQIFPWNAPMILLACK
ALDH2_MESAU     LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
AL8A1_HUMAN     KDQGKTLALARTDIPRSVQNFRFFASSSLHHTSETQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWK
AL1A2_TAEGU     LNSGKPFLQAYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWK
ALDH1_ELEED     INAGKVFASAYLDLDYCIKALRYCAGWADKIQGRTIPVDGEFFSYTRHEPIGVCGLIFPWNAPMILLACK
BADH_BETVU      IDSGKPFDEAVLDIDDVATCFEYFAGQAEAMDAKQTLPMERFKSHVLRQPIGVVGLITPWNYPLLMATWK
ALDH2_RAT       LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
AL1A1_RAT       INGGKVLGGSIKALKYCAWADKIHGQTIP---SDGDIFTFTRR-----EPIGVCGQIIPWNFPLLMFIWK
FEAB_ECOLI      LEQGKSIAISRAFEVGCTLNWMRYTAGLTTKIAGKTLDQGARQAWTRKEPVGVVAGIVPWNFPLWKVM--
BETB_BRUMB      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
ALDH2_MOUSE     LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK
AL1A7_MOUSE     MNAGKVFAHAYLDVEISIKALQYFAGWADKIHGQTIPSDGNIFTYTRREPIGVCGQIIPWNGPLIIFTWK
ABDH_ERWCT      LNCGKPYHAVNDEVPAVADVFRFFAG-AARCLSGSAAGEEGHTSMIRRDPVGVVASIAPWNYPLMMASWK
BETB_BRUO2      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
BETB_BRUME      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
BETB_BRUAB      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
BETB_BRUA2      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
BETB_BRUA1      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
ALDH2_BOVIN     LDNGKYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWK
ALDH6_YEAST     LDNGKTLALARGDVTIAINCLRDAAAYADKVNGRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLAWK
ABDH_PECCP      LNCGKPYHAANDEVPAVADVFRFFAG-AARCLSGSAAGEEGHTSMIRRDPVGVVASIAPWNYPLMMASWK
AL9A1_ORYLA     INNGKSITEALVDID-VAWQCEYYAGVAGTLAGQHFQLPGGAFAYTRREPLGVCVGIGAWNYPFQIAACK
DMPC_PSEUF      LDTGKPKSLAHIDIPRGAANFKVFADLLKN-VATEAFEGSGAINYAVRRPKGVIGVISPWNLPLLLMTWK
AL1B1_PONAB     LDNGKPFQESYADLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPIGVCGQIIPWNFPLVMQGWK
FTHFD_MOUSE     LDAGAVYTLAKTHVGMSIQTFRYFAGWCDKIQGATIPINQARPNLTKKEPVGVCGIVIPWNYPLMMLSWK
BETB_BRUSU      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
BETB_BRUSI      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
BETB_BRUC2      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
AL2B4_ARATH     WDNGKPYQQSTAEIPMFARLFRYYAGWADKIHGLTIPADGNYQVHTLHEPIGVAGQIIPWNFPLLMFAWK
AL1B1_HUMAN     LDNGKPFQESYADLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWK
ALDH_ALTAL      LDNGKAFSMAKVDVPAAAGCLRYYGGWADKIEGKVVDTAPDSFNYIRKEPIGVCGQIIPWNFPILMWSWK
BETB_OCHA4      LDTGKALQETLVXXXXXXXXXLEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWK
BETB_BACSU      ---GKTLEESKADMDDIANVFQYYAGLADKDGGXXXXXXXXXXXXXXXEPIGVCGQITPWNYPLLQASWK
BETB_XANC5      LNTGKPLSETRSDVVTGADVLEYYXXXXXXXXXXXXPLREGSFFYTRHEPLGVVGAIGAWNYPIQIXXXX
A9A1A_DANRE     ANNGKSITEAEVDID-VAWQCEYYAGIAPTLSGQHIQLPGGSFAYTRREPLGVCVGIGAWNYPFQIAAWK
BETB_CHRSD      RNTGKPISEASVDIVTGADALEYYAGLAPAIEGSQIPLRDTRLVYTRREPLGVIGAIGAWNYPIQIACWK
BETB_VIBVU      RDTGKPIQEASVDIATGADVIEYFAGLVNGLGGEQQSLGSNQFFYTRREPLGICAGIGAWNYPIQIAMWK
BETB_BURS3      RDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWK
ALDH_ASPNG      LDNGKSITMAHGDIAGAAGCLRYYGGWADKIHGQTIDTNSETLNYTRHEPIGVCGQIIPWNFPLLMWAWK
BETB_BURCH      RDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_BURCA      RDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWK
ALDA_STAAW      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
ALDA_STAAN      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
ALDA_STAAM      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
BETB_VIBVY      RDTGKPIQEASVDIATGADVIEYFAGLVNGLGGEQQSLGSNQFFYTRREPLGICAGIGAWNYPIQIAMWK
ALDA_STAAR      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
ALDA_STAAB      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
AL1B1_RAT       LDNGKPFQESYVDLDEVIKVYRYLAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWK
HPCC_ECOLX      ADTGLPIHQTKVLIPRASHNFEFFAEVCQQMNGKTYPVDDKMLNYTLVQPVGVCALVSPWNVPFMTATWK
FTHFD_PONAB     LDAGAVYTLAKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNLTRKEPVGVCGIIIPWNYPLMMLSWK
BETB_BURP1      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_BURP0      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_BURMS      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_BURMA      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_BURM9      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_BURM7      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWK
ALDH2_PIG       LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTLPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWK
ALDA_STAAS      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
BETB_BURPS      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_BURP6      RDTGKPIAETRADIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWK
ALDA_STAAC      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
ALDA_STAA8      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
ALDA_STAA3      LNNGKPIRETTAI--DIPFAARHFHYFASVIETEEGTVNDIDKSIVRHEPIGVVGAVVAWNFPMLLXXXX
BETB_BURCC      RDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWK
FTHFD_RAT       LDRGAVYTLAKTHVGMSIQTFRYFAGWCDKIQGATIPINQARPNLTKKEPVGVCGIVIPWNYPLMMLSWK
BETB_BURM1      RDTGKPIAETLADIVTGADVIEYYAGLATAIEGLQVPLRADSFVYTRREPLGVCAGIGAWNYPIQIACWK
BETB_XANCB      LNTGKPLSETRSDIVTGADVLEYYAGVAQALQGVQVPLREGSFFYTRHEPLGVVGAIGAWNYPIQIXXXX
BETB_XANC8      LNTGKPLSETRSDIVTGADVLEYYAGVAQALQGVQVPLREGSFFYTRHEPLGVVGAIGAWNYPIQIXXXX
BETB_BURCJ      RDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWK
FTHFD_HUMAN     LDAGAVYTLAKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNLTRKEPVGVCGIIIPWNYPLMMLSWK
BETB_XANCP      LNTGKPLSETRSDIVTGADVLEYYAGVAQALQGVQVPLREGSFFYTRHEPLGVVGAIGAWNYPIQIXXXX
BETB_XANAC      LNTGKPLSETRSDVVTGADVLEYYXXXXXXXXXXXXPLREGSFFYTRHEPLGVVGAIGAWNYPIQIXXXX
BADH_ORYSJ      LDSGKPLDEAAGDMEDVAACFEYYKQRAPISLPMENFES-----YVLKEPIGVVGLITPWNYPLLMATWK
FTHFD_XENLA     IDSGAVYTLAKTHVGMSIQTFRYFAGWCDKIQGRTIPINQARPNFTRREPIGVCGIVIPWNYPLMMLAWK
BADH2_ARATH     IDCGKPLDEAAWDMDDVAGCFEYYADLAEGLDAKQKLPMDTFKGYILKEPIGVVGMITPWNYPLLMAVWK
ALDH_EMENI      LDNGKAFTMAKVDLANSIGCLRYYAGWADKIHGQTIDTNPETLTYTRHEPVGVCGQIIPWNFPLLMWSWK
ALDH2_HORSE     LDNGKYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAAK
ALD1_STAHJ      DELGAPL--TLSENVHYQMGLNHFEE-ASRALDSFEFEERRGDALVTKEAIGVSGLVTPWNFPTNQTSLK
LADH_META3      IDVGKPIKQSIIEVDRTITTFKFSAFYS-RELRGETIPFDDGMVITKREPVGLVGAITPFNFPLNLFAHK
SSDH1_SCHPO     LENGKALGDAKGEVVYAAKFIDWFAGEALRISGDSSMSSNPQNRIITIQPVGVVGIITPWNFPAAMITRK
BETB_RHILO      LDTGKAIQETLVADAPSAADCLEYFGGAVAAYNGEAVDLGGPFAYTRREALGVCVGIGAWNYPIQIAGWK
BETB_BURVG      RDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWK
AL1A1_CHICK     IDGGKLFSTAYLDLGACIKTIRYCAGWADKIHGRTVPMDGNFFTFTRHEPVGVCGQIIPWNFPLVMFIWK
ALDH_ENCBU      LDNGKPFAMSYGDTLMAQKVLRYYAGFADKIVGQTIPADGNVFCYTRHEPVGVVGAITPWNFPLHLXXXX
AL1A7_RAT       MNAGKIFTHAYLDTEVSIKALKYFAGWADKIHGQTIPSDGDVFTYTRREPIGVCGQIIPWNGPLILFIWK
ALDH5_YEAS7     MDNGKSLFCARGDVALVSKYLRSCGGWADKIYGNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWK
LADH_METVS      VDVGKPIKQSRIEVDRTITAFRLSALYAKE-LRGETIPSENEIIFTKKEPVGVVGAITPFNFPLNLITHK
ALDH5_YEAST     MDNGKSLFCARGDVALVSKYLRSCGGWADKIYGNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWK
XYLC_PSEPU      RECGAIRPKGLWEAG-----IAYEQMHQAAGLASTLFPSPGRMNLCQRVPVGVVGVIAPWNFPLFLAMRS
GABD2_MYCS2     AETGKARSAAQEEIVDMMLNARYYARQAVKLLAPKRVQGGVVKTVVNHHPKGVVGVISPWNYPMALSISD
AL8A1_BOVIN     KDQGKTITLARTDIPRAV--------HNFRFFASSILHHTSECTYTVRAPVGIAALISPWNLPLYLLTWK
Y4UC_RHISN      REAGKTIVQARKEVLRCVNTLKLSAEEAKRN-AGEIVPFDARQGWFTRDPLGIITAITPYNDPLNLVAHK
ABDH_CITK8      QNCGKPLHCANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPVGVVASIAPWNYXXXXXXXX
ALDH3_YEAST     LDAGKPFSNAKQDLAQIIELTRYYAGAVDKFNMGETIPLTFNKAYTLKVPFGVVAQIVPWNYPLAMACRK
AL221_ARATH     RDTGKTLGEIMTTCEKITWLLSEGE----RWLKPESRSSGRKVSRVEFHPLGVIGAIVPWNYPFHNIFNP
ABDH_SALPA      QNCGKPLHVINDEIPAIVDVFRFFAGAASGLAAGEYLEGHT--SMIRRDPIGVVASIAPWNYXXXXXXXX
IOLA1_GEOTN     LENGKSYNEAYGEIQR-GIECVEFAAGAPTLMMGRQLPSIATESGMYRYPIGVVGGITPFNFPMMVPCWM
GABD2_MYCUA     AEAGKARWAAQEEVVDLVANANYYARVSAGLLKPRTVQAGIGKTTVGYQPKGVVGVISPWNYPMTLTASD
ALDH2_YEAST     LDAGKPYSNAKGDLAQILQLTRYFAGSADKFDKGATIPLTFNKAYTLKVPFGVVAQIVPWNYPLAMACWK
GABD2_MYCTU     AEAGKARWAAQEEIVDLIANANYYARVCVDLLKPRKAQPGIGKTTVCYQPKGVVGVISPWNYPMTLTVSD
GABD2_MYCTA     AEAGKARWAAQEEIVDLIANANYYARVCVDLLKPRKAQPGIGKTTVCYQPKGVVGVISPWNYPMTLTVSD
GABD2_MYCBP     AEAGKARWAAQEEIVDLIANANYYARVCVDLLKPRKAQPGIGKTTVCYQPKGVVGVISPWNYPMTLTVSD
GABD2_MYCBO     AEAGKARWAAQEEIVDLIANANYYARVCVDLLKPRKAQPGIGKTTVCYQPKGVVGVISPWNYPMTLTVSD
AL8A1_MOUSE     KDQGKTLTLARTDIPRSVLNFRFFASSNLHHVSECTQMSHLGMHYTVRTPVGIAGLISPWNLPLYLLTWK
ABDH_SALAR      QNCGKPLHVINDEIPAIIDVFRFFAGAARGLAAGEYLEGYT--SMIRRDPVGVVASIAPWNYXXXXXXXX
NAHF_PSEU8      MEVGASALWAGFNVHASANVFREAASLATQIQGETIPTDKAETLSMTLQPVGPILSIVPWNGTAVLAARA
NAHF_PSEPU      MEVGASALWAGFNVHASANVFREAASLATQIQGETIPTDKAETLSMTLQPVGPILSIVPWNGTAVLAARA
AMNC_PSESP      ADTGKPLSMA-ATIDIPRGIANF--RNFADILATAPVDSHRALNYAARKPLGVVGVISPWNLPLLLLTWK
ABDH_SHISS      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
IOLA2_GEOKA     LENGKSYNEAYGEVQR-GIECVEFAAGAPTLMMGRQLPDIATESGMYRYPIGVVGGITPFNFPMMVPCWM
ABDH_ESCF3      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOUT      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOSE      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOL6      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOL5      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOK1      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECO8A      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECO81      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECO45      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECO24      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_SHIFL      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_SHIF8      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOLC      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOHS      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECO55      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_SALTY      QNCGKPLHVINDEIPAIVDVFRFFAGAASGLAAGEYLEGHT--SMIRRDPIGVVASIAPWNYXXXXXXXX
ABDH_ECOLI      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECODH      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOBW      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ASTD_PSEF5      EETGKPLWEAATEVNKIAISVQSYRERT----GEKSGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGH
ABDH_ECOSM      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECOLU      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECO27      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ALDY_BACSU      RETGGTIIKSTIELEQTIAILDEAMTYTGELGGVKEVPSDGKTNKIYRLPLGVISSISPFNFPMNLSMRS
ALD1_STAES      DELGAPLSVS----ENVHYQMGLNHFTAARDALDSFFEEQRGDDLVVKEAIGVAGLVTPWNFPTNQTSLK
ALD1_STAEQ      DELGAPLSVS----ENVHYQMGLNHFTAARDALDSFFEEQRGDDLVVKEAIGVAGLVTPWNFPTNQTSLK
ROCA_GEOSW      KEAGKPWKEADADTAEAIDFMEYYARQMLKLKDGVPVESETNRFFYI--PLGVGVVISPWNFPFAIMAGT
GAPN_WHEAT      KEIAKPAKDAVSEVVRSGDLVSYTAEEGVRILGEKLLVSDSRNKYCLSSPLGVVLAIPPFNYPVNLAVSK
GAPN_NICPL      KEIAKPAKDAVTEVVRSGDLVSYTAEEGVRFLVSDSFPGNERTKYCLTSPLGVILAIPPFNYPVNLAVSK
BADH_HORVU      VDSGKPKXXXXXXXXXXXXCFEYYKQHAPISLPMEEF-----KTYVLKEPIGVVGLITPWNYPLLMATWK
ABDH_ECO5E      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ABDH_ECO57      RNCGKPLHSANDEIPAIVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ALDH1_BACSU     REMGKTLPEAKGETARGIAILRYYAGEGMRKTGDVIPSTDKDAMFTTRVPLGVVGVISPWNFPVAIPIWK
IOLA1_GEOKA     QENGKAYKEAYGEIQR-GIECVEFAAGAPTLLMGESLSNIAEESEMFRYPLGVVAGITPFNFPMMVPLWM
ABDH_SALCH      QNCGKPLHVINDEIPAIVDVFRFFAGAASGLAAGEYLEGHT--SMIRRDPIGVVASIAPWNYXXXXXXXX
ROCA_GEOKA      KEAGKPWREADADTAEAIDFMEYYGRQMLKLKDGIPVESETNRFFYI--PLGVGVVISPWNFPFAIMAGT
ABDH_SHIDS      RNCGKPLHSANDEIPAIVDVFRFFAGAARCLNGLAVGEYEGHTSMIRRDPLGVVASIAPWNYXXXXXXXX
ROCA_GEOTN      KEAGKPWREADADTAEAIDFMEYYGRQMLKLKDGIPVESETNRFFYI--PLGVGVVISPWNFPFAIMAGT
IOLA_LISMC      LENGKNLSEARGEVQRGIENVEF-AAGAPTLMMGDSLASIATDVEAARYPVGVVGGIAPFNFPMMVPCWM
IOLA_LISIN      LENGKNLSEARGEVQRGIENVEF-AAGAPTLMMGDSLASIATDVEAARYPVGVVGGIAPFNFPMMVPCWM
IOLA_LISMH      LENGKNLSEARGEVQRGIENVEF-AAGAPTLMMGDSLASIATDVEAARYPVGVVGGIAPFNFPMMVPCWM
IOLA_BACA2      LENGKNTTEALGEVGRGIENVEF-AAGAPSLMMGDSLASIATDVEAARYPIGVVGGIAPFNFPMMVPCWM
IOLA1_BACSK     IENGKNLTEARGEVQRGIENVEFAAGAPSLMMGDSLIATDVEASNYRY-PIGVVGGIAPFNFPMMVPCWM
ABDH_SALPC      QNCGKPLHVINDEIPAIVDVFRFFAGAASGLAAGEYLEGHT--SMIRRDPIGVVASIAPWNYXXXXXXXX
ABDH_SALPB      QNCGKPLHVINDEIPAIVDVFRFFAGAASGLAAGEYLEGHT--SMIRRDPIGVVASIAPWNYXXXXXXXX
ROCA_BACCN      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ABDH_SALTI      QNCGKPLHVINDEIPAIVDVFRFFAGAASGLAAGEYLEGHT--SMIRRDPIGVVASIAPWNYXXXXXXXX
IOLA_LISMF      LENGKNLSEARGEVQRGIENVEF-AAGAPTLMMGDSLASIATDVEAARYPVGVVGGIAPFNFPMMVPCWM
GAPN_STRMU      KEVAKGYKSAVSEVVRTAEIINYAAEEGLR-MEGEVLESKKKIAVVRREPVGLVLAISPFNYPVNLAGSK
IOLA_LISMO      LENGKNLSEARGEVQRGIENVEF-AAGAPTLMMGDSLASIATDVEAARYPVGVVGGIAPFNFPMMVPCWM
IOLA_BACNA      IENGKNTKEALGEVGRGIENVEF-AAGAPSLMMGDSLASIATDVEAARYPIGVVGGIAPFNFPMMVPCWM
ASTD_MARAV      LETGKPLWESRTEVAKIPISVKAYNERTGH------TESDVAGGHAVLRPHGVVAVFGPYNFPGHLPNGH
ALD1_STAS1      DELGAPLSVA--ENVHYQMGLDHFEA-ARDALNDFQFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLK
LADH_METMP      IDVGKPIKQSKIEVDRTLTALKLSAFYAKE-LRGETINSENGLIFTKKEPLGVIGAITPFNFPLNLATHK
LADH_METJA      XDAGKPIKQARVEVERSIGTFKYVKEHR-----DEVIPSDDRLIFTRREPVGIVGAITPFNFPLNLSAHK
IOLA3_GEOKA     LENGKVYEDAYGEVQR-GIECVEFAAGIPTLMMGQQLPDIATESGMYRYPLGVVAGITPFNFPMMVPCWM
ALDHY_YEAST     LDNGKPFDEAASVLKELRYTAGWADKHGTRFAITIPTFQDLRLRYTRHEPVGVCGEIIPWNIPLLMYIWK
IOLA_BACSU      IENGKNTKEALGEVGRGIENVEF-AAGAPSLMMGDSLASIATDVEAARYPIGVVGGIAPFNFPMMVPCWM
LADH_METM5      IDVGKPIKQSKIEVDRTLTALKLSAFYAKE-LRGETINSENGLIFTKKEPLGVVGAITPFNFPLNLITHK
IOLA_BACCN      LENGKTLKDASGEVQRGIEAVELATS-APNLMMGQALPNIAGGGSIWRYPLGVVAGITPFNFPMMIPLWM
ALD1_STAAW      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
ALD1_STAAS      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
ROCA_ANOFW      KEAGKPWKEADADTAEAIDFMEYYARQMLKLKDGIPVESETNRFFYI--PLGVGVVISPWNFPFAIMAGT
ALD1_STAAR      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
ALD1_STAAN      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
ALD1_STAAM      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
ALD1_STAAC      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
ALD1_STAA8      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
ALD1_STAA3      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
ASTD_PSE14      EETGKPLWESATEVNKIAISVQSYRERT----GEKSGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGH
AL1B1_BOVIN     LDNGKPFQESYVDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCCQIIPWNFPLVMQSWK
ALDH2_LEITA     LDNGKPYEVALNVDVALSVECFRYCAG----LADKVNGTVPPRSIVKRQPIGVCGQIIPWNFPLLMAAFK
IOLA1_BACHK     LENGKTLTDATGEVQRGIEAVELATS-APNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA1_BACAN     LENGKTLTDATGEVQRGIEAVELATS-APNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
GAPN_APIGR      KEIAKPAKDSVTEVVRSGDLVSYCAEEGVRFLVSDSFPGNERTKYCLTSPLGVILAIPPFNYPVNLAVSK
CROM_ENTDO      LNTGKPYKSAYQDIVHCIQVLRYYAGWADKNMGQNIPVDGDFFSFTKHEPVGICGLIIPWNYPMLMMTWK
ALD1_STAAB      DELGAPLSLSERV---------HYQMGLNHFVAADNYEFEERRGLVVKEAIGVSGLITPWNFPTNQTSLK
GAPN_MAIZE      KEIAKPAKDAVSEVVRSGDLVSYTAEEGVRILGEKLVVSDSRNKYCLSSPLGVVLAIPPFNYPANLAGSK
IOLA_BACC2      LENGKTLTDATGEVQRGIEAVELATS-APNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA1_OCEIH     LENGKSLRDAQGEVQRGIEVVELATS-TPSMMMGDALPSIAKGGSIWRYPLGVVAGITPFNFPMMVPLWM
LADH_METM7      IDVGKPIKQSKIEVDRTLTAFRLSAFYAKE-LRGETINSENGLIFTKKEPLGVVGAITPFNFPLNLITHK
AL2C4_ARATH     VDGGKLFQLGKADIPATAGHFRYNAGAADKIHGETLMTRQSLFGYTLKEPIGVVGNIIPWNFPSIMFATK
IOLA_BACCR      LENGKTLTDATGEVQRGIEAVELATS-TPNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA_BACC1      LENGKTLTDATGEVQRGIEAVELATS-TPNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA1_BACCZ     LENGKTLTDATGEVQRGIEAVELATS-TPNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA1_BACAH     LENGKTLTDATGEVQRGIEAVELATS-TPNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA2_GEOTN     LENGKVYEDAYGEVQR-GIECVEFAAGIPTLMMGQQLPDIATESGMYRYPLGVVAGITPFNFPMMVPCWM
ASTD1_SHEDO     LETGKALWESRTEVAMTGKIAISIKANAERTGTVENPMPGA-KAFIRHKPHGVVAVFGPYNFPGHLPNGH
IOLA_BACC4      LENGKTLTDATGEVQRGIEAVELATS-TPNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA1_BACWK     LENGKTLTDATGEVQRGIEAVELATS-APNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA_BACCQ      LENGKTLTDATGEVQRGIEAVELATS-TPNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA_BACC7      LENGKTLTDATGEVQRGIEAVELATS-TPNLMMGQALPNIASGGSIWRYPIGVVAGITPFNFPMMIPLWM
IOLA2_BACSK     LENGKTIKDARGEVQRGIECVELATSTPTMMMGDALPDASGIDGSIWRYPLGVVAGITPFNFPMMVPLWM
ALDH_PSESP      HEQGKPLADARGELAGAIAFCQC----AGSLPLPEVVQSATRLSKTVREPLGVVVAIVPWNYPVSIAFRR
ROCA_BACC1      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACLD      KEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSEGERNQYVYTPTGVTVVIPPWNFLFAIMAGT
ROCA_OCEIH      YDAGKPWDQADGDTAEGIDFLEYYARHMVELLADRPNE-DNKYFY---QPLGPGVVIPPWNFAFAIVCGT
ROCA_BACWK      KEAGKPWNEADADTAEAIDFMEYYARQMLKLKDGMPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
GAPN_PEA        KEIAKPAKDAVTEVVRSGDLVSYCAEEGVRFLVSDSFPGNERTKYCLTSPLGVILAIPPFNYPVNLAVSK
ROCA_BACHK      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACCZ      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACCQ      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACC7      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACC3      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACC0      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACAN      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACAH      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACAC      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACAA      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ALDH_STRCO      WENGKPVRETLAADIPLAIDHFRYFAGAVRAQEGSLGEDDDTVAYHFHEPLGVVAQIIPWNFPILMATWK
ROCA2_BACSU     KEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSEGEKNQYVYTPTGVTVVIPPWNFLFAIMAGT
IOLA2_BACLD     IENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLIATDVEAANYRY-PIGVVGGIAPFNFPMMVPCWM
ABDH_SERP5      INCGKVLND---ELPGVADVFRFFAG-ASRCLAGEYLAGHT--SMIRRDPLGVVASIAPWNYXXXXXXXX
ROCA_BACCR      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACC4      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
ROCA_BACC2      KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPRFSYI---PLGVGVIISPWNFPFAIMAGM
IOLA3_BACCZ     IENGKSYNEAYGEVLR-GIECVEFAAGAPTLMMGKQLPDIATESGMYRYPIGVIGGITPFNFPMMVPCWM
ALDA_STAES      LQNGKPYRETSTDVPQAANQFKYF---ASVLTTDEVNEIDQNTSLVVNEPXXXXXXXXXWNFPILLASWK
ALDA_STAEQ      LQNGKPYRETSTDVPQAANQFKYF---ASVLTTDEVNEIDQNTSLVVNEPXXXXXXXXXWNFPILLASWK
MMSA_PSEAE      SELGKTFEDAKGDVWRGIEVVEH-ACNVPSLLMGETVENVARNTYSITQPLGVCVGITPFNFPAMIPLWM
YOSF_SCHPO      KDTGKTLGEILVTLEKINWTLANGEQSLRPTKRPNSLLTSYKGGYVKYEPLGVIAALVSWNYPLHNALGP
ASTD_SPHAL      RETGKPLWEARTEVESVANKVDIYAERTPNRRIEGAM---GLRSAVRHKPHGALAVLGPYNFPAHLPNGH
ROCA_STAS1      YEAGKPWDEAVGDAAEGIDFIEYYARSMME-LADPVLDREGEHNKYFYKPIGTGVTIPPWNFPFAIMAGT
ASTD_LEGPH      LETGKPLWESQTEVSSVIGIQAYQERTWPK--QTETAEANA---CLRFKPHGIVVVLGAFNFPAHLSNGH
ASTD_LEGPC      LETGKPLWESQTEVSSVIGIQAYQERTWPK--QTETAEANA---CLRFKPHGIVVVLGAFNFPAHLSNGH
THCA_RHOER      WDNGKPIRETNADIPLAI---DHFRYFAGAIRAQEGSLSEINSDTVAYEPLGVVGQIIPWNFPILMAVWK
IOLA2_BACHK     IENGKSYNEAYGEVLR-GIECVEFAAGAPTLMMGKQLPDIATESGMYRYPIGVIGGITPFNFPMMVPCWM
ASTD_PSEFS      EETGKPLWESVTEVNKIAISVQSYRERT----GEKSGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGH
ALDB_ECOLI      WDNGKPIRETSAADVPLA--IDHFRYFASCIRAQEISEVDSETAYHFHEPLGVVGQIIPWNFPLLMASWK
IOLA_BACHD      LENGKSYKEAYGEVQR-GIECVEFAAGAPSLMMGKQLPDIATNSGMYRYPIGVVGGITPFNFPMMVPCWM
IOLA2_BACAN     IENGKSYNEAYGEVLR-GIECVEFAAGAPTLMMGKQLPDIATESGMYRYPIGVIGGITPFNFPMMVPCWM
IOLA2_BACCZ     IENGKSYNEAYGEVLR-GIECVEFAAGAPTLMMGKQLPDIATESGMYRYPIGVIGGITPFNFPMMVPCWM
IOLA2_BACAH     IENGKSYNEAYGEVLR-GIECVEFAAGAPTLMMGKQLPDIATESGMYRYPIGVIGGITPFNFPMMVPCWM
CROM_OMMSL      MDTGKPYKNSYQDMVHCIQVLRYFAGWADKNMGESIPVDGDFFCYTRNEPVGVCGLLIPYNYPMLMMTWK
ROCA1_BACHD     HEAGKPWKEADADTAEAIDFLEYYARQMIELRGKEILSRPGEQNRYFYTPMGVTVTISPWNFALAIMVGT
XYLG_PSEPU      ARFGEFL-EARMPGHRQAEVAGQPHRHSARRVANEAFEGAGALNYGVRRPKGVIGVISPWNLPLLLMTWK
ALDA_STAHJ      LQNGKPYRETSTDVPLTANQFKYF---ASVLTTDEVNEIDENTSLVVNEPXXXXXXXXXWNFPILLASWK
DHA2_RALEH      IDNGKPVRETTAADLPLA--VDHFRYFAGCIRAQEISEIDADTAYHFHEPLGVVGQIIPWNFPLLMATWK
ASTD_LEGPL      LETGKPLWESQTEVSSVIGIQAYQERTWPK--QTETAEANA---CLRFKPHGVVVVLGAFNFPAHLSNGH
ALDH_RHORT      IDNGKPIRETLAADIPLA--IDHFRYFAACIRAQEGSLSQIDETTIAYEPLGVVGQIIPWNFPILMATWK
ALDH_MYCTU      WDNGKPVREALAADIPLA--VDHFRYFAAAIRAQEGALSQIDEDTVAYEPLGVVGQIIPWNFPIXXXXXX
ALDH_MYCBO      WDNGKPVREALAADIPLA--VDHFRYFAAAIRAQEGALSQIDEDTVAYEPLGVVGQIIPWNFPIXXXXXX
AL7B4_ARATH     LEMGKILAEGIGEVQEVIDMCDF-AVGLSRQLNGSVIPSE-RPNHMMLEPLGIVGVITAFNFPCAVLGWN
ASTD_PSEPF      EETGKPLWEAATEVNKIAISVQSYRERT----GEKSGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGH
AL7A1_PEA       LEMGKILAEGIGEVQEIIDMCDY-SVGLSRQLNGSIIPSERHMMFEVWNPLGIVGVITAFNFPCAVLGWN
IOLA_LACCA      EENGKSLDEAVAEVGRGIENVEFAAGVPTLMMGDSLVATDVEATNYRY-PIGVVGGITPFNFPMMVPCWM
ASTD_NOVAD      RETGKPLWEARTEVDSVVNKVEIYADRTSQRKLDSALQGTAALRH---KPHGVLAVLGPYNFPAHLPNGH
ASTD_PSESM      EETGKPLWESATEVNKIAISVQSYRERT----GEKSAPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGH
AL7A1_BRANA     LEMGKILAEGIGEVQEVIDMCDF-AVGLSRQLNGSVIPSE-RPNHMMLEPLGIVGVITAFNFPCAVLGWN
ASTD_PSEU2      EETGKPLWESATEVNKIAISVQSYRERT----GEKSGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_PSEPW      EETGKPLWESATEVNKVAISIQSYRERTGEKLADAT-------AVLRHKPHGVVAVFGPYNFPGHLPNGH
ALDH_VIBCH      WDNGKPIRETLAA--DLPLTIDHFRYFAACIRSQEASELDSRTTYHLPEPIGVVGQIIPWNFPXXXXXXX
ALDH_VIBC3      WDNGKPIRETLAA--DLPLTIDHFRYFAACIRSQEASELDSRTTYHLPEPIGVVGQIIPWNFPXXXXXXX
AL7A1_MOUSE     LEMGKILVEGIGEVQEYVDVCDY-AAGLSRMIGGPTLPSE-RPGHALIEPLGLVGIITAFNFPVAVFGWN
IOLA_BACP2      MENGKSITEAKGEVQR-GIECVEFAAGAPTLMMGKQLPDIASESGMYRYPIGVIGGITPFNFPMMVPCWM
IOLA2_BACWK     LENGKSYKEAYGEVQR-GIECVEFAAGAPTLMMGEQLPDIATESGMYRYPIGVIAGITPFNFPMMVPCWM
ASTD1_CAUCR     RETGKPMWEALTEADKVAISIRAQDERAGE-RSEPMADATAR---LAHRPHGVLAVIGPFNFPMHLANGH
ABDH_ENT38      QNCGKPLHCVISEIPAVVDVFRFFAGAARGLAAGEYLEGHT--SMIRRDPVGVVASIAPWNYXXXXXXXX
ROCA_BACP2      KEAGKPWNEADADTAEAIDFLEYYARQMLELAKGKPVNSEGEHNQYVYTPTGVTLVIPPWNFLFAIMAGT
ASTD_PSEMY      EETGKPLWEAATEVNKVAISIQSYRERTGEKLADAT-------AVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_LEGPA      LETGKPLWESQTEVSSVIGIQAYQERTWPK--QTETAEANA---CLRFKPHGVVVVLGAFNFPAHLSNGH
ASTD_IDILO      KETGKPVWETRTEVGKVAISERAYHERT------GTVENDGAKAFIRHKPHGVVAVYGPYNFPGHLPNGH
MMSA_DROME      KEQGKTLADAEGDVLRGLQVVEHCCS-IPSLQMGETVANVARDTYSLVLPLGVTAGVAPFNFPAMIPLWM
ASTD2_PSEHT     QETGKPLWETRTEVGKVAISVKAYNERT----GTTENPMPGAKAFIRHKPHGVVAIFGPYNFPGHLPNGH
ALDH_DEIRA      WDNGKPVRETLAADLPLA--IDHFRYFAGCIRAQEGGLSQIDDSTVAYEPLGVVGQIIPWNFPLLMGVWK
ASTD_PSEP1      EETGKPLWESATEINKVAISVQSYRERTGEKLADAT-------AVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD2_SHEDO     QETGKPQWETATEVGAMIGKIALSAAAHDKRTGTETNELAAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_CHRVO      QETGKPLWEATTEVTTMVGKIDISLKALAERTGERAAAMGDAQAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_PSEE4      EETGKPLWESATEVNKVAISVQSYRERTGEKLADAT-------AVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_PSEAE      EETGKPLWESATEVNKVAISVQAFRERTGEKLADAT-------AVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_ACIAD      QETSKPLWETLTEVQKVAISIRAYHQRTGKSITEMADGAASLRH----RPHGVMAVFGPYNFPGHLPNGH
AL7A1_MALDO     LEMGKILAEGIGEVQEVIYMCDF-AVGLSRQLNGSIIPSERHMMFEVWNPLGIVGVITAFNFPCAVLGWN
AL7A1_BOVIN     LEMGKILVEGVGEVQEYVDVCDY-AVGLSRMIGGPILPSE-RPGHALIEPVGLVGIITAFNFPVAVYGWN
GAPN_STREI      KEIAKGYKSAVGEVIRTAEIINYAAXXXXXXXXXXXXXSKKKIAIVRREPVGLVLAISPFNYPINLAGSK
GAPN_ARATH      KEIAKPAKDSVTEVVRSGDLISYCAEEGVRFLLSDSFPGNDRTKYCLTSPLGVVLAIPPFNYPVNLAVSK
ASTD_CHRSD      QETGKPLWEARTEIGKVAISITAYHERT----GERARDIGDARAVLRHRPHGVLAVYGPYNFPGHLPNGH
MMSA_DROPS      KEQGKTLADAEGDVLRGLQVVEHCCS-IPSLQMGETVANVARDTYSLVMPLGVTAGIAPFNFPAMIPLWM
IOLA2_OCEIH     LENGKNYAEAYGEVQRGIENVEF-ATGAPSLMMGEQLASIATESGVYRYPIGVIGGITPFNFPMMVPCWM
ASTD_BURM1      RETGKPLWEARTEVAKVGISIQAYQERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
AL7A1_HUMAN     LEMGKILVEGVGEVQEYVDICDY-AVGLSRMIGGPILPSE--RSGHALNPVGLVGIITAFNFPVAVYGWN
YHJ9_YEAST      RDSGKTMGEILVTLEKIQWTIKHGQQPSRRPGPTNFFMKWYKGAEIRYEPLGVISSIVSWNYPFHNLLGP
ASTD_KLEP7      AETGKAAGEVTAMINKVAISVKAYHVRTGEQHSDLPDGAATLRH----RPHGVLAVFGPYNFPGHLPNGH
MMSA_HUMAN      LEQGKTLADAEGDVFRGLQVVEHACS-VTSLMMGETMPSITKDMYSYRLPLGVCAGIAPFNFPAMIPLWM
MMSA_MOUSE      LEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMITKDMDL-YSYRLPLGVCAGIAPFNFPAMIPLWM
MMSA_BOVIN      LEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGDTMITKDMDL-YSYRLPLGVCAGIAPFNFPAMIPLWM
ASTD1_PSEHT     QETGKPLWETRTEAGAMVGKIAISEKAFLERTGDVENAMPLGRAMIRHKPHGVVAVFGPYNFPGHLPNGH
MMSA_AEDAE      KEQGKTLVDAEGDVLRGLQVVEHCCSITSLQMGETVIAKDMD-TYSYTLPLGVTAGICPFNFPAMIPLWM
ASTD_PHOLL      QETSKPLWETRTEIQKAAISIEAWEQ---RTGESETIMPDG-RALLRHRPHGVMAVFGPYNFPGHLPNGH
ALDH2_MACPR     ----------------------------------------------------------------------
ASTD_BURVG      RETGKPLWEARTEVAKVAISIQAYHERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_BURCH      RETGKPLWEARTEVAKVGISIQAYQERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_BURCA      RETGKPLWEARTEVAKVGISIQAYQERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_PHOPR      EETGKPLWETRTEVGKIAISLRAYHERT----GEKQKDIAGTAAVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_SHEB9      QETGKPQWETATEIGKIALSAAAYNKRT----GTEANDTPAGRAVIRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_SHEB5      QETGKPQWETATEIGKIALSAAAYNKRT----GTEANDTPAGRAVIRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_ENT38      RETGKPRWEATTEITAMAYHTRTGEQHTA--MADGAATLRHR-------PHGVLAVFGPYNFPGHLPNGH
ASTD_VIBSL      KETGKPIWETRTEAGKIAISIRAYHERT----GEASREAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_COLP3      LETGKTTGEAGAMVAKVAISLKAYNERTG------TVENPGAKAFIRHKPHGVVAIFGPYNFPGHLPNGH
ASTD_BURCJ      RETGKPLWEARTEVAKVGISIQAYQERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
MMSA_RAT        LEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMITKDMDL-YSYRLPLGVCAGIAPFNFPAMIPLWM
MMSA_DICDI      EEQGKTLPDAKGDVFRGLEVVEH-SVNVASLMMGETVENVSKNVYSYVQPLGVCAGITPFNFPAMIPLWM
ASTD_BURA4      RETGKPLWEARTEVAKVGISIQAYQERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_SALAR      RETGKPRWEAATEINKIAISIKAYHART----GEQTSELADGAATLRHRPHGVLAVFGPYNFPGHLPNGH
ROCA_BACSU      KEAGKPWKEADADTAEAIDFLEFYARQMLKLKEGAPVKSRAGENQYHYEALGVGIVISPFNFPLAIMAGT
MMSA_ANOGA      KEQGKTLIDAEGDVLRGLQVVEHCCSITSLQMGETVIAKDMD-TYSYHLPLGVTAGIAPFNFPAMIPLWM
ASTD_ECO5E      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECO57      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_BURCC      RETGKPLWEARTEVAKVGISIQAYQERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_BURCM      RETGKPLWEARTEVAKVGISIQAYQERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_SHESA      QETGKPQWETATEVAAMIGKIGLSATAYNKRTGTEANDTPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_AERS4      RETGKPLWETRTEVAKIAISIRAHDERTG------TVENPGAKAFVRHKPHGVVAVFGPYNFPGHLPNGH
AL3A1_RAT       SDLGK--NEWTSYYEEVAHVLEELDKELPDWAEDEPVAKTRQTQYIHSEPLGVVLVIGAWNYPFNLTIQP
ASTD_SHEON      QETGKPQWETATEVAAMIGKIGLSASAYNKRTGTETNDTPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_BURS3      RETGKPLWEARTEVAKVGISIQAYQERTRQDMADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ROCA_STAES      YEAGKPWDEAVGDAAEGIDFIEYYARSMME-LADPVLDREGEHNRYFYKPIGTGVTIPPWNFPFAIMAGT
ROCA_STAEQ      YEAGKPWDEAVGDAAEGIDFIEYYARSMME-LADPVLDREGEHNRYFYKPIGTGVTIPPWNFPFAIMAGT
ASTD_ECOHS      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_YERPS      LETSKTLTEVQAMIGKVAISLQAYQTHSQTPMGDSM-------SVLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_YERPB      LETSKTLTEVQAMIGKVAISLQAYQTHSQTPMGDSM-------SVLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECO8A      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECO55      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECO24      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_VIBHB      KETGKPIWETRTEAAKIAISIRAYHDRT----GEATREAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_SHIBS      RETGKLRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_HAHCH      KETSKPLWEARTEVAKVGISIQAFNERTG------VSEQDVAAGHAVLKPHGVLAVFGPYNFPGHLPNGH
ASTD_ECOL5      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ENTS8      LETSKPRWEAATEVTAMAYQTRTGEQHSP--MPDGAATLRHR-------PHGVLAVFGPYNFPGHLPNGH
ASTD_ECOUT      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECOLI      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECOLC      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECODH      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECOBW      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECO45      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ALDH2_BACSU     QDLHKSEQEAYSTLEEISFVMKRLRKWSKPKRVKTPLTHLGSKSIIIPEPYGTVLVIAPWNYPLQLALSP
MMSA_CAEEL      IEQGKTLPDAEGDVSRGLQVVEHACS-VPSLMMGETLPNVSRDTHSYRIPLGVTAGICPFNFPAMIPLWM
ASTD_YERPY      LETSKTLTEVQAMIGKVAISLQAYQTHSQTPMGDSM-------SVLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_YERPG      LETSKTLTEVQAMIGKVAISLQAYQTHSQTPMGDSM-------SVLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_YERPE      LETSKTLTEVQAMIGKVAISLQAYQTHSQTPMGDSM-------SVLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_YERPA      LETSKTLTEVQAMIGKVAISLQAYQTHSQTPMGDSM-------SVLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECO81      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
IOLA1_BACLD     TENGKTLKDARGEVQRGIEVVELATA-TPTLMMGESLPAIAGGGSIWRYPLGVVAGITPFNFPMMVPLWM
ASTD_YERPP      LETSKTLTEVQAMIGKVAISLQAYQTHSQTPMGDSM-------SVLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_SHIB3      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECOSE      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHCPHGVLAVFGPYNFPGHLPNGH
ASTD_VIBVU      KETGKPLWETRTEAAKIAISIRAYHERT----GESQKEAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_ECO27      RETGKPRWESATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
MMSA_ARATH      TEQGKTLKDSHGDIFRGLEVVEHACGMATLQMGEYLPNSNGVDTYSIREPLGVCAGICPFNFPAMIPLWM
AL7A1_CAEEL     LEMGKISAEGVGEVQEYVDICDY-ATGLSRSLEGKIFPSE-RPGHALLEPLGVVGVISAFNFPCAVYGWN
ROCA2_BACHD     KEAGKPWKEADADTAEAIDFLEYYARQMITLKDGKPVNSEGEHNRYFYTPIGVCVTISPWNFALAIMAGT
ASTD_PSEA6      QETGKPLWETATEVGAMMGKIGISERAYQERTGLVENPMPVGKAFIRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_VIBPA      KETGKPIWETRTEAAKIAISIRAYHDRT----GEATREAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_SHEPC      QETGKPQWETATEIGKIALSAAAYHKRT----GTEANDTPAGRAVIRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_ECOLU      RETGKPRWEAATEINKIAISIKAYHIRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_ECOL6      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_VIBVY      KETGKPLWETRTEAAKIAISIRAYHERT----GESQKEAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_AERHH      RETGKPLWETRTEVAKIAISIRAHDERTG------TVENPGAKAFVRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_SHIF8      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_SERP5      RETSKTLTEVQAMIGKVAISLQAYQV---RTGVSQTAMADGA-SVLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_SORC5      LETGKPRWEALTEVQTMIGKIDVSLMAWRERTGERQAEAGDATAVVRHRPHGVVAVLGPYNFPGHLPNGH
ASTD_SHIDS      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_SHIFL      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_VIBCM      KETGKPLWETRTEXXXXXXXXXXXXXXYHERTGETVREAAGNQLVLRHRPLGVMAVFGPYNFPGHLPNGH
AL3A1_MOUSE     SNLRK--NEWTSYYEEVAHVLDEIDEDEPVGKTRQTQEDDL---YIHSEPLGVVLVIGAWNYPFNLTIQP
ROCA_STAHJ      YEAGKPWDEAVGDAAEGIDFIEYYARSMME-LADPVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
PUTA_ECOLI      REAGKTFSNAIAEVREAVDFLHYY--------AGQVRDDFANETH---RPLGPVVCISPWNFPLAIFTGQ
ASTD_VIBF1      KETGKPFWETKTEVGKIAISIRAYHERTPY----KEREAAGNKIVLRHRPLGVMAVFGPYNFPGHLPNGH
ROCA_STAAW      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAAT      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAAR      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAAN      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAAM      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAAE      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAAC      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAAB      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAA9      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAA8      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAA3      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAA2      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ROCA_STAA1      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ASTD_SALG2      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_SALEP      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
PUTA_SALTY      REAGKTFSNAIAEVREAVDFLHYY--------AGQVRDDFDNETH---RPLGPVVCISPWNFPLAIFTGQ
ASTD_SHEPA      QETGKTATEAGAMIGKIGLSVAAYHKRTGTSEND----TPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_SHEHH      QETGKTATEAGAMIGKIGLSVAAYHKRT----GTSESETPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_SHEB8      QETGKPQWETATEIGKIALSAAAYNKRT----GTEANDTPAGRAVIRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_ALISL      KETGKPFWETKTEVGKIAISIRAYHERTPH----KEREAAGNKIVLRHRPLGVMAVFGPYNFPGHLPNGH
PUTA_KLEAE      REAGKTFSNAIAEVREAVDFLHYY--------AGQVRDDFDNETH---RPLGPVVCISPWNFPLAIFTGQ
ASTD_VIBCH      KETGKPLWETRTEXXXXXXXXXXXXXXYHERTGETVREAAGNQLVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_VIBC3      KETGKPLWETRTEXXXXXXXXXXXXXXYHERTGETVREAAGNQLVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_SHEPW      QETGKTATEAGAMIGKIGLSVAAFHKRTGTSEND----TPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_CITK8      RETGKPCWEAATEINKIAISVKAYHART----GEQQSELPDGAATLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_BURXL      RETGKPLWEARTEAASMAAKVEISIQAYNERTGEKRSAMADGTAVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_VIBFM      KETGKPFWETKTEVGKIAISIRAYHERTPY----KEREAAGNKIVLRHRPLGVMAVFGPYNFPGHLPNGH
ASTD_SHESH      QETGKTATEAGAMIGKIGLSVAAYNKRTGTSEND----TPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_SALA4      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_PSEPK      EETGKPLWESATEINKVAISVQSYRERTGEKLADAT-------AVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_SHEFN      QETGKPQWETATEVGAMIGKIALSAKAHDKRTGTETNDLPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_PSEPG      EETGKPLWESATEINKVAISVQSYRERTGEKLADAT-------AVLRHKPHGVVAVFGPYNFPGHLPNGH
AL3A1_HUMAN     ----------------------------PEWAADEPVEKTPQTQYIHSEPLGVVLVIGTWNYPFNLTIQP
ASTD_SALNS      RETGKPRWEAETEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ALDH3_BACSU     ------------------------------------------------EPKGVTLILGPWNYPFMLTMAP
ROCA_STAAS      YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKVLDREGEHNKYFYKSIGTGVTIPPWNFPFAIMAGT
ASTD_ERWT9      RETGKPRWETQTEVQKVAISLRAWHVRCP-----EQVEGE---SSVRHRPHGVMAVFGPYNFPGHLPNGH
ASTD_ECOSM      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_SHEB2      QETGKPQWETATEIGKIALSAAAYNKRT----GTEANDTPAGRAVIRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_CAUSK      RETGKALWETKAELGSMAGKVEASIKAYDERTGEHANDMAFGRAVLRHRAHGVMAVLGPFNFPGHLPNGH
AL7A1_DICDI     LEMGKIYIEAKGEVQEFIDVCD-YATGLSRSINGQVMPSE-RPNHILMEPLGLVGIITAFNFPCAVLGWN
ASTD_SHESW      QETGKPQWETATEIGKIALSAAAYHKRT----GTEANDTPAGRAVIRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_SHEWM      QETGKTATEAGAMIGKIGLSVAAYNKRT----GSSENDTPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGH
ASTD_ESCF3      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
ASTD_SALPB      RETGKPRWEAATEINKIAISIKAYHARTGA-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_ECO7I      RETGKPRWEAATEINKIAISIKAYHVRT----GEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGH
CALB_PSEUH      ADFGNRSREQTLLCDIAGSVASLKDEHVAKWMEPEHHKAPGAEARVEFQPLGVVGVISPWNFPIVLAFGP
ASTD_SALPK      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_SALPA      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_SALTY      RETGKPRWEAATEINKIAISIKAYHARTGA-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_SALTI      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_SALPC      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_SALHS      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_SALDC      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
ASTD_SALSV      RETGKPRWEAATEINKIAISIKAYHARTGE-QKSELVDGAATLRH---RPHGVLAVFGPYNFPGHLPNGH
AL3B1_RAT       QDLHKSAFESESEIAISQAEVDLALRNLRSWMKDEKVSKNLATAFIRKEPFGLVLIIVPWNYPLNLTLVP
ALDH3_DICDI     KDLGKHEFEIQTEIVMIQTELDETISHLESWNKTEKVYSPLHSSYILKEPLGVVLIMSPWNYPVNLALIP
AL3B1_HUMAN     QDLHKSAFESQGEVTLAAWM---KDERVPKNLATQLDSAFIRK-----EPFGLVLIIAPWNYPLNLTLVP
AL3B1_MOUSE     QDLHKSAFEAESEIAISQAEVDLALRNLRSWMKDEKVSKNLATAFIRKEPFGLVLIIVPWNYPINLTLVP
AL3A2_MACFA     ADLCKSLNAYSQEVITVLGEIDFMLENLPEWVTAKPVKKNLLEAYIQPQPLGVVLIIGAWNYPFVLIIQP
ASTD_BURPS      RETGKPLWEARTEVASMASIAAYHERTGERRTADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_BURP6      RETGKPLWEARTEVASMASIAAYHERTGERRTADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_BURP1      RETGKPLWEARTEVASMASIAAYHERTGERRTADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_BURP0      RETGKPLWEARTEVASMASIAAYHERTGERRTADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_BURMS      RETGKPLWEARTEVASMASIAAYHERTGERRTADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ASTD_BURMA      RETGKPLWEARTEVASMASIAAYHERTGERRTADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
ALDH_PSEOL      ADFRKPASEV-----KLTEIFPVLQEHAKRNLKDWMKPRRVRRAGLRYEPKGVCLIIAPWNYPFNLSFGP
ALDH9_POLMI     ----------------------------------------------------------------------
PUT2_EMENI      HGQGK--NAWQAEIDSAAELCDFFRKYAEDLYAQQPVHAPGVWNRVEYRPLGFVYAISPFNFTAIGGNLA
ASTD2_CAUCR     RETGKALWETRAELASMAGKVDLYDERTG-------VTENAMRAVLRHRAHGVMAVLGPFNFPGHLPNGH
AL3A1_CANFA     ADLHKNEWNAXXXXXXXXXXXXXXMKKLPEWAADEPVEKTPQTQYIHSEPLGVVLIIGTWNYPFTVTIQX
ALDH_CRAPL      ---------------------------------------------IVSEPLGVVLVITAWNYPFLLALDP
AL3H1_ARATH     ---------------------------------------------IVSEPLGVVLVISAWNYPFLLSIDP
AL3A2_HUMAN     ADLCKSFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLEAYIQPQPLGVVLIIGAWNYPFVLTIQP
AL3A2_PONAB     ADLCKSFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLEAYIQPQPLGVVLIIGAWNYPFVLTIQX
AL3B1_BOVIN     QDLHKSAFEAESEISISQNEINLALRNLRTWMKDEKVSKNLATAFIRKEPFGLVLILSPWNYPLNLSLGP
ASTD_BURTA      RETGKPLWEARTEVASMASITAYHEKRAP--MADGV-------AVLRHRPHGVVAVFGPYNFPGHLPNGH
AL3A2_RAT       ADLSKSLNAYSHEVITILGEIDFMLGNLPELASARPAKKNLLEAYVQPEPLGVVLIIGAWNYPFVLTLQP
AL3A2_MOUSE     -------------------------------------------AYVQPEPLGVVLIIGAWNYPFVLTMQX
GAPN_SCEVA      ------------------------------------------------------LAIPPFNYPVNLAVSK
ALDH1_ENTHI     EDLHRDVGMCVAEVNSVIHEINFXXXXXXXXXXXXQVPTVCAKSFVEREPYGCVCVISPWNFPANLSLIP
PUTA_RHIME      REAGKSALNAIAEVREAIDFLRYYAEQT-------------RRTLGPATPLGPIVCISPWNFPLAIFTGQ
CALB_PSEAE      ---------------------------------------------VVYQPLGVVGVIVPWNYPLFLSIGP
CALB_CAUCR      QDFGSRSPEATSLTDVAGSILKHAREHLTKWMKPEILGLFGAKATVQWQPKGVVGVISPWNFPVNLTFAP
AL4A1_HUMAN     VGQGKTV--IQAEIDAAAELIDFF-----RFNAKYAVELEGQQP-ISVPPSGFVAAISPFNFTAIGGNLA
A16A1_RAT       ------------------------------------------------EPLGVIGLILPTSFSFLDMMWR
AL4A1_DANRE     IGQGKTV--VQAEIDAAPELIDFFRKHAIELEDQQPLDSDGSTNTMLYRGLGFVAAVAPFNFTAIGGNLA
A16A1_MOUSE     LVTGRAVREVRGDVPLAQQLLQYHAVQAHA-------QGDALADW---QPVGVIGLILPTPFSFLDMMWR
A16A1_BOVIN     LVTGRAVREVRRDVPLAQQLLQYHAVQA----------HTQEEALAGWEPMGVIGLILSPTFPFLDMMWR
MAOC_ECOLI      AQTGATRADSWVDIEGGIGTLFTYASLGSRELPDDTLEGGFAARHLLTSKSGVAVHINAFNFPCWGMLEK
PUT2_SCHPO      IGQGKNIWQA--EIDAGMEIIDFLRKYASELYASQPPENTPRMEYRPLE--GFVYAITPFNFTAIAGNLA
AL3B2_HUMAN     --------------------------------------------FIWKEPFGLVLIIAPWNYPXXXXXXX
A16A1_HUMAN     LVTGRAVREVRGDVQLAQQLLHYHAIQA----------STQEEALAGWEPMGVIGLILPPTFSFLEMMWR
PUT2_YEAST      LGQGKNVYQAEIDITELSDFFRYYVKYASDLYAQQPVESDGTWNKAEYRPLGFVYAVSPFNFTAIAANLI
AL4A1_MOUSE     VGQGKTV--IQAEIDAAAELIDFFRKFAVELEGEQPISVPPSTNHTVYRGLGFVAAISPFNFTAIGGNLA
AL4A1_RAT       VGQGKTV--IQAEIDAAAELIDFFRKFAVELEGEQPISVPPSTNHVVYRGLGFVAAISPFNFTAIGGNLA
AL4A1_BOVIN     VGQGKTV--IQAEIDAAAELIDFFRFNAKFAMELEVPPSTNSMLYRGLE--GFVAAISPFNFTAIGGNLA
AL3F1_ARATH     ---------------------------------------------VISEPYGTVLVLSSWNFPISLSLDP
AL4A1_DICDI     LGQGKTVWQA--EIDAAAYAQEIYQQQPPA-------NSAGCWNILTYQPLGYVVAISPFNFTAIGLNLS
AL3I1_ARATH     QDLSKPELEALAEISNTKSSCMLAIKELKNWMAPETVKTSVTTAQIVSEPLGVVLVISAWNFPFLLSVEP
PUT2_AGABI      TMLGQGKNTWQAEIDAAAELADFF-----RFGVSYVEELYAQQNRTEYRPLGFVLAVSPFNFTAIGGNLP
HFD1_YEAST      ----------------------------------------------------------------------
AL3A1_BOVIN     ----------------------------------------------------------------------
BOXD_AZOEV      RNSGATEGDASFDVDGAIFTVKSYARAAGRHLKEALAKTDVFQGQHFLMPLGVAVFINAFNFPAWGLWEK
AL7A1_RAT       ----------------------------------------------------------------------
EUTE_SALTY      -------------------------------LSPQVLTGDNGLTLIENAPWGVVASVTPSTNPAATVINN
ALDHX_YEAST     ----------------------------------------------------------------------
ALDH_VIBHA      LETARLTGEIARTANQLRLFADYHQADTPNPTRAPLPKPDIRRQQIALGPVAVFLAFSXXXXXXXXXXXX
PROA_CYAP4      ------------------------------------------------------------------VVQI
EUTE_ECOLI      SETGM----GRVEDKFAKNVAQARGTPGVECLSPQVLTGDNGLTLIENAPWGVVASVTPSTNPAATVINN
ALDH_LINUS      RVAPKSYHQALGEVQVTQKFFENFTGDQVRFLARSFGVPGGQQSNGFRWPFGPVAIITPFNFPLEIPVLQ
PROA_STRU0      -------------------------------------------------PLG-VIAMIFESRPNVSVDAF
PROA_ACIAD      ----------------------------------------------------------------------
PROA_THEP1      ----------------------------------------------------------------------
PROA_DESDA      ----------------------------------------------------------------------
ADHE_CLOAB      LETG--MGLVEDKVIKNHFAGEYYNKYKDEKTCGIIERNEPYGITKIAEPIGVVAAIIPVTNPTSTTIFK
PROA_PELTS      EDLGPLLKRLKFDEAKIQEVIEELEDPVGRTLLSTELD-DGLELYKVTCPIGVIGVIFESRDALVQISTL
SEC16_NEOFI     ----------------------------------------------------------------------
PROA_CLOPS      ----------------------------------------------------------------------
PROA_CLOPE      ----------------------------------------------------------------------
PROA_THESQ      ----------------------------------------------------------------------
PROA_THEMA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           CAPALVAGNTAVLKHAANVPQCGLAIEQTLLEAGFPPGVFRTLLVSSSQTAKVIADPRVQGVTLTGSEAA
GABD_SYNY3      AAPALMAGNVGLLKHASNVPQCALAIAEIFQTAGFPEGAFQTLLIGGKVASELMADDRIQAGTLTXXXXX
GABD_DEIRA      AAPNLVVGNTVLLKHSELCPQSALALEQLFHDAGVPQGAYTNLFLRIADIEQVIAHPAVQGVSLTGSERA
YNEI_ECOLI      AVPIILAGNGYLLKHAPNVMGCAQLIAQVFKDAGIPQGVYGWLNADNDGVSQMIKDSRIAAVTVTGSVRX
GABD1_MYCPA     AAPALMAGNVGILKHASNVPQSALYLADVITRGGFPEGCFQTLLVPSSAVERILRDPRVAAATLTGSEPA
GABD1_MYCA1     AAPALMAGNVGILKHASNVPQSALYLADVITRGGFPEGCFQTLLVPSSAVERILRDPRVAAATLTGSEPA
GABD1_MYCUA     AAPALMAGNVGLLKHASNVPQSALYLADVIARAGFPDGCFQTLLVSASAVEGILRDPRVAAATLTGSEPA
GABD1_MYCTU     AAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPA
GABD1_MYCTA     AAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPA
GABD1_MYCBP     AAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPA
GABD1_MYCBO     AAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPA
GABD1_MYCLE     AAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPEDCFQTLLISANGVEAILRDPRVAAATLTGSEPA
GABD_ECOLI      AGPALAAGCTMVLKPASQTPFSALALAELAIRAGVPAGVFNVVTGSAGAVGELTSNPLVRKLSFTGSTEI
BETB1_RHIME     GAPALVAGNAMVFKPSENTPLGALKIAEILIEAGLPKGLFNVIQGDRATGPLLVNHPDVAKVSLTGSVPT
BETB_SINMW      GAPALVAGNSMVFKPSENTPLGALKIAEILIEAGLPKGLYNVVQGDRSTGPLLVNHPDVAKVSLTGSVPT
AL9A1_MOUSE     SAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPPGLFNVVQGGAATGQFLCHHREVAKISFTGSVPT
BETB_RHIE6      GAPALIAGNAMVFKPSENTPLGALKIAEILHEAGLPKGLFNVIQGDRDTGPLLVNHPDVAKVSLTGSVPT
BETB_RHIEC      GAPALISGNAMVFKPSENTPLGALKIAEILHEAGLPKGLFNVIQGDRDTGPLLVNHPDVAKVSLTGSVPT
BETB_YERPY      SAPALAAGNAMIFKPSEVTSLTALKLAEIYTEAGLPAGVFNVLTGSGDQVGQMLTEPGIAKVSFTGGIAS
BETB_RHIL3      AAPALVCGNAMVFKPSENTPLGALKIAEILHEAGLPKGLFNVIQGDRDTGPLLVNHPDVAKVSLTGSVPT
BETB_ACIBT      SAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGREIGQWLTEPVIEKISFTGGVET
BETB_RHISN      GAPALAAGNSMVFKPSENTPLGALKIAEILIEAGLPKGLYNVIQGDRSTGPLLVNHPDVAKVSLTGSVPT
BETB_PSEA7      SAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEPLIEKISFTGGTST
BETB_AGRT5      AAPALVAGNAMVFKPSENTPLGALKIAEILIEAGLPKGLFNVIQGDRDTGPLLVNHPDVAKVSLTGSVPT
BETB_ACIBY      SAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGREIGQWLTEPVIEKISFTGGVET
BETB_ACIB5      SAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGREIGQWLTEPVIEKISFTGGVET
BETB_ACIB3      SAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGREIGQWLTEPVIEKISFTGGVET
BETB_ACIBC      SAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGREIGQWLTEPVIEKISFTGGVET
BETB_PSEAE      SAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEPLIEKISFTGGTST
BETB_PSEA8      SAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEPLIEKISFTGGTST
SSDH_RAT        VGAALAAGCTVVVKPAEDTPYSXXXXXXXXXXXGIPPGVYNVIPCSRTKAKEVCTDPLVSKISFTGSTAT
BETB_PSEFS      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGVPAGVFNVLTGSGREVGTWLTEPRIEKVSFTGGTDT
BETB_PSEAB      SAPALAAGNAMIFKPSEVTPLTTLKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEPLIEKISFTGGTST
BETB_ACIBS      SAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGREIGQWLTEPVIEKISFTGGVET
AL9A1_RAT       SAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPNGLF-NVVQGGAATGQFLCQHRVAKVSFTGSVPT
SSDH_MOUSE      VGAALAAGCTVVVKPAEDTPYSXXXXXXXXXXXGIPAGVYNVIPCSRNKAKEVCTDPLVSKISFTGSTAT
BETB_PSEMY      SAPALAAGNAMIFKPSEVTSLTALKLAEIYTEAGLPAGVFNVLTGSGREVGQWLTEPGIEKVSFTGGTVT
SSDH_ARATH      VGPALASGCTVVVKPSXXXXXXXXXXXXXXXQAGVPPGALNVVMGNAPEIGDLLTSPQVRKITFTGSTAV
BETB_RHOS5      AAPALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGAVGAALVSDSRVAKVSLTGSVPT
BETB_VIBPA      SAPALAAGNAMIFKPSEETPLTALKLAEIYSEAGLPDGVFNVVQGDYRVGQMLTAHPDIAKVSFTGESGT
BETB_ACIAD      SAPALAAGNAMIFKPSEVTPLTAFKLAEIYSEAGLPAGVFNVVQGAGREIGQWLTEHAVEKISFTGGVET
BADH_GADCA      CAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQGGAETGSLLCHHPNVAKVSFTGSVPT
BETB_VIBSL      SAPALAAGNAMIFKPSEETPLTALKLAEIFTEAGLPDGVFNVVQGDYRVGQMLTAHPDIAKVSFTGETGT
BETB_ECO45      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTDPGIAKVSFTGGVAS
AL1A3_HUMAN     LAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPFGPTVGAAISSHPQINKIAFTGSTEV
BETB_KLEP3      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGIGAETGQYLTEPGIAKISFTGGVAS
BETB_VIBHB      SAPALAAGNAMIFKPSEETPLTALKLAEIYSEAGLPDGVFNVIQGDYRVGQMLTAHPDIAKVSFTGESGT
BETB_ECO27      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTDPGIAKVSFTGGVAS
AL1A3_RAT       LAPALCCGNTVVLKPAEQTPLTALYLASLIKEVGFPPGVVNIVPFGPTVGAAISSHPQINKIAFTGSTEV
BETB_ECOL6      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTDPGIAKVSFTGGVAS
BETB_AGRRK      GAPALVAGNAMVFKPSENTPLGALKIAEILIEAGLPKGLYNVIQGDRETGPLLINHPDVAKVSLTGSVPT
BETB_ECOHS      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_SHIF8      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGGGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECOLU      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTDPGIAKVSFTGGVAS
BETB_ECO24      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
SSDH_HYLLA      VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
SSDH_HUMAN      VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
BETB_ECOLC      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPNGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECO8A      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECO7I      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECO5E      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECO57      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECO55      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECOSE      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECOLI      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECODH      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
UGA2_YEAST      AAAALAVGCTVVIKPDSQTPLSALAMAYLAEKAGFPKGSFNVIL-SHANTPKLCESPKVKKVTFTGSTNV
SSDH_PANPA      VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
SSDH_GORGO      VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
BETB_BURP8      SAPALAAGNAMIFKPSEVTPLSASKLAEIYLEAGVPAGVFNVVQGDGRVGAMLSAHPGIAKISFTGGVET
BETB_RHILW      AAPALISGNAMVFKPSENTPLGALKIAEILHEAGLPKGLFNVIQGDRDTGPLLVNHPDVAKVSLTGSVPT
SSDH_PANTR      VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
BETB_BURXL      SAPALAAGNAMIFKPSEITPLSALKLAEIYTEAGVPAGVFNVVQGDGRVGAMLAAHPDIEKISFTGGVET
ALDH4_YEAST     IAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNPKIKKVAFTGSTAT
SSDH_PONPY      VGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIPCSRKNAKEVCTDPLVSKISFTGSTTT
BETB_ECOSM      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
BETB_ECOL5      SAPALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEPGIAKVSFTGGVAS
ALDA_ECOLI      MAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELANPKVAMVSMTGSVSA
ALDH5_BACSU     VAPALGAGNGVVLKPHEETPICGGTLIAKIFEAGIPAGLLNVVVTDIAEIGDSFVEPRI--ISFTGSTKV
BETB_BURPP      SAPALAAGNAMIFKPSEITPLSALKLAEIFTEAGVPAGVFNVVQGDGRVGAMLAAHPDIEKISFTGGVET
BETB_YERP3      SAPALAAGNAMIFKPSEVTSLTALKLAEIYTEAGLPAGVFNVLTGSGDQVGQMLTEPGIAKVSFTGGIAS
BETB_PECCP      SAPALAAGNAMIFKPSEVTSLTALKLAEVYTEAGLPAGVFNVLTGTGQSVGQALTTPGIAKVSFTGGIAS
AL1A1_HUMAN     IGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPYGPTAGAAISSHMDIDKVAFTGSTEV
YF19_SCHPO      IAPAVACGNTIILKTAELTPLSALCLTKFVPECGFPPGVINVLSGDGRRCGNAISSHMIDKVAFTGSTGV
BETB_RHOS1      AAPALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGAVGAALVTDSRVAKVSLTGSVPT
AL1A1_HORSE     IAPALSCGNTVVVKPAEQTPLSALHVATLIKEAGFPPGVVNIVPYGPTAGAAISSHMDIDKVAFTGSTEV
BETB_YERPP      SAPALAAGNAMIFKPSEVTSLTALKLAGIYTEAGLPAGVFNVLTGSGDQVGQMLTEPGIAKVSFTGGIAS
BETB_YERPN      SAPALAAGNAMIFKPSEVTSLTALKLAGIYTEAGLPAGVFNVLTGSGDQVGQMLTEPGIAKVSFTGGIAS
BETB_YERPE      SAPALAAGNAMIFKPSEVTSLTALKLAGIYTEAGLPAGVFNVLTGSGDQVGQMLTEPGIAKVSFTGGIAS
BETB_YERPB      SAPALAAGNAMIFKPSEVTSLTALKLAGIYTEAGLPAGVFNVLTGSGDQVGQMLTEPGIAKVSFTGGIAS
BETB_YERPA      SAPALAAGNAMIFKPSEVTSLTALKLAGIYTEAGLPAGVFNVLTGSGDQVGQMLTEPGIAKVSFTGGIAS
GABD_RHISN      ISPALAAGCTVVLKPAEQTPLVAGAMFALAKLAGFPDGVLNLVYASEGDAIELCTNPKVRKISFTGSTEV
BETB_RHOSK      AAPALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGGVGAALVTDSRVAKVSLTGSVPT
AL9A1_HUMAN     SAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPT
BETB_RHOS4      AAPALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGAVGASLVTDSRVAKVSLTGSVPT
AL9A1_PONAB     SAPALACGNAMVFKPSPFTPVSALLLAEIYTEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPT
A9A1B_DANRE     SAPAIACGNSMVFKPSPLTPVTAVLLAEIYRQAGAPEGLFNVVQGGQETGSLLCLHPSVEKVSFTGSVPT
SSDH2_SCHPO     GGAALAAGCTAIFLPAFRTPYVCLGLVRLAQEAGFPDGVLNVITSSSAHGKELTTNPIVRKVSFTGSTNV
BETB_PSEPW      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPDGVFNVLTGSGREVGTWLTEPRIEKVSFTGGTTT
ALDH_AGABI      IGPALATGNCIVLKPSEFTPLSALRMCALIQEAGFPPGVVNVVTGYGSTTGQAISSHKIDKVAFTGSTLV
BETB_YERPS      SAPALAAGNAMIFKPSEVTSLTALKLAGIYTEAGLPAGVFNVLTGSGDQVGQMLTEPGIAKVSFTGGIAS
AL1A3_MOUSE     LAPALCCGNTVVLKPAEQTPLTALYLASLIKEVGFPPGVVNIVPFGPTVGAAISSHPQINKIAFTGSTEV
AL1A2_HUMAN     IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHGIDKIAFTGSTEV
ALDH4_BACSU     MGAALATGCTIVLKPAEQTPLSALYLAELIDQAGFPAGVINIIPGFGEDAGEALTNHEVDKIAFTGSTEI
AL1A2_RAT       IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHGIDKIAFTGSTEV
BETB_PSESM      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGVPNGVFNVLTGSGREVGTWITEPRIEKVSFTGGTDT
BETB_PSEPG      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPNGVFNVLTGSGREVGTWLTEPRIEKVSFTGGTTT
AL1A2_MOUSE     IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHGIDKIAFTGSTEV
BETB_ERWCT      SAPALAAGNAMIFKPSEVTSLTALKLAEIYTEAGLPAGVFNVLTGTGKSVGQALTTPGIAKVSFTGGIAS
YLX7_SCHPO      IAPALAAGNCIIIKSAETTPLSLLYFATLVEEAGFPKGVVNIITVAGSYMAK---HPGIDKIAFTGSTKV
BETB2_RHIME     AAPALACGNAMIFKPSEVTPLSALKLAEILTEAGLPPGVFNIVQGAGDVGAELATHPAIAKVSLTGSVKT
BETB_PSEU2      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGVPNGVFNVLTGSGREVGTWITEPRIEKVSFTGGTDT
BETB_PSEPK      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPNGVFNVLTGSGREVGTWLTEPRIEKVSFTGGTTT
BETB_PSEP1      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPNGVFNVLTGSGREVGTWLTEPRIEKVSFTGGTTT
BETB_PSE14      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGVPNGVFNVLTGSGREVGTWITEPRIEKVSFTGGTDT
BETB_PSEPF      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGVPNGVFNVLTGSGREVGTWLTEPRIEKISFTGGTDT
AL1B1_MOUSE     LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMVDKVAFTGSTEV
ALDH2_PONAB     LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEI
ALDH2_HUMAN     LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEI
AL9A1_BOVIN     SAPALACGNAMVFKPSPFTPVSVLLLAEIYTEAGVPPGLFN-VVQGGAATGQFLCQHRVAKVSFTGSVPT
BETB_PSEU5      XXXXXXXXXXMIFKPSEVTPLSALRLAEIFSEAGLPDGVFNVLTGSGAGVGALITEPRIAKVSFTGGVAT
AL1L2_MOUSE     SAACLAAGNTLVLKPAQVTPLTALKFAELTVKAGFPKGVINIIPGSGGVAGQRLSQPDIRKLGFTGSTSV
PUUC_ECOLI      LGPALAAGNSVILKPSEKSPLSAIRLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNIDAIAFTGSTRT
AL1A2_CHICK     IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGFGPIVGAAIASHGIDKIAFTGSTEV
BETB_BURA4      TAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
BADH1_ARATH     VAPSLAAGCTAILKPSELASVTCLELADICREVGLPPGVLNVLTGFGSEAGAPLASPGVDKIAFTGSFAT
BETB_PSEF5      SAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPDGVFNVLTGSGREVGTWLTEPRIEKVSFTGGTDT
BADH_SCHPO      LVPAIASGNCVVLKPSELAPWSCLEFALICKEAGLPDGVLNVIIGSGKESGAALSHPKIAYLAFTGSLAT
BADH_AMAHP      VAPALAAGCSAVLKPSELASVTCLELAEVCREVGLPPGVLNILTGLGPEAGGPLAHPDVDKVAFTGSTAT
AL1A1_RABIT     IGPALSCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPYGPTAGAAISSHMDIDKVAFTGSTEV
BETB_STRMK      SAPALAAGNAMVFKPSEVTPLTAIRLAEIYTEAGVPAGVFNVVQGPGREIGQWLTEPVIEKISFTGGVAT
BETB_PSEE4      SAPALAAGNAMIFKPSEVTSLTTLKLAEIFTEAGLPNGVFNVLTGSGREVGTWLTEPRIEKVSFTGGTTT
AL2B7_ARATH     LGPALACGNTVVLKTAEQTPLSALLVGKLLHEAGLPDGVVNIVSGFGATAGAAIASHMVDKVAFTGSTDV
AL1A1_MACFA     IGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPYGPTAGAAISSHMDIDKVAFTGSTEV
BETB_STRM5      SAPALAAGNAMVFKPSEVTPLTAIRLAEIYTEAGVPAGVFNVVQGPGREIGQWLTEPVIEKISFTGGVAT
GABD_BACSU      AAPALAAGCTFIIKPAPDTPLSAYELARLAYEAGIPKDVLQVVIGDGEEIGNVFSSPKIRKITFTGSTPV
BETB_BURCM      TAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
BADH_SPIOL      IAPALAAGCTAVLKPSELASVTCLEFGEVCNEVGLPPGVLNILTLGPDAGAPLVSHPDVDKIAFTGSSAT
AL8A1_DANRE     IAPAVATGNTVVAKPSEMTSVTAWMMCQLLEEAGFPPGVVNIVFGTGPRAGDLVSHPDVPLISFTGSTAT
AL1L2_HUMAN     SAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSEPDIRKLGFTGSTPI
BETB_MARMS      SGPALAAGNAMIFKPSEETPLTALKLAEIFTEAGLPDGVF-NVIQGDARTGQLITNPDIDKVSFTGEVGT
BADH_ATRHO      IAPALAAGCTTVLKPSELASVTCLEFGEVCNEVGLPPGVLNILTLGPDAGAPIVSHPDIDKVAFTGSSAT
ALDH_CLAHE      IGPAIACGNTVVLKTAEQTPLGGLVAASLVKEAGFPPGVINVISFGKVAGAALSSHMDVDKVAFTGSTVV
AL1A1_SHEEP     IGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPYGPTAGAAISSHMDVDKVAFTGSTEV
BETB_SERP5      SAPALAAGNAMIFKPSEVTSLTALKLAEIYTEAGLPDGVFNVVTGSGAEVGQYLTDPGIAKVSFTGGVKT
AL1A1_MOUSE     IGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPYGPTAGAAISSHMDVDKVAFTGSTQV
FTHFD_XENTR     TAACLAAGNTVVLKPAQVTPLTALKFAELSVKAGIPKGVINILPGAGSLIGQRLSDPDVRKIGFTGSTPI
AL1A1_BOVIN     IGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPYGPTAGAAISSHMDVDKVAFTGSTEV
ALDH_BACST      MAPALVYGNTVVLKPASETAVTAAKVIECFHEAGFPKGVVNMVCGSGSVVGQGIANPDIDGVTFTGSNTV
ALDH1_MACPR     IGPALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPYGPTAGAAISSHMDVDKVAFTGSTEV
ALDH2_MESAU     LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEV
AL8A1_HUMAN     IAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGELVSHPEVPLISFTGSQPT
AL1A2_TAEGU     IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGFGPIVGAAIASHGIDKIAFTGSTEV
ALDH1_ELEED     IGPALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPYGPTAGAAISSHMDVDKVAFTGSTEV
BADH_BETVU      IAPALAAGCTAVLKPSELASITCLEFGEVCNEVGLPPGVLNIVTXXXXXXXXXXXXXXVDKVAFTGSSAT
ALDH2_RAT       LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEV
AL1A1_RAT       IGPALSCGNTVVVKPAEQTPLTALHMASLIKEAGFPPGVVNIVPYGPTAGAAISSHMDVDKVAFTGSTQV
FEAB_ECOLI      --PALAAGCSIVIKPSETTPLTMLRVAELASEAGIPDGVFNVVTGSGAVCAALTSHPHVAKISFTGSTAT
BETB_BRUMB      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
ALDH2_MOUSE     LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEVDKVAFTGSTEV
AL1A7_MOUSE     LGPALSCGNTVVVKPAEQTPLTALHMASLIKEAGFPPGVVNIVPGYGPTAGGAISSHMIDKVSFTGSTEV
ABDH_ERWCT      LAPALAAGNCVVLKPAEQTPLTTFYLAHLLADI-LPAGVVNIVFGRGADIGDALTGEKVNMVSLTGSIAT
BETB_BRUO2      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
BETB_BRUME      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
BETB_BRUAB      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
BETB_BRUA2      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
BETB_BRUA1      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
ALDH2_BOVIN     LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNVIPGFGPTAGAAIASHEVDKVAFTGSTEV
ALDH6_YEAST     IAPALAMGNVCILKPAAVTPLNALYFASLCKKVGIPAGVVN-IVPGPGRTAALTNDPRIRKLAFTGSTEV
ABDH_PECCP      LAPALAAGNCVVLKPAEQTPLTTFYLAHLLAEI-LPAGVVNIVFGRGADIGDALTGEKVNMVSLTGSIAT
AL9A1_ORYLA     SAPALACGNAMVFKPSPFTPVTAVILAEIYKEAGVPDGLFCVVQGGAETGSLLCNHPKVAKVSFTGSVPT
DMPC_PSEUF      VGPALACGNTVVVKPSEETPLTTALLGEVMQAAGVPAGVYNVVFGPDSAGAFLTEHPDVNAITFTGETRT
AL1B1_PONAB     LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMVDKVAFTGSTEV
FTHFD_MOUSE     TAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDPDVRKIGFTGSTEV
BETB_BRUSU      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
BETB_BRUSI      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
BETB_BRUC2      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAKVSLTGSVPT
AL2B4_ARATH     VGPALACGNTIVLKTAEQTPLTAFYAGKLFLEAGLPPGVLNIVSGFGATAGAALASHMVDKLAFTGSTDT
AL1B1_HUMAN     LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMVDKVAFTGSTEV
ALDH_ALTAL      IGPAIATGNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITFGKIAGAAMSAHMDIDKIAFTGSTVV
BETB_OCHA4      SAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGFGDVGAALVNHRLTAKVSLTGSVPT
BETB_BACSU      IAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELANKDVDLISFTGGIET
BETB_XANC5      XXXXXXXXXXMIFKPSEVTPLTALKLAEIFTEAGLPDGVFNVLPGDGASVGTALTEPQIEKISFTGGTAT
A9A1A_DANRE     SAPALACGNAMVFKPSPMTPVTAVMLAEIYKEAGVPDGLFNVVQGGAETGSLLCHHPMVAKVSFTGSVPT
BETB_CHRSD      AAPALAAGNAIVFKPSEVTPLTALKLAEIFTEAGLPDGVFNVVQGDGRVGAMLTEHEGIAKVSFTGEVGT
BETB_VIBVU      AAPALAAGNAMIFKPSEETPLSALKLAELFTQAGVPDGVFNVVQGDYRVGQMLTAHPEIDKVSFTGESGT
BETB_BURS3      TAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
ALDH_ASPNG      IGPAIATGNTVVIKTAEQTPLSGLYAANVIKEAGIPAGVVNVISGFGRVAGSAISHHMIDKVAFTGSTLV
BETB_BURCH      TAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
BETB_BURCA      TAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
ALDA_STAAW      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
ALDA_STAAN      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
ALDA_STAAM      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
BETB_VIBVY      AAPALAAGNAMIFKPSEETPLSALKLAELFTQAGVPDGVFNVVQGDYRVGQMLTAHPEIAKVSFTGESGT
ALDA_STAAR      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPNGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
ALDA_STAAB      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
AL1B1_RAT       LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMVDKVAFTGSTEV
HPCC_ECOLX      VAPCLALGITAVLKMSELSPLTADRLGELALEAGIPAGVLNVVQYGATAGDALVRHHDVRAVSFTGGTAT
FTHFD_PONAB     TAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDPDVRKIGFTGSTEV
BETB_BURP1      SAPALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIAKVSFTGGVET
BETB_BURP0      SAPALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIAKVSFTGGVET
BETB_BURMS      SAPALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIAKVSFTGGVET
BETB_BURMA      SAPALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIAKVSFTGGVET
BETB_BURM9      SAPALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIAKVSFTGGVET
BETB_BURM7      SAPALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIAKVSFTGGVET
ALDH2_PIG       LGPALATGNVVVMKVSEQTPLTALYVANLIKEAGFPPGVVNIVPGYGPTAGAAIASHEVDKVAFTGSTEV
ALDA_STAAS      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
BETB_BURPS      SAPALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIAKVSFTGGVET
BETB_BURP6      SAPALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIAKVSFTGGVET
ALDA_STAAC      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
ALDA_STAA8      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
ALDA_STAA3      XXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGSESGNAIFNDGVDKLSFTGSTDV
BETB_BURCC      TAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
FTHFD_RAT       TAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDPDVRKIGFTGSTEV
BETB_BURM1      TAPALAAGNAMVFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
BETB_XANCB      XXXXXXXXXXMIFKPSEVTPLTALKLAEIFTEAGLPDGVFNVLPGDGASVGHALTEPEIEKISFTGGTAT
BETB_XANC8      XXXXXXXXXXMIFKPSEVTPLTALKLAEIFTEAGLPDGVFNVLPGDGASVGHALTEPEIEKISFTGGTAT
BETB_BURCJ      TAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
FTHFD_HUMAN     TAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDPDVRKIGFTGSTEV
BETB_XANCP      XXXXXXXXXXMIFKPSEVTPLTALKLAEIFTEAGLPDGVFNVLPGDGASVGHALTEPEIEKISFTGGTAT
BETB_XANAC      XXXXXXXXXXMIFKPSEVTPLTALKLAEIFTEAGLPDGVFNVLPGDGASVGTALTEPQIEKISFTGGTAT
BADH_ORYSJ      VAPALAAGCTAVLKPSELASLTCLELGGICAEIGLPPGVLNIITLGTEAGAPLASHPHVDKIAFTGSTET
FTHFD_XENLA     TAACLTAGNTVVLKPAQVTPLTALKFAELSVKAGIPKGVINILPGAGSLIGQRLSDPDVRKIGFTGSTPI
BADH2_ARATH     VAPSLAAGCTAILKPSELASLTCLELADICREVGLPPGVLNILTLGTEAGAPLASHPHVDKIVFXXXXXX
ALDH_EMENI      IGPAVAAGNTVVLKTAEQTPLSALYAAKLIKEAGFPAGVINVISFGRTAGAAISSHMDIDKVAFTGSTLV
ALDH2_HORSE     LGPALATGNVVVMKVAEQTPLTALYVANLTKEAXXXXXXXXXXXXXXXTAGAAIASHEVDKVAFTGSTEV
ALD1_STAHJ      LAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSEPKVRMMSFTGSGRT
LADH_META3      IAPAIAMGNSIVAHPSSKAPMITIEIEKVLKSKKIPLGVFNLLTGEGHIVGEIVKNNKINKLSFTGSVEV
SSDH1_SCHPO     VGAALAAGCTVVIRPAAETPFTALALAKLAERAGVPAGVLNMVTANSPSEIELTTNPLIRKVSFTGSTNV
BETB_RHILO      SAPALAMGNAMVFKPSENTPLSALALAEIYSEAGLPDGLFNVVQGYGDVGAGLVGHDVVAKVSVTGSVPT
BETB_BURVG      TAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIAKVSFTGGVET
AL1A1_CHICK     IAPALCCGNTVVVKPAEQTPLSALYMGSLIKEAGFPPGVVNIVPGFGPTAGAAISHHMIDKVSFTGSTEV
ALDH_ENCBU      XXXXXXXGCTLVLKPAEQTPLTALYLASLVKQAGFPAGVINIVPLGHTAGAALTNHPDINKITFTGSTEV
AL1A7_RAT       IGAALSCGNTVIVKPAEQTPLTALYMASLIKEAXXXXXXXXXXXXXXSTAGAAISSHMIDKVSFTGSTEV
ALDH5_YEAS7     IGPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGRLSAHPDVKKIAFTGSTAT
LADH_METVS      IGPAIATGNAVVLHPSSKAPITAIVIEHVLKKMNIERGVFNLTTGNGEIVGDEIANEKINFLSFTGSVEV
ALDH5_YEAST     IGPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGRLSAHPDVKKIAFTGSTAT
XYLC_PSEPU      VAPALALGNAVILKPDLQTAVTGGAIAEIFSDAGMPDGVLHVLPGGADVGESMVANSGINMISFTGSTQV
GABD2_MYCS2     SIPALLAGNAVVVKPDSQTPYCTLANAELLYEAGLPRDLFAVVPGPGSVVGTAIVE-NCDYLMFTGSTAT
AL8A1_BOVIN     IAPAIAAGNTVIAKPSELTSVTAWMMCRLLEKAGVPPGVVNIVFGTGPRVGELVSHPEVPLISFTGSQPT
Y4UC_RHISN      LGPAIAGGNAVMLKPSNLTPFSAIKLVGALREAGLPEEVITISHGDRELVTAMIAAREVRMVSFTGGFAT
ABDH_CITK8      XXXXXXXGNCVVIKPSEITPLTALKLAEFAKDI-FPPGVLNVLF----GRGKTVGDPKVRMVSLTGSIAT
ALDH3_YEAST     MQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMIDKISFTGSTKV
AL221_ARATH     MLAAVFSGNGIVIKVSEHASWSGFRIIQAALAAVGAPENLVDVITGFAETGEALVSS-VDKMIFVGSTAV
ABDH_SALPA      XXXXXXXGNCVVIKPSEITPXXXXXXXXXXXDI-FPPGVLNVLFGRGQTVGDVLTGEKVRMVSLTGSIAT
IOLA1_GEOTN     FPLAIACGNTFVLKPSERTPMLANRLAELFKEAGLPDGVLNIVHGAHDVVNGLLEHPDVKAISFVGSQPV
GABD2_MYCUA     SVPALIAGNAVVLKPDSQTPYCALACAELLYRAGLPRALYAIVPGPGSVVGTAIAD-NCDYLMFTGSSAT
ALDH2_YEAST     LQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMIDKISFTGSTKV
GABD2_MYCTU     SVPALVAGNAVVLKPDSQTPYCALACAELLYRAGLPRALYAIVPGPGSVVGTAITD-NCDYLMFTGSSAT
GABD2_MYCTA     SVPALVAGNAVVLKPDSQTPYCALACAELLYRAGLPRALYAIVPGPGSVVGTAITD-NCDYLMFTGSSAT
GABD2_MYCBP     SVPALVAGNAVVLKPDSQTPYCALACAELLYRAGLPRALYAIVPGPGSVVGTAITD-NCDYLMFTGSSAT
GABD2_MYCBO     SVPALVAGNAVVLKPDSQTPYCALACAELLYRAGLPRALYAIVPGPGSVVGTAITD-NCDYLMFTGSSAT
AL8A1_MOUSE     IAPAIAAGNTVIAKPSEMTSVTAWMFCKLLDKAGVPPGVINIVFGTGPRVGELVSHPEVPLISFTGSQPT
ABDH_SALAR      XXXXXXXGNCVVIKPSEITPXXXXXXXXXXXDI-FPPGVINVLFGRGQTVGDALTGEKVRMVSLTGSIAT
NAHF_PSEU8      IAYPLVCGN