[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57001.1

[Show Plain Result]


## Summary of Sequence Search
    1::548
   73::454     7e-52  39%  664 aa  NU5C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 5;   
   70::455     3e-51  38%  666 aa  NU5C1_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   64::442     2e-50  34%  670 aa  NU5M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   73::421     4e-50  40%  681 aa  NU5C_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 5;   
   64::442     6e-50  34%  670 aa  NU5M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   35::439     8e-50  33%  645 aa  NUOL_RICFE RecName: Full=NADH-quinone oxidoreductase subunit L;    
   59::423     8e-50  41%  606 aa  NQO12_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 12;  
   64::442     7e-49  34%  669 aa  NU5M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     7e-49  37%  720 aa  NU5C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   98::421     9e-49  36%  669 aa  NU5M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     5e-48  37%  742 aa  NU5C_SPIOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   33::444     6e-48  39%  615 aa  NUOL_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit L;    
   63::448     8e-48  36%  670 aa  NU5M_DICDI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   66::437     1e-47  35%  613 aa  NUOL_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit L;    
   68::439     2e-47  32%  603 aa  NU5M_RABIT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   31::448     2e-47  36%  668 aa  NU5M_DICCI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   75::454     4e-47  45%  670 aa  NU5C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     7e-47  34%  739 aa  NU5C_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     7e-47  34%  737 aa  NU5C_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     7e-47  34%  740 aa  NU5C_SOLBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   46::425     9e-47  31%  594 aa  NU5M_HIPAM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     9e-47  39%  740 aa  NU5C_PIPCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   66::451     9e-47  36%  710 aa  NU5C_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   76::431     1e-46  36%  600 aa  NU5M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   71::417     1e-46  32%  609 aa  NU5M_HALGR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     1e-46  34%  748 aa  NU5C_PLAOC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   71::433     2e-46  35%  609 aa  NU5M_PHOVI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     3e-46  36%  740 aa  NU5C_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     3e-46  35%  740 aa  NU5C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     3e-46  38%  750 aa  NU5C_TECST RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     3e-46  35%  740 aa  NU5C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   43::454     3e-46  31%  648 aa  NU5C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     3e-46  34%  757 aa  NU5C_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     3e-46  36%  739 aa  NU5C_COFAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     3e-46  36%  739 aa  NU5C_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     3e-46  36%  739 aa  NU5C_ACOAM RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     6e-46  36%  742 aa  NU5C_LACSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   63::405     7e-46  34%  633 aa  NUOL_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit L;    
   74::454     7e-46  36%  741 aa  NU5C_CICIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     1e-45  35%  748 aa  NU5C_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   45::425     2e-45  33%  606 aa  NU5M_SORFM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     2e-45  39%  741 aa  NU5C_BRADI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     2e-45  34%  741 aa  NU5C_ATHGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     2e-45  34%  743 aa  NU5C_AMBTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     2e-45  34%  744 aa  NU5C_ADEHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::431     3e-45  32%  606 aa  NU5M_PIG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
   64::420     3e-45  39%  656 aa  NU5M_CRYPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     3e-45  39%  740 aa  NU5C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     3e-45  35%  740 aa  NU5C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   58::464     3e-45  34%  745 aa  NU5C_GOSBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::425     4e-45  34%  606 aa  NU5M_CANLU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     4e-45  36%  744 aa  NU5C_GERJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   40::446     4e-45  34%  699 aa  NU5C_DIGGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   77::456     4e-45  32%  663 aa  NU5C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     4e-45  34%  749 aa  NU5C_ATRJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   51::420     5e-45  33%  654 aa  NU5M_RHIST RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     5e-45  34%  743 aa  NU5C_HELAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   62::406     6e-45  33%  666 aa  NU5M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     8e-45  34%  752 aa  NU5C_MANES RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   65::420     1e-44  34%  664 aa  NU5M_PHYIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   50::430     1e-44  36%  684 aa  NU5C_SESIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   67::440     1e-44  31%  653 aa  NUOL_RICPR RecName: Full=NADH-quinone oxidoreductase subunit L;    
   54::421     1e-44  34%  613 aa  NU5M_POLOR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     1e-44  34%  735 aa  NU5C_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     1e-44  34%  741 aa  NU5C_FLARA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::451     1e-44  34%  744 aa  NU5C_DAMDI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  100::411     2e-44  39%  641 aa  NU5M_ALLMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     2e-44  34%  741 aa  NU5C_GUIAB RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  109::454     2e-44  37%  741 aa  NU5C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   70::439     3e-44  34%  609 aa  NU5M_SCYCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::413     3e-44  33%  601 aa  NU5M_DASNO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     3e-44  34%  741 aa  NU5C_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::425     4e-44  33%  596 aa  NUOL_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit L;    
   68::438     4e-44  31%  606 aa  NU5M_RHIUN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::430     4e-44  32%  603 aa  NU5M_DUGDU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     4e-44  37%  741 aa  NU5C_LOLPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::455     4e-44  37%  739 aa  NU5C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::422     5e-44  30%  603 aa  NU5M_LEMCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   20::420     7e-44  31%  715 aa  NU5M_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   65::392     7e-44  31%  599 aa  NU5M_GEOPE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     9e-44  42%  739 aa  NU5C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   64::420     1e-43  31%  658 aa  NU5M_PENMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::455     1e-43  37%  747 aa  NU5C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   66::423     2e-43  35%  604 aa  NU5M_HORSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::425     2e-43  31%  606 aa  NU5M_BOSIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::452     2e-43  34%  742 aa  NU5C_LEMMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   66::446     2e-43  35%  695 aa  NU5C_CAPBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::425     2e-43  31%  606 aa  NU5M_SHEEP RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::425     2e-43  35%  606 aa  NU5M_EQUAS RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::425     2e-43  31%  606 aa  NU5M_BOVIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     2e-43  33%  746 aa  NU5C_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   64::420     3e-43  33%  652 aa  NU5M_PODAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::401     3e-43  32%  606 aa  NU5M_BALPH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::401     3e-43  32%  606 aa  NU5M_BALMU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   41::399     3e-43  35%  656 aa  NU5M_ASPNG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     3e-43  38%  741 aa  NU5C_CERDE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::425     4e-43  34%  606 aa  NU5M_CANFA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   40::446     4e-43  37%  702 aa  NU5C_POAPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     4e-43  34%  749 aa  NU5C_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     4e-43  38%  732 aa  NU5C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   67::440     8e-43  37%  653 aa  NUOL_RICTY RecName: Full=NADH-quinone oxidoreductase subunit L;    
   48::454     8e-43  37%  738 aa  NU5C_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::455     8e-43  37%  740 aa  NU5C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   67::440     1e-42  32%  657 aa  NUOL_RICCN RecName: Full=NADH-quinone oxidoreductase subunit L;    
   60::456     1e-42  34%  712 aa  NUOL_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit L;    
   62::403     1e-42  32%  614 aa  NUOL_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit L;    
   64::399     1e-42  36%  692 aa  NU5M_TRIRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   46::403     1e-42  31%  602 aa  NU5M_MACRO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::446     1e-42  34%  603 aa  NU5M_GORGO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::446     2e-42  30%  603 aa  NU5M_PANTR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::407     2e-42  33%  606 aa  NU5M_FELCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     2e-42  34%  743 aa  NU5C_CARTI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::407     2e-42  31%  606 aa  NU5M_CERSI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::438     3e-42  35%  603 aa  NU5M_MYOGL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::404     3e-42  34%  603 aa  NU5M_HYLLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   70::404     3e-42  30%  602 aa  NU5M_DIDMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   43::424     3e-42  38%  702 aa  NU5C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     3e-42  33%  707 aa  NU5C_MALAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::446     4e-42  33%  603 aa  NU5M_PANPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::456     4e-42  36%  760 aa  NU5C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     4e-42  34%  741 aa  NU5C_DAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   31::384     4e-42  38%  703 aa  NQO12_PARDE RecName: Full=NADH-quinone oxidoreductase chain 12;    
  109::448     5e-42  32%  686 aa  NU5M_SCHCO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     5e-42  37%  739 aa  NU5C_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::456     5e-42  36%  760 aa  NU5C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::455     5e-42  36%  772 aa  NU5C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::455     5e-42  36%  772 aa  NU5C_OENGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::455     5e-42  36%  777 aa  NU5C_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::455     5e-42  36%  772 aa  NU5C_OENBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::455     5e-42  36%  772 aa  NU5C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     5e-42  36%  738 aa  NU5C_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     5e-42  35%  751 aa  NU5C_FAGEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     5e-42  40%  734 aa  NU5C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::466     6e-42  38%  999 aa  PHAAB_RHIME RecName: Full=Probable K(+)/H(+) antiporter subunit
   68::425     8e-42  36%  605 aa  NU5M_ROUAM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     8e-42  35%  741 aa  NU5C_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     8e-42  34%  741 aa  NU5C_ASTCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     1e-41  33%  738 aa  NU5C_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     1e-41  34%  744 aa  NU5C_MUTAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   43::407     1e-41  32%  598 aa  NU5M_PETMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     2e-41  34%  670 aa  NU5C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::421     2e-41  37%  734 aa  NU5C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     2e-41  35%  743 aa  NU5C_CARCG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::414     2e-41  32%  610 aa  NU5M_RAT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
   74::454     2e-41  32%  709 aa  NU5C_PACAQ RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::451     2e-41  36%  741 aa  NU5C_ANIIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   75::399     3e-41  32%  653 aa  NU5M_TRIRU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   63::411     3e-41  34%  675 aa  NU5M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::457     4e-41  34%  746 aa  NU5C_AMBTC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::446     7e-41  31%  603 aa  NU5M_PAPHA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     7e-41  34%  772 aa  NU5C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   47::424     9e-41  35%  604 aa  NU5M_ORNAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::454     9e-41  35%  747 aa  NU5C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     9e-41  33%  746 aa  NU5C_CALFG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   43::440     9e-41  31%  801 aa  MRPA_BACSU RecName: Full=Na(+)/H(+) antiporter subunit A;AltName:
   65::439     1e-40  29%  674 aa  NUOL_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit L;    
   65::439     1e-40  29%  674 aa  NUOL_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit L;    
   71::419     4e-40  33%  610 aa  NU5M_SQUAC RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     4e-40  33%  741 aa  NU5C_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   67::417     5e-40  35%  612 aa  NU5M_CHIMO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     5e-40  33%  738 aa  NU5C_LIGVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::454     6e-40  38%  746 aa  NU5C_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::456     8e-40  36%  749 aa  NU5C_VITVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     1e-39  34%  750 aa  NU5C_SOYBN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   19::439     1e-39  31%  662 aa  NU5M_CRYNV RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::454     1e-39  36%  746 aa  NU5C_VICFA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     1e-39  36%  743 aa  NU5C_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     2e-39  41%  746 aa  NU5C_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   58::454     2e-39  34%  746 aa  NU5C_DIOEL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   67::395     2e-39  30%  601 aa  NU5M_MYXGL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   64::398     2e-39  36%  657 aa  NU5M_EMENI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   18::395     3e-39  40%  592 aa  NU5M_DEBHA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::454     3e-39  34%  744 aa  NU5C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     3e-39  33%  739 aa  NU5C_CHLSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   34::412     5e-39  36%  654 aa  NUOL_STRCO RecName: Full=NADH-quinone oxidoreductase subunit L;    
   33::438     7e-39  29%  607 aa  NU5M_CARAU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   60::447     7e-39  33%  800 aa  MNHA2_STAES RecName: Full=Putative antiporter subunit
   60::447     7e-39  33%  800 aa  MNHA2_STAEQ RecName: Full=Putative antiporter subunit
  110::454     9e-39  39%  746 aa  NU5C_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   98::400     1e-38  41%  674 aa  NU5M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::454     1e-38  40%  746 aa  NU5C_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   46::414     2e-38  30%  607 aa  NU5M_MOUSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     2e-38  35%  734 aa  NU5C_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     2e-38  35%  734 aa  NU5C_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     2e-38  35%  734 aa  NU5C_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     2e-38  35%  734 aa  NU5C_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     3e-38  35%  744 aa  NU5C_CICAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   71::428     4e-38  35%  606 aa  NU5M_LOXAF RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   66::411     4e-38  29%  590 aa  NU5M_DINSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   76::465     7e-38  29%  638 aa  NU5M_PARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   33::416     1e-37  27%  607 aa  NU5M_CYPCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   92::446     1e-37  40%  603 aa  NU5M_PONPY RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   72::414     2e-37  28%  611 aa  NU5M_LATCH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   59::397     2e-37  33%  605 aa  NU5M_STRCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::454     3e-37  39%  746 aa  NU5C_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  109::454     4e-37  35%  692 aa  NU5C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     4e-37  39%  746 aa  NU5C_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     4e-37  40%  746 aa  NU5C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   68::409     6e-37  32%  621 aa  NUOL_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit L;    
   73::409     6e-37  28%  612 aa  NU5M_ONCMY RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   58::446     6e-37  32%  603 aa  NU5M_HUMAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::454     6e-37  38%  746 aa  NU5C_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     6e-37  41%  746 aa  NU5C_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   73::461     6e-37  32%  655 aa  NU5C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::454     8e-37  40%  741 aa  NU5C_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   92::446     1e-36  39%  603 aa  NU5M_PONAB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   80::420     1e-36  28%  612 aa  NU5M_GADMO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   70::415     1e-36  32%  604 aa  NU5M_XENLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   53::417     1e-36  32%  798 aa  MNHA2_STAS1 RecName: Full=Putative antiporter subunit
   69::396     2e-36  29%  605 aa  NU5M_CHICK RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   63::413     2e-36  32%  612 aa  NU5M_TETNG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     3e-36  37%  754 aa  NU5C_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   90::454     5e-36  38%  740 aa  NU5C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   43::416     5e-36  33%  801 aa  MNHA1_STAES RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   43::416     5e-36  33%  801 aa  MNHA1_STAEQ RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   66::156     7e-36  36%  642 aa  NUOL_RICBR RecName: Full=NADH-quinone oxidoreductase subunit L;    
  109::454     7e-36  37%  729 aa  NU5C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     9e-36  32%  739 aa  NU5C_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   44::420     1e-35  28%  612 aa  NU5M_CROLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   65::391     1e-35  31%  546 aa  NU5M_CHLRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   73::409     2e-35  27%  612 aa  NU5M_SALSA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   75::424     2e-35  36%  652 aa  NU5C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   45::443     2e-35  31%  805 aa  MRPA_BACPF RecName: Full=Na(+)/H(+) antiporter subunit A;AltName:
   68::416     2e-35  34%  805 aa  MNHA1_STAS1 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   95::428     3e-35  36%  606 aa  NU5M_ELEMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   48::454     3e-35  35%  739 aa  NU5C_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     6e-35  35%  738 aa  NU5C_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   48::454     6e-35  35%  738 aa  NU5C_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   92::425     1e-34  36%  603 aa  NU5M_MAMPR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   46::417     1e-34  29%  800 aa  MNHA2_STAHJ RecName: Full=Putative antiporter subunit
   74::445     5e-34  29%  745 aa  NU5C_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   61::385     6e-34  28%  598 aa  NU5M_BRALA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::454     1e-33  39%  740 aa  NU5C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   67::415     1e-33  27%  606 aa  NU5M_DANRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   77::423     2e-33  28%  605 aa  NU5M_PELSU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   61::386     2e-33  28%  599 aa  NU5M_BRAFL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   41::424     9e-33  33%  803 aa  MNHA1_STAHJ RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  102::438     1e-32  35%  644 aa  NU5M_PICCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::424     2e-32  36%  750 aa  NU5C_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   60::447     2e-32  27%  800 aa  MNHA2_STAAR RecName: Full=Putative antiporter subunit
  100::456     2e-32  34%  637 aa  NU5M_STRPU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   99::400     6e-32  34%  655 aa  NU5M_YARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   94::447     1e-31  30%  800 aa  MNHA2_STAAN RecName: Full=Putative antiporter subunit
   94::447     1e-31  30%  800 aa  MNHA2_STAAM RecName: Full=Putative antiporter subunit
   94::447     1e-31  30%  800 aa  MNHA2_STAA9 RecName: Full=Putative antiporter subunit
   94::447     1e-31  30%  800 aa  MNHA2_STAA2 RecName: Full=Putative antiporter subunit
   94::447     1e-31  30%  800 aa  MNHA2_STAA1 RecName: Full=Putative antiporter subunit
   94::447     2e-31  30%  800 aa  MNHA2_STAAW RecName: Full=Putative antiporter subunit
   94::447     2e-31  30%  800 aa  MNHA2_STAAU RecName: Full=Putative antiporter subunit
   94::447     2e-31  30%  800 aa  MNHA2_STAAT RecName: Full=Putative antiporter subunit
   94::447     2e-31  30%  800 aa  MNHA2_STAAS RecName: Full=Putative antiporter subunit
   94::447     2e-31  30%  800 aa  MNHA2_STAAE RecName: Full=Putative antiporter subunit
   94::447     2e-31  30%  800 aa  MNHA2_STAAC RecName: Full=Putative antiporter subunit
   94::447     2e-31  30%  800 aa  MNHA2_STAA8 RecName: Full=Putative antiporter subunit
   94::447     2e-31  30%  800 aa  MNHA2_STAA3 RecName: Full=Putative antiporter subunit
   97::419     1e-30  34%  801 aa  MNHA1_STAAR RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAAW RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAAU RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAAT RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAAS RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAAN RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAAM RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAAE RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAAC RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAA9 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAA8 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAA3 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAA2 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   97::419     2e-30  34%  801 aa  MNHA1_STAA1 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   66::450     3e-30  31%  615 aa  NUOL_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit L;    
   94::447     3e-30  29%  800 aa  MNHA2_STAAB RecName: Full=Putative antiporter subunit
   97::419     3e-30  34%  801 aa  MNHA1_STAAB RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  193::385     6e-30  44%  574 aa  NU5M_LUMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   18::127     7e-30  33%  552 aa  NU5M_CANAL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   20::128     8e-29  32%  555 aa  NU5M_CANPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  167::424     8e-29  39%  643 aa  NU5M_ASTPE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   57::419     9e-28  33%  479 aa  HYFD_ECOLI RecName: Full=Hydrogenase-4 component D;       
   16::359     3e-27  32%  545 aa  NU5M_ALBCO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  191::363     2e-26  36%  572 aa  NU5M_DROME RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  191::363     2e-26  36%  573 aa  NU5M_DROYA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
    2::122     5e-26  47%  124 aa  NU5C_PEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
 1320::1644    3e-24  25% 1849 aa  NU5H_NYCOV RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
  185::357     2e-23  44%  552 aa  NU5M_RHISA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   61::379     2e-23  32%  541 aa  NU5M_ARTSF RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::379     3e-23  32%  568 aa  NU5M_MYTED RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  178::317     1e-22  37%  547 aa  NU5M_ASCSU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  197::369     1e-21  35%  580 aa  NU5M_AEDAE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   27::363     1e-21  32%  572 aa  NU5M_LOCMI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  241::385     2e-21  33%  618 aa  NU5C2_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  233::424     6e-21  39%  570 aa  NU5M_PARTE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
    6::180     2e-20  35%  183 aa  NU5M_PEA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
  197::373     2e-20  33%  580 aa  NU5M_ANOGA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  197::373     2e-20  33%  384 aa  NU5M_ANOAR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  193::365     3e-19  33%  576 aa  NU5M_ANOQU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  187::358     1e-15  29%  554 aa  NU5M_APILI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  219::399     7e-15  30%  493 aa  MRPD_BACPF RecName: Full=Na(+)/H(+) antiporter subunit D;AltName:
  236::385     4e-14  32%  509 aa  NUOM_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit M;    
   45::275     1e-13  32%  640 aa  Y051_MYCTU RecName: Full=Uncharacterized protein Rv0083/MT0090;
  226::399     2e-13  27%  491 aa  NUOM_RICPR RecName: Full=NADH-quinone oxidoreductase subunit M;    
  177::316     4e-13  32%  527 aa  NU5M_CAEEL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  225::444     4e-13  29%  672 aa  HYFB_ECOLI RecName: Full=Hydrogenase-4 component B;       
  234::448     6e-13  29%  509 aa  NUOM_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit M;    
  234::448     6e-13  29%  509 aa  NUOM_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit M;    
  237::430     1e-12  26%  494 aa  NUOM_RICBR RecName: Full=NADH-quinone oxidoreductase subunit M;    
  197::265     1e-12  49%  265 aa  NU5M_ANOQN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  232::430     2e-12  25%  493 aa  NUOM_RICFE RecName: Full=NADH-quinone oxidoreductase subunit M;    
  232::432     3e-12  28%  513 aa  NQO13_PARDE RecName: Full=NADH-quinone oxidoreductase chain 13;    
   70::389     3e-12  24%  493 aa  MRPD_BACSU RecName: Full=Na(+)/H(+) antiporter subunit D;AltName:
  223::357     9e-12  29%  590 aa  NU5M_TRYBB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  232::376     3e-11  27%  493 aa  NUOM_RICCN RecName: Full=NADH-quinone oxidoreductase subunit M;    
  233::434     5e-11  25%  512 aa  NUOM_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit M;    
  222::421     5e-11  28%  501 aa  MNHD2_STAS1 RecName: Full=Putative antiporter subunit
  212::366     5e-11  41%  608 aa  HYCC_ECOLI RecName: Full=Formate hydrogenlyase subunit 3;       
  223::401     6e-11  25%  498 aa  MNHD1_STAES RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::401     6e-11  25%  498 aa  MNHD1_STAEQ RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  229::402     8e-11  24%  494 aa  NUOM_RICTY RecName: Full=NADH-quinone oxidoreductase subunit M;    
  245::440     1e-10  27%  535 aa  NU4C2_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  221::420     1e-10  29%  498 aa  MNHD2_STAAR RecName: Full=Putative antiporter subunit
  221::420     2e-10  23%  499 aa  MNHD2_STAHJ RecName: Full=Putative antiporter subunit
  223::396     2e-10  25%  498 aa  MNHD1_STAAW RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAU RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAT RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAS RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAR RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAN RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAM RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAE RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAC RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAAB RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAA9 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAA8 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAA3 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAA2 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  223::396     2e-10  25%  498 aa  MNHD1_STAA1 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
  221::420     3e-10  29%  498 aa  MNHD2_STAAW RecName: Full=Putative antiporter subunit
  222::421     3e-10  29%  499 aa  MNHD2_STAAU RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAAT RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAAS RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAAN RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAAM RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAAE RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAAC RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAAB RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAA9 RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAA8 RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAA3 RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAA2 RecName: Full=Putative antiporter subunit
  221::420     3e-10  29%  498 aa  MNHD2_STAA1 RecName: Full=Putative antiporter subunit
  245::440     4e-10  27%  534 aa  NU4C2_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
   96::375     7e-10  29%  495 aa  NU4M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  229::425     1e-09  24%  525 aa  NU4C2_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-2;
  229::425     1e-09  24%  525 aa  NU4C1_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  231::427     1e-09  26%  534 aa  NU4C_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  140::425     2e-09  31%  492 aa  NU4M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
   38::447     3e-09  24%  485 aa  NUON_ERWT9 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  147::375     3e-09  31%  495 aa  NU4M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  225::425     3e-09  26%  550 aa  NU4C3_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 3;
  224::424     3e-09  26%  560 aa  NU4C3_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-3;
  231::427     3e-09  31%  534 aa  NU4C2_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  231::427     3e-09  31%  534 aa  NU4C2_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  225::425     3e-09  26%  561 aa  NU4C2_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  254::423     4e-09  28%  544 aa  NU4C_SYNR3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  249::445     6e-09  26%  546 aa  NU4C_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  226::426     6e-09  24%  553 aa  NU4C2_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
   65::337     6e-09  29%  505 aa  NDHF_BACSU RecName: Full=Probable NADH-quinone oxidoreductase
  221::420     6e-09  33%  500 aa  MNHD2_STAES RecName: Full=Putative antiporter subunit
  220::419     6e-09  33%  499 aa  MNHD2_STAEQ RecName: Full=Putative antiporter subunit
  227::375     7e-09  28%  495 aa  NU4M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  136::371     7e-09  34%  525 aa  NU2C_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  249::445     9e-09  26%  546 aa  NU4C_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  250::419     9e-09  27%  558 aa  NU4C_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  250::419     1e-08  28%  563 aa  NU4C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  250::419     1e-08  27%  557 aa  NU4C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  224::424     1e-08  26%  559 aa  NU4C2_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-2;
  230::425     1e-08  24%  526 aa  NU4C2_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  250::419     2e-08  28%  558 aa  NU4C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  242::411     2e-08  27%  546 aa  NU4C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  237::433     2e-08  27%  538 aa  NU4C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  237::433     2e-08  27%  538 aa  NU4C_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  229::398     2e-08  27%  529 aa  NU4C1_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  230::399     2e-08  27%  533 aa  NU4C_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  237::433     2e-08  26%  534 aa  NU4C_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  250::419     2e-08  28%  563 aa  NU4C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  237::433     2e-08  26%  534 aa  NU4C_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  234::430     2e-08  26%  531 aa  NU4C_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  229::397     2e-08  27%  526 aa  NU4C1_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  174::406     3e-08  23%  523 aa  NU4M_PROWI RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  229::424     3e-08  24%  527 aa  NU4C1_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  229::397     3e-08  27%  528 aa  NU4C1_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  231::411     5e-08  24%  481 aa  Y1309_METJA RecName: Full=Uncharacterized protein MJ1309;
  147::375     5e-08  31%  495 aa  NU4M_BRACM RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  242::411     5e-08  27%  548 aa  NU4C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  250::419     5e-08  27%  551 aa  NU4C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  237::433     5e-08  25%  534 aa  NU4C_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  226::394     5e-08  27%  526 aa  NU4C_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
   45::311     6e-08  26%  521 aa  NU2C_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
   45::311     6e-08  26%  521 aa  NU2C_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  105::305     8e-08  25%  479 aa  NUON2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit N 2; 
  224::397     8e-08  26%  501 aa  NU4C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  226::399     8e-08  28%  500 aa  NU2C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  229::424     1e-07  31%  533 aa  NU4C2_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  224::459     1e-07  24%  500 aa  NU4C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  226::426     1e-07  24%  561 aa  NU4C2_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  228::396     1e-07  25%  525 aa  NU4C1_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-1;
  225::424     2e-07  28%  533 aa  NU4C1_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  225::424     2e-07  28%  533 aa  NU4C1_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  238::411     2e-07  28%  513 aa  NU2C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  230::398     3e-07  24%  537 aa  NU4C3_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 3;
  231::399     3e-07  24%  538 aa  NU4C1_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  227::400     3e-07  36%  514 aa  NU2C_CYAP7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  262::464     4e-07  23%  553 aa  NUOM_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit M;    
   46::367     4e-07  28%  521 aa  NU2C_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  269::438     5e-07  26%  531 aa  NUON_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit N;    
  269::438     5e-07  26%  531 aa  NUON_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit N;    
  230::454     5e-07  31%  534 aa  NU4C1_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  141::319     5e-07  27%  506 aa  NU2C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  217::345     7e-07  32%  460 aa  NU4M_ASTPE RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  224::397     9e-07  34%  512 aa  NU4C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  228::397     9e-07  24%  499 aa  NU4C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  226::314     2e-06  37%  501 aa  NU2C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
   70::383     2e-06  21%  526 aa  HYFF_ECOLI RecName: Full=Hydrogenase-4 component F;       
  143::375     2e-06  22%  491 aa  NU4M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  148::322     2e-06  34%  520 aa  NU2C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  227::400     3e-06  38%  526 aa  NU2C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  226::314     3e-06  37%  501 aa  NU2C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  229::397     3e-06  24%  501 aa  NU4C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     3e-06  24%  503 aa  NU4C_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  237::325     3e-06  42%  523 aa  NU2C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  237::325     3e-06  42%  523 aa  NU2C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  227::400     3e-06  36%  517 aa  NU2C_CYAP8 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  217::438     4e-06  26%  486 aa  NUON_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit N;    
  237::380     4e-06  26%  497 aa  NU4M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  228::371     4e-06  35%  526 aa  NU2C_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  226::399     4e-06  33%  496 aa  NU2C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
   62::400     7e-06  33%  513 aa  NU2C_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  217::345     1e-05  28%  463 aa  NU4M_STRPU RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  230::425     1e-05  23%  497 aa  NU4C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  237::325     1e-05  40%  523 aa  NU2C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  237::325     1e-05  42%  523 aa  NU2C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  137::312     1e-05  34%  512 aa  NU2C_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  223::396     1e-05  23%  512 aa  NU4C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  237::325     1e-05  40%  523 aa  NU2C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  237::325     1e-05  40%  523 aa  NU2C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  227::370     1e-05  31%  521 aa  NU2C_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  226::399     1e-05  28%  511 aa  NU2C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  215::292     2e-05  30%  458 aa  NU4M_MYXGL RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  223::396     2e-05  21%  507 aa  NU4C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  223::396     2e-05  21%  499 aa  MNHD1_STAHJ RecName: Full=Na+/H+-antiporter, MnhD subunit;
  229::408     2e-05  22%  499 aa  NU4C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  237::325     2e-05  39%  524 aa  NU2C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  226::314     3e-05  38%  498 aa  NU2C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  224::397     4e-05  23%  500 aa  NU4C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  240::436     4e-05  26%  499 aa  NU2M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 2;   
  217::419     4e-05  20%  499 aa  NQO14_PARDE RecName: Full=NADH-quinone oxidoreductase chain 14;    
  216::303     5e-05  29%  478 aa  NUON_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit N;    
  229::397     5e-05  24%  497 aa  NU4C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  230::312     5e-05  32%  527 aa  NU4C1_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  137::401     5e-05  29%  496 aa  NU2C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  226::369     5e-05  30%  502 aa  NU2C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  224::418     6e-05  23%  500 aa  NU4C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::418     6e-05  23%  500 aa  NU4C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  218::357     8e-05  27%  464 aa  NU4M_PARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  231::370     1e-04  25%  502 aa  NU4C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     1e-04  22%  500 aa  NU4C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     1e-04  22%  497 aa  NU4C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::398     1e-04  27%  501 aa  NU4C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  222::415     1e-04  26%  497 aa  NU2C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  135::399     1e-04  31%  494 aa  NU2C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  210::296     2e-04  29%  458 aa  NUON_RICTY RecName: Full=NADH-quinone oxidoreductase subunit N;    
  134::420     2e-04  22%  484 aa  NU4M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  228::372     2e-04  33%  498 aa  NU4C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::313     2e-04  30%  488 aa  NU2M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 2;   
  241::386     3e-04  21%  508 aa  NUOM_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit M;    
  278::383     3e-04  25%  501 aa  NUOM_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit M;    
  224::397     3e-04  29%  500 aa  NU4C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     3e-04  29%  500 aa  NU4C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     3e-04  21%  503 aa  NU4C_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  225::371     3e-04  27%  500 aa  NU2C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  224::311     4e-04  29%  500 aa  NU4C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     4e-04  22%  500 aa  NU4C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  228::397     5e-04  29%  500 aa  NU4C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  228::397     5e-04  29%  516 aa  NU4C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     5e-04  21%  500 aa  NU4C_MANES RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::418     5e-04  35%  500 aa  NU4C_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::418     5e-04  22%  500 aa  NU4C_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     5e-04  21%  500 aa  NU4C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  102::220     5e-04  23%  335 aa  NU2M_LUMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 2;   
  210::296     7e-04  27%  458 aa  NUON_RICPR RecName: Full=NADH-quinone oxidoreductase subunit N;    
  237::434     7e-04  20%  505 aa  NUOM_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit M;    
  224::397     7e-04  28%  500 aa  NU4C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  228::397     7e-04  30%  500 aa  NU4C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  228::401     7e-04  24%  500 aa  NU4C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  228::397     7e-04  21%  493 aa  NU4C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  225::398     0.001  21%  501 aa  NU4C_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::397     0.001  22%  500 aa  NU4C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  259::347     0.001  37%  583 aa  NU2M_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase chain 2;   
    1::548

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPGRGSGLAVGGIFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYS
NU5C_SYNP2      -------------------------------LEWAAAGDFHLQMGYTVDHLSALMSVIVTTVALLVMIYT
NU5C1_PAUCH     ---------------------------SEVLFSWASAGTFNLEMGYRVDPIGATMLALVSTVAILVMVYS
NU5M_OENBE      ---------------------------------WISSEMFDASWGFVFDSLTVVMLIVVTFISSLVHLYS
NU5C_SYNY3      -------------------------------IEWASAGSFHLEMGYVIDHLSALMLVIVTSVALLVMIYT
NU5M_WHEAT      ---------------------------------WISSEMFDASWGFLFDSLTVVMLIVVTFISSLVHLYS
NUOL_RICFE      -------IATGFLSLSALFSLVIAGLDGNIILPWIEVGNFKVNWSIYIDQLTSIMFIAVTWVSSVVHIYS
NQO12_THET8     ---------------------------------WLPGIPF----SLLLDNLSGFMLLIVTGVGFLIHVYA
NU5M_ARATH      ---------------------------------WISSEMFDASWGFLFDSLTVVMLIVVTSISSLVHLYS
NU5C_PHYPA      --------------------------------SWIFDNKIDFKIGFLIDPLTSIMLVLITTVGVLVMIYS
NU5M_MARPO      -------------------------------------------------------------------IYS
NU5C_SPIOL      -------LSIVMIFSMKLAIQQISNSIYQYLWSWTINNDFSLEFGYLMDPLTSIMSMLITTVAILVLIYS
NUOL_PSEAE      -------VGVGSVGLSALSAAPEGGAYSLVLWQWMAAGDFSTNFTLYLDGLSVTMLGVVTGVGFLIHLFA
NU5M_DICDI      --------------------------------TWMQVGSLNVEYGLLYDSLTSIMIIVITCISSMVHLYS
NUOL_ECOLI      --------------------------------TWMSVGDFNIGFNLVLDGLSLTMLSVVTGVGFLIHMYA
NU5M_RABIT      ---------------------------------WMTIHTLKLTTSFKLDYFSMLFTPIALFVTWSIMEFS
NU5M_DICCI      -------IAVGCMMLTALSSLYIG---YEILLTWMQVGSLNVEYGLLYDSLTSIMIIVITCISSMVHLYS
NU5C_CHAGL      ---------------------------------WLSTKNLTLDIGYLIDPLTSIMLVLVTSVAVTVMIYS
NU5C_SOLTU      -------LSIVMIFSIYLSIQQINSSSVQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_SOLLC      -------LSIVMIFSIYLSIQQINSSSVQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_SOLBU      -------LSIVMIFSIYLSIQQINSSSVQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYS
NU5M_HIPAM      --------------ISLVPMIAFTNTGQEMIISWITIQTLKLTLSFKADYFSIVFAPVALFVTWSIMEFS
NU5C_PIPCE      --------------------------------SWTINNDFSLEFGYLIDSLTSIMLILITTVGIMVLIYS
NU5C_IPOPU      ------------------------GSIYQYVWSWIINNDFSLEFGYLIDPLTSIMSILVTTVGILVLIYS
NU5M_METSE      ---------------------------------------------LQFDSLTAVMLIVVTSISTLVHIFS
NU5M_HALGR      ---------------------------------WMTIQTMKLTLSFKLDHFSMIFVPVALFVTWSIMEFS
NU5C_PLAOC      -------LSIVMIFSADLSIQQLNGSSIQYVWSWTINNDFSLEFGYLIDPLTSIMSILITTVGIMVLVYS
NU5M_PHOVI      ---------------------------------WMTIQTMKLTLSFKLDHFSMIFVPVALFVTWSIMEFS
NU5C_ATRBE      --------------------------------SWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_TOBAC      --------------------------------SWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_TECST      -------LSIVMIFATNLSIQQINTSSIQYVWSWTLDNDFSLEFGYLIDPLTSIMSMLITTVGIMVLIYS
NU5C_NICSY      --------------------------------SWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_NEPOL      -------LAIGAMFVVSLGVLQLHGAPVRWIIEWMLTDTFRLEIGYWVDPXXXXXXXXXXXXXXXXXIYS
NU5C_DRIGR      -------LSIVMVFSADLSVQQIDGSSIYQYLSWTINNDFSLEFGHLIDPLTSIMSILITTVGIMVLIYS
NU5C_COFAR      --------------------------------SWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_ACOCL      -------LSIAMVFSADLAIQQINGSFIQYSWSWTINNTFSLEFGYLIDPLTSIMLILITTVGIMVLIYS
NU5C_ACOAM      -------LSIAMVFSADLAIQQINGSFIQYSWSWTINNTFSLEFGYLIDPLTSIMLILITTVGIMVLIYS
NU5C_LACSA      --------------------------------SWIINNDFSLEFGYLIDPLTSIMLILITTVGIMVLIYS
NUOL_MYCTU      ----------------------LERAIHQQVFTWIPAGGLQVDFGLQIDQLSMCFVLLISGVGSLIHIYS
NU5C_CICIN      --------------------------------SWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_CUCSA      --------------------------------SWTINNDFSLELGYFIDPLTCIMAILITTVGIMVLIYS
NU5M_SORFM      -------------FTSLIPTLIFINSGHEAILSWMTIQTVKLSLNFKLDYFSMIFTPVALFVTWSIMEFS
NU5C_BRADI      -------LSIAMVFSVQLSIQQINGSSIYQYLSWTINNDFSLEFGYLIDPLTSIMLMLITTVGILVLIYS
NU5C_ATHGR      -------LSIVMIFSMNLSIQQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_AMBTR      -------LSIVMIFSMNLSIQQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_ADEHI      -------LSIVMIFSMNLSIQQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5M_PIG        ---------------------------------WMTLQTVELSLSFKMDYFSVMFIPVALFVTWSIMEFS
NU5M_CRYPA      ---------------------------------WIDSEWFNIIWGFQFDSLTVSMLLPVLIISSLVHIYS
NU5C_PSINU      --------------------------------SWIPHKNIPLEVGFFIDPLTSIMLILVTTVGVLVMIYS
NU5C_NICTO      --------------------------------SWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_GOSBA      -------LSIVMIFSLDLSIQQINGSSIQYVWSWTINNDFSFEFGYFIDSLTSIMSILITTVGIFVLIYS
NU5M_CANLU      ---------------------------------WMTIQTMKLSMSFKLDYFSMIFVPVALFVTWSIMEFS
NU5C_GERJA      --------------------------------SWIINNDFSLELGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_DIGGR      -------LSIVMIFSTNLSIQQISNSIYQYVWSWTLDNDFSLELGCLIDPLTSIMSMLITIVGITVLIYS
NU5C_CHAVU      ---------------------------------WIVNDNISLKLGFFIDPLSSLMLFLVTSVAVLVMSYS
NU5C_ATRJA      -------LSIVMIFSMNLSIQQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMLILITTVGIMVLIYS
NU5M_RHIST      -----------GLCGSPVSIKLMSWIDSEFLLVSWGFIYDSLTVS---------MLLPVLIVSALVHIYS
NU5C_HELAN      -------LSIVMIFSLNLSIQQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5M_CHOCR      -------------------------------VSWIKSGAFYVSWGFLFDXXXXXXXXXXXXXXXXXHIYS
NU5C_MANES      --------------------------------SWTINNDFSLEFGHLIDPLTSILSVLITTVGILVLFYS
NU5M_PHYIN      ---------------------------------WINSGLFNCNWCFLFDSLTMIMLVVVTSISTLVHLYS
NU5C_SESIN      --------------------------------SWTXDNDFSLEFGYLIDPLTSIMSMLXTTVGIMVLIYS
NUOL_RICPR      -------------------------------LPWIEFKNLQVNWSIYIDQLTSIMFIAVTFVSSVVHIYS
NU5M_POLOR      --------------IPSITCLNLNLQSFTIYYQWFSISSTKINISLQFDQYSMIFMTIALYVTWSILEFA
NU5C_GOSHI      -------LSIVMIFSLDLSIQQINGSSIQYVWSWTINNDFSFEFGYFIDSLTSIMSILITTVGIFVLIYS
NU5C_FLARA      -------LSIVMIFSMNLSIQQINSSSVQYVWSWIINNDISLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_DAMDI      -------LSIVMIFSMNLSIQQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLSYS
NU5M_ALLMA      -------------------------------------------------------------------LYS
NU5C_GUIAB      -------LSIVMIFSMNLSIQQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_CRYJA      -------------------------------------------------------------------IYS
NU5M_SCYCA      ---------------------------------WMNMGPFNINMSFKFDLYSIMFTPVALYVTWSILEFA
NU5M_DASNO      ---------------------------------WMTMQTMKLSLSFKLDFFSIIFVSVALFVTWSIMEFS
NU5C_LIRTU      -------LSIVMVFSADLSIQQINGSSIQYLCSWTINNDFSLEFGHLIDPLTSIMSILITTVGIMVLIYS
NUOL_CAMJE      ------------------------------------------------DAISLTMMSVVGIVATCVHFYS
NU5M_RHIUN      ---------------------------------WMTTQTLKLSLSFKLDYFSMIFVPVALFVTWSIMEFS
NU5M_DUGDU      ---------------------------------WMTIHTLKLSLSFKLDYFSLIFMPVALFVTWSIMEFS
NU5C_LOLPR      -------LSIAMVFSIQLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5C_HORVU      -------LSIAMVFSVQLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5M_LEMCA      ---------------------------------WMTIQTLKLSISFKLDYFSMLFMPVALFVTWSIMEFS
NU5M_NEUCR      --GRKVGVS-GAQLITCLSVIITTGL---AILAFFEVGFNNIPVTINLFRWGFQFDSLTVAMLIPVLIYS
NU5M_GEOPE      ---------------------------------WLTVHTIELKMSFKLDLYSITFMPVALYVTWSIMEYS
NU5C_CYCTA      --------------------------------SWTINKNFSPELGYLIDPLTSIMPISVTTVGIMVMIYS
NU5M_PENMA      ---------------------------------WIDAEALNVMWSFKFDSLTVSMLIPVLIVSSLVHIYS
NU5C_NYMAL      -------LSIVMVFSTKLAIQQINGSSIEYLWSWSITSDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5M_HORSE      ---------------------------------WMTMQTLKLSLSFKLDYFSMIFVPVALFVTWSIMEFS
NU5M_BOSIN      ---------------------------------WLTIQTLKLSLSFKMDYFSMMFTPVALFVTWSIMEFS
NU5C_LEMMI      -------LSIGLIFSANLAFQQINGSFIYQYLSWTINNDFSLEFGYFIDPLTSVMLILITTVGIMVLIYS
NU5C_CAPBA      --------------------------------SWIINNDFSLDFGYLIDPLTSIMXXLITTVGIMVLIYS
NU5M_SHEEP      ---------------------------------WLTIQTLKLSLSFKMDFFSMMFVPVALFVTWSIMEFS
NU5M_EQUAS      ---------------------------------WMTIQTLKLSLSFKLDYFSMIFVPVALFVTWSIMEFS
NU5M_BOVIN      ---------------------------------WLTIQTLKLSLSFKMDYFSMMFIPVALFVTWSIMEFS
NU5C_CARPA      -------LSIVMIFSIDLSIQQITGSSAQYVWSWTINNEFSFEFGNLIDPLTSIMSXXXXXXXXXXXXYS
NU5M_PODAN      ---------------------------------WIDSEWFNIIWGFQFDSLTVSMLIPVLIISSLVHIYS
NU5M_BALPH      ---------------------------------WITIQTLKLTLSFKMDYFSLMFMPVALFITWSIMEFS
NU5M_BALMU      ---------------------------------WITIQTLKLTLSFKMDYFSLMFMPVALFITWSIMEFS
NU5M_ASPNG      -------------FLAILAFFEVGFNNIPVTINWVDVESLYVLWNFRFDSLTVSMFITVLIVSSLVHIYS
NU5C_CERDE      -------LSIGMLLSVELAIQQINQSSVYKYLSWTINNDFSLEFGYLIDPLTSIMSXXXXXXXXXXXXYS
NU5M_CANFA      ---------------------------------WMTIQTMKLSMSFKLNYFSMIFVPVALFVTWSIMEFS
NU5C_POAPR      -------LSIAIVYSVHLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5C_ILLOL      --------------------------------SWTINSDFSLELGCLIDPLTSIMLILITTVGIMVLIYS
NU5C_ANTFO      --------------------------------SWISNGDIVLEFGYLIDPLTCIMLVLVTSVAIIVMIYS
NUOL_RICTY      -------------------------------LPWIEFRNFKVNWSIYIDQLTSIMFIVVTFVSSVVHIYS
NU5C_SORBI      -------LSIAMVFSLHLSIQQINGSSIYQYLSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXXXXYS
NU5C_NUPAD      -------LSIVMVFSTKLAIQQINGSSIEYLWSWSITSDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NUOL_RICCN      -------------------------------LPWIEVGTFKVNWSIYIDQLTSIMFIAVTWVSSIVHIYS
NUOL_RHOCA      -------------------------------LDWIRSGALDTSWGIRLDRLTAIMLIVVTTVSALVHLYS
NUOL_BUCAI      ----------------------------QILWKWLSINEFKIDFGFFLDGLSLSMLFVITGVGLLIHIFS
NU5M_TRIRE      ---------------------------------WLDSESFNMVWNFQFDSLTVSMLIPVLVISSLVHFYS
NU5M_MACRO      -------------FTSLPALLLFINTGQESTITWFSIESLNMTMSFKLDYFSIIFIPIALYVTWSILEFS
NU5M_GORGO      ---------------------------------WATTQTIQLSLSFKLDYFSMMFIPVALFVTWSIMEFS
NU5M_PANTR      ---------------------------------WATTQTTQLSLSFKLDYFSMTFIPVALFVTWSIMEFS
NU5M_FELCA      ---------------------------------WLSIQTLKLSLSFKMDYFSTIFIPVALFVTWSIMEFS
NU5C_CARTI      -------LSIVMIFSMNLSIHQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMSXXXXXXXXXXXXYS
NU5M_CERSI      ---------------------------------WMTIQTLKLSLSFKLDYFSMIFVPVALFVTWSIMEFS
NU5M_MYOGL      ---------------------------------WMTIQTLNLTXXXXXXXXXXXXVPVALFVTWSIMEFS
NU5M_HYLLA      ---------------------------------WTATQTLELSLSFKLDYFSMMFIPIALFVTWSIMEFS
NU5M_DIDMA      ---------------------------------WFSIHSFNISMSFKMDFFSIIFIPIALFVTWAILEFS
NU5C_ZYGCR      -------LSIGALLVTMLLSITISDSAYRQLVSWIKVDNLFLEIGCLVDPLSAIMXXXXXXXXXXXMIYT
NU5C_MALAR      -------LSIVMIFSIDLSIQQINGSYIQYVWSWTINNDFSFEFGYFIDSLTSIMSILITTVGIFVLIYS
NU5M_PANPA      ---------------------------------WATTQTTQLSLSFKLDYFSMTFIPVALFVTWAIMEFS
NU5C_POPAL      --------------------------------------------------------------------YS
NU5C_DAUCA      -------LSIVMLFSINLSIQQINGSSIQYVWSWIINNDFSLEFGYLIDPXXXXXXXXXXXXXXXVLIYS
NQO12_PARDE     -------LTTGVLFLSCLIFLSFDGVPRHIVLDWVVTGDFHAEWAIRLDRLTAIMLIVVTTVSALVHMYS
NU5M_SCHCO      ----------------------------------------------------------VLFISFLIHLFS
NU5C_WHEAT      -------LSIAMVFSVQLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5C_POPTR      --------------------------------------------------------------------YS
NU5C_OENPA      --------------------------------------------------------------------YS
NU5C_OENGL      --------------------------------------------------------------------YS
NU5C_OENEH      --------------------------------------------------------------------YS
NU5C_OENBI      --------------------------------------------------------------------YS
NU5C_OENAR      --------------------------------------------------------------------YS
NU5C_MAIZE      -------LSIAMVFSLHLSIQQINGSSIYQYLSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXXXXYS
NU5C_FAGEA      --------------------------------SWTINNDFSLEFGYLVDPLTSIMSMLITTVGILVLIYS
NU5C_EUCGG      --------------------------------------------------------------------YS
PHAAB_RHIME     -----------------------SGGVLHYRIDW--VPELGLNFTLRMDGFAWLFSALITAIGVLVALYA
NU5M_ROUAM      ---------------------------------WMTIQTLKLSLSFKLDYFSMILMPVALSVTWSIMEFS
NU5C_PANGI      --------------------------------SWIINNDFSLEFGYLIDPLTSIMSXXXXXXXXXXXXYS
NU5C_ASTCO      -------LSIVMIFSMNLSIQQINSSSVQYVWSWIINNDFSLEFGYLIDPLTSIMSXXXXXXXXXXXXYS
NU5C_RANMC      -------LSIIMIFSVILSIKQIDGNPIQYVWSWTINNDFSLDFGNFIDPLTSIMLILITTVGIMVLIYS
NU5C_MUTAC      -------LSIVMIFSMNLSIQQINSSSAQYVWSWIINNDVSLEFGYLIDPLTSIMSXXXXXXXXXXXXYS
NU5M_PETMA      ------------MFISLIPLTIYLNENMETTLTWMDWALFNIALSFKIDKYTVIFTPIALMITWSIMEFS
NU5C_STAPU      --------------------------------SWITTEAVSLQIGYIIDPLSSIMLVLVTTVGIAVMIYT
NU5C_HUPLU      --------------------------------SWIPDQDVTLEVGYPIDPLTSIMLVLVTTIGVTVMIHS
NU5C_CARCG      --------------------------------SWVINNDFSLELGYLIDPLTSIMLILITTVGIMVLIYS
NU5M_RAT        ---------------------------------WLTINSIKLTMSFKIDYFSILFLSVSLFVTWSIMQFS
NU5C_PACAQ      --------------------------------SWTINNDFSFEFGYFIDSLTSIMSILITTVGIFVLIYX
NU5C_ANIIN      --------------------------------SWIINNDFSLEFGYLIDPLTSIMSXXXXXXXXXXXXYS
NU5M_TRIRU      ---------------------------------------------------GFYFDSLTVSMLIPVLIYS
NU5M_ACACA      ---------------------------------WFHIGLLKLNWLFLFDSITSXXXXXXXXXXXXXXXYS
NU5C_AMBTC      -------LSIVMVFSTNLSIQQINGNSIYQYLSWTINSDSSLEFGYLIDSLTSIMSILIATVGMMVLIYS
NU5M_PAPHA      ---------------------------------WMMTQTLDLTLSFKLDYFSMMFIPIALFITWSIMEFS
NU5C_ANGEV      --------------------------------SWFFNKDISLQIGFLIDPLTSTMLVSVTSVGILVMIYS
NU5M_ORNAN      --------------ISLVPMLSFLNGGVEATVTWFTTQTFNLSMNFKLDLYTIMFLPIALLITWSIMEFS
NU5C_LOTJA      --------------------------------------------------------------------YS
NU5C_CALFG      -------LSIAMVFSVNLSIQQINGSSIYQHLSWTINNDFSFEFGHLIDPLTSIMSILITTVGIMVLIYS
MRPA_BACSU      ------------IYFLPMIRMTQSGETLRSVLEWIPSLGINFTVYI--DGLGLLFALLITGIGSLVTLYS
NUOL_NEIMB      ----------------------------ENVYTWLTMGGLDFSVGFLVDXXXXXXXXXXXXXSLMVHIYT
NUOL_NEIMA      ----------------------------ENVYTWLTMGGLDFSVGFLVDXXXXXXXXXXXXXSLMVHIYT
NU5M_SQUAC      ---------------------------------WINIGPFDINMSFKFDMYSIIFTPVALYVTWSILEFA
NU5C_NANDO      -------LSIIMIFSADLSIQQIKGSLIQYVWSWTINNDFSLEFGYLIDPLTSIMLILITTVGIMVLIYS
NU5M_CHIMO      -------------------------------ISWIHLPLFNINLSFKFDMYSIMFTSVALYVTWSILDFT
NU5C_LIGVU      --------------------------------SWTINNDFSLEFGYLIDPLTSIMSMLITTVGIMVLIYS
NU5C_LEPVR      --------------------------------SWTINNEFSFEFGYFIDPLTSIMSILISTVGILVLIYS
NU5C_VITVI      --------------------------------SWTINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYS
NU5C_SOYBN      --------------------------------------------------------------------YS
NU5M_CRYNV      ---RGRTIGVTGAHIITTGCLMTSAALSIVA--FYEVGLSGSPVSIV---IGSWIDSLVQWMLLPVLIYS
NU5C_VICFA      --------------------------------------------------------------------YS
NU5C_CITSI      --------------------------------------------------------------------YS
NU5C_DRANE      --------------------------------------------------------------------YS
NU5C_DIOEL      -----------------LAIQQINGSFIQYLCSWTINNDFSLEFGYLIDPLTSIMSLLISTVGIMVLMYS
NU5M_MYXGL      ----------------------------------FNMISFNLLLGFEADMYCLTFFSIALYITWSIMQFS
NU5M_EMENI      ---------------------------------WLDVESLYVLWIFRFDSLTVSMFITVLIVSSLVHIYS
NU5M_DEBHA      --------------------------------TWFSVGDIQVNYGTLLDSLSMVVMVPVGIVTLSVLIYA
NU5C_PELHO      --------------------------------SWTINNDFSLEFGHLVDPLTSIMSXXXXXXXXXXXXYS
NU5C_CHLSC      -------LSITMVFSSNLSIQQINGSFIYQYLSWTINNDFSLEFGYLIDPLTSIMSXXXXXXXXXXXXYS
NUOL_STRCO      ----GTLLAAVSFVLGVVLFADLLGSGAEDRFSWIPVEGFQADVAFRLDQLSMTFVLLITGVGSLIHLYS
NU5M_CARAU      MAGMTKTAVSSAFFISLLPLMIFLNLKTEGIITWMNTQTFDVNISFKFDHYSLIFVPIALYVTWSILEFA
MNHA2_STAES     -----------------------------VRLPWMP--SIDINLDLRLDGLSLMFGLIISLIGVGVFFYA
MNHA2_STAEQ     -----------------------------VRLPWMP--SIDINLDLRLDGLSLMFGLIISLIGVGVFFYA
NU5C_OLIPU      --------------------------------------------------------------------YS
NU5M_USTMA      -------------------------------------------------------------------IFS
NU5C_NASOF      --------------------------------------------------------------------YS
NU5M_MOUSE      --------------ISLLPLLMFFHNNMEYMITWVTMNSMELKMSFKTDFFSILFTSVALFVTWSIMQLS
NU5C_ORYSJ      -------LSIAMVFSVHLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5C_ORYSI      -------LSIAMVFSVHLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5C_ORYSA      -------LSIAMVFSVHLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5C_ORYNI      -------LSIAMVFSVHLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5C_CICAR      --------------------------------------------------------------------YS
NU5M_LOXAF      ---------------------------------WMTIHTLKLSMSFKLDFFSLTFMPIALFITWSIMEFS
NU5M_DINSE      -----------------------------------------INISITLDTASLLFTPIALFITWSITEFS
NU5M_PARLI      -------------FLSVISLLSVQNSFKSINLTWFNNTPTNVSINFLLDQYFLLFLSVGLIVTWSIMEFS
NU5M_CYPCA      MAGMTKTAVSSAFFVSLLPLMIFLNLKTEGIITWMNTQAFDVNISFKFDHYSLIFVPIALYVTWSILEFA
NU5M_PONPY      ------------------------------------------------------VALFVTW---SIMEFS
NU5M_LATCH      ---------------------------------WMNTNTFNINISFKFDQYSIVFIPIALYVTWSILEFA
NU5M_STRCA      -----------------------SGTEAIISHWYWSFTPLKIPLSFKMDQYSMLFLPVALFVTWSILQFA
NU5C_CAPBU      --------------------------------------------------------------------YS
NU5C_MARPO      -------------------------------------------------------------------IYS
NU5C_BARVE      --------------------------------------------------------------------YS
NU5C_ARATH      --------------------------------------------------------------------YS
NUOL_BUCBP      ---------------------------------WISIDYLKIDFNFMLDGLSITMLTMTTSIGFLIHLFS
NU5M_ONCMY      ---------------------------------WMNTTTFDINLSFKFDHYSIIFTPIALYVTWSILEFA
NU5M_HUMAN      --------------------------DQEVIISWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIMEFS
NU5C_LOBMA      --------------------------------------------------------------------YS
NU5C_CRUWA      --------------------------------------------------------------------YS
NU5C_CHLAT      -------------------------------IEWIVTNQFSLEIGYSIDPXXXXXXXXXXXXAILVMIYS
NU5C_ARAHI      --------------------------------------------------------------------YS
NU5M_PONAB      ------------------------------------------------------VALLITW---SIMEFS
NU5M_GADMO      ----------------------------------------DITLSFKFDHYSIIFIPIALYVTWSILEFA
NU5M_XENLA      ---------------------------------WMNINTFDINMSFKFDIYSSIFIPIALFVTWSILEFA
MNHA2_STAS1     ----------------------MQGNFVSVKIPWLTL--LDINIDFRLDXXXXXXXXXXXXXXXAVVYYA
NU5M_CHICK      ---------------------------------WQFIPNFKIPISLKMDMYSMMFFPIALFVTWSILEFA
NU5M_TETNG      ------------------------GAEAVITLSWMNTHTFDINISLKFDHYSIIFTPVALYVTWSILEFA
NU5C_MORIN      -------LSIIMLFSTYLAIQQVNNPSIYLSISWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXXXXYS
NU5C_AETGR      ------------------------------------------------DPLSCIMVILITTVGIFVLIYS
MNHA1_STAES     ------------IYFISLISMTMSGNNVMKNLNWMP--HIGMNFNLYVDGLGLLFSLLITGIGSLVVLYS
MNHA1_STAEQ     ------------IYFISLISMTMSGNNVMKNLNWMP--HIGMNFNLYVDGLGLLFSLLITGIGSLVVLYS
NUOL_RICBR      -------------------------------LPWIEVSQFKVDWSIYIDQLTSIMFIAVTWVSSVVHIYS
NU5C_ADICA      -------------------------------------------------------------------IYS
NU5C_BUXMI      -------LSIVMIFSFNLSIQQINGSSIQYVCSWTINNDFSFEFGLLIDSLTSIMXXXXXXXXXXXXXYS
NU5M_CROLA      --------AVSSAFL--ISLLPLADQGTETIVTWMNTTMFDINISFKFDYYSLVFTPIALYVTWSILEFA
NU5M_CHLRE      --------------------------------TWFSVGTFHAGWTFNFDLLTANMLFTVTGVSMAVHMYA
NU5M_SALSA      ---------------------------------WMNTTTFDINLSFKFDHYSIIFTPIALYVTWSILEFA
NU5C_MESVI      ---------------------------------WIVTNNFLLEIGYFVDPXXXXXXXXXXXXXXXXXXYT
MRPA_BACPF      -------------FIQYLSITSTGGV-VEHTIPW--VPSLGINFTVFVDGLSLLFAXXXXXXXXXXXXYS
MNHA1_STAS1     ---------------------------------------FGMNFNLYVDGLGLLFSLLITGIGCLIVLYS
NU5M_ELEMA      ---------------------------------------------------------IALFITWSIMEFS
NU5C_AGRST      -------LSIAMVFSVQLSIQQINGSSIYQYLSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXXXXYS
NU5C_SACOF      -------LSIAMVFSLHLSIQQINGSSIYQYLSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXXXXYS
NU5C_SACHY      -------LSIAMVFSLHLSIQQINGSSIYQYLSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXXXXYS
NU5M_MAMPR      ---------------------------------------------------------IALFITWSIMEFS
MNHA2_STAHJ     -----------------LAQIPLHGKFVEFKIPWMPA--IDVNLDFRLDGLGLMFGLIISIIGVAVFFYA
NU5C_JASNU      --------------------------------SWTINNDFSFEFGYLIDPLTSIMSMLITTVGIMVLVYS
NU5M_BRALA      ---------------------------------WVKLGGYSLMISFRFDLYTCCFFVVGLYVTWNILMFS
NU5C_AETCO      --------------------------------------------------------------------YS
NU5M_DANRE      --------------------------------SWMNTQAFNVDLSFKFDYYSVTFTSIALFITWSILEFA
NU5M_PELSU      -----------------------------------------LAMSIKIDYYSLIFISIALFITRAILQYT
NU5M_BRAFL      ---------------------------------WVKLGGYSLMISFRFDLYTCCFFVVGLYVTWNILMFS
MNHA1_STAHJ     ------------LFIYFLSLISTTQSGNTVIKTLNWMPHIGMNFDLYLDGLSILFSLLITGIGSLVVLYS
NU5M_PICCA      ----------------------------------------------------------------------
NU5C_PHAVU      --------------------------------------------------------------------YS
MNHA2_STAAR     -----------------------------VSIPWMT--SLDINVDLRLDGXXXXXXXXXXXXXXAVFFYA
NU5M_STRPU      ---------------------------------WLSNTPLNISLNFIYDQYFLVFLSVALIVTWSIMEFS
NU5M_YARLI      -----------------------------------------------------------------VHIYS
MNHA2_STAAN     -----------------------------------------------------------------VFFYA
MNHA2_STAAM     -----------------------------------------------------------------VFFYA
MNHA2_STAA9     -----------------------------------------------------------------VFFYA
MNHA2_STAA2     -----------------------------------------------------------------VFFYA
MNHA2_STAA1     -----------------------------------------------------------------VFFYA
MNHA2_STAAW     -----------------------------------------------------------------VFFYA
MNHA2_STAAU     -----------------------------------------------------------------VFFYA
MNHA2_STAAT     -----------------------------------------------------------------VFFYA
MNHA2_STAAS     -----------------------------------------------------------------VFFYA
MNHA2_STAAE     -----------------------------------------------------------------VFFYA
MNHA2_STAAC     -----------------------------------------------------------------VFFYA
MNHA2_STAA8     -----------------------------------------------------------------VFFYA
MNHA2_STAA3     -----------------------------------------------------------------VFFYA
MNHA1_STAAR     --------------------------------------------------------------------YS
MNHA1_STAAW     --------------------------------------------------------------------YS
MNHA1_STAAU     --------------------------------------------------------------------YS
MNHA1_STAAT     --------------------------------------------------------------------YS
MNHA1_STAAS     --------------------------------------------------------------------YS
MNHA1_STAAN     --------------------------------------------------------------------YS
MNHA1_STAAM     --------------------------------------------------------------------YS
MNHA1_STAAE     --------------------------------------------------------------------YS
MNHA1_STAAC     --------------------------------------------------------------------YS
MNHA1_STAA9     --------------------------------------------------------------------YS
MNHA1_STAA8     --------------------------------------------------------------------YS
MNHA1_STAA3     --------------------------------------------------------------------YS
MNHA1_STAA2     --------------------------------------------------------------------YS
MNHA1_STAA1     --------------------------------------------------------------------YS
NUOL_BUCAP      --------------------------------SWISINELDIDCSLILDGLSLSMLAMXXXXXXXXHIFS
MNHA2_STAAB     -----------------------------------------------------------------VFFYA
MNHA1_STAAB     --------------------------------------------------------------------YS
NU5M_LUMTE      ----------------------------------------------------------------------
NU5M_CANAL      --------------------------------TWISLGDIVIPFGLSLDSLAMTVIVPVGIITLCVLAYA
NU5M_CANPA      ---------------------------------WLNIGDIIIPYGLSLDSLAMTVMIPVGIVTLCVLLYA
NU5M_ASTPE      ----------------------------------------------------------------------
HYFD_ECOLI      -----------------------------VTLTLVNVGDVAL-FGLVIDRVSXXXXXXXXXXXXXXXXYS
NU5M_ALBCO      -------------------VLNMQNSSYLLMFNLFSTQSVNFNLALICDKVSTSFLVVVLLISSCVFLFA
NU5M_DROME      ----------------------------------------------------------------------
NU5M_DROYA      ----------------------------------------------------------------------
NU5C_PEA        ----------------------------------------------------------------------
NU5H_NYCOV      --------------------------------------------------------------------FG
NU5M_RHISA      ----------------------------------------------------------------------
NU5M_ARTSF      -----------------------------------------------------------------VMIYS
NU5M_MYTED      -----------------------------------------------------------------VATYC
NU5M_ASCSU      ----------------------------------------------------------------------
NU5M_AEDAE      ----------------------------------------------------------------------
NU5M_LOCMI      --------------------------DYSLFIEWFSLNSSMVVMTFIIDWMSLVFMSFVMYISSLVIYYS
NU5C2_PAUCH     ----------------------------------------------------------------------
NU5M_PARTE      ----------------------------------------------------------------------
NU5M_PEA        ----------------------------------------------------------------------
NU5M_ANOGA      ----------------------------------------------------------------------
NU5M_ANOAR      ----------------------------------------------------------------------
NU5M_ANOQU      ----------------------------------------------------------------------
NU5M_APILI      ----------------------------------------------------------------------
MRPD_BACPF      ----------------------------------------------------------------------
NUOM_PSEAE      ----------------------------------------------------------------------
Y051_MYCTU      -------------------------------------------VHIELDRLGGFFMALTGAVAAPVGCYL
NUOM_RICPR      ----------------------------------------------------------------------
NU5M_CAEEL      ----------------------------------------------------------------------
HYFB_ECOLI      ----------------------------------------------------------------------
NUOM_ECOLI      ----------------------------------------------------------------------
NUOM_ECO57      ----------------------------------------------------------------------
NUOM_RICBR      ----------------------------------------------------------------------
NU5M_ANOQN      ----------------------------------------------------------------------
NUOM_RICFE      ----------------------------------------------------------------------
NQO13_PARDE     ----------------------------------------------------------------------
MRPD_BACSU      -------------------------------------------IVLAADQFASLLVLTTAIIGLLVGLYS
NU5M_TRYBB      ----------------------------------------------------------------------
NUOM_RICCN      ----------------------------------------------------------------------
NUOM_RHOCA      ----------------------------------------------------------------------
MNHD2_STAS1     ----------------------------------------------------------------------
HYCC_ECOLI      ----------------------------------------------------------------------
MNHD1_STAES     ----------------------------------------------------------------------
MNHD1_STAEQ     ----------------------------------------------------------------------
NUOM_RICTY      ----------------------------------------------------------------------
NU4C2_SYNJA     ----------------------------------------------------------------------
MNHD2_STAAR     ----------------------------------------------------------------------
MNHD2_STAHJ     ----------------------------------------------------------------------
MNHD1_STAAW     ----------------------------------------------------------------------
MNHD1_STAAU     ----------------------------------------------------------------------
MNHD1_STAAT     ----------------------------------------------------------------------
MNHD1_STAAS     ----------------------------------------------------------------------
MNHD1_STAAR     ----------------------------------------------------------------------
MNHD1_STAAN     ----------------------------------------------------------------------
MNHD1_STAAM     ----------------------------------------------------------------------
MNHD1_STAAE     ----------------------------------------------------------------------
MNHD1_STAAC     ----------------------------------------------------------------------
MNHD1_STAAB     ----------------------------------------------------------------------
MNHD1_STAA9     ----------------------------------------------------------------------
MNHD1_STAA8     ----------------------------------------------------------------------
MNHD1_STAA3     ----------------------------------------------------------------------
MNHD1_STAA2     ----------------------------------------------------------------------
MNHD1_STAA1     ----------------------------------------------------------------------
MNHD2_STAAW     ----------------------------------------------------------------------
MNHD2_STAAU     ----------------------------------------------------------------------
MNHD2_STAAT     ----------------------------------------------------------------------
MNHD2_STAAS     ----------------------------------------------------------------------
MNHD2_STAAN     ----------------------------------------------------------------------
MNHD2_STAAM     ----------------------------------------------------------------------
MNHD2_STAAE     ----------------------------------------------------------------------
MNHD2_STAAC     ----------------------------------------------------------------------
MNHD2_STAAB     ----------------------------------------------------------------------
MNHD2_STAA9     ----------------------------------------------------------------------
MNHD2_STAA8     ----------------------------------------------------------------------
MNHD2_STAA3     ----------------------------------------------------------------------
MNHD2_STAA2     ----------------------------------------------------------------------
MNHD2_STAA1     ----------------------------------------------------------------------
NU4C2_SYNJB     ----------------------------------------------------------------------
NU4M_MARPO      ------------------------------------------------------LTTFLTPICILVGFYS
NU4C2_ANASP     ----------------------------------------------------------------------
NU4C1_ANAVT     ----------------------------------------------------------------------
NU4C_ACAM1      ----------------------------------------------------------------------
NU4M_CHOCR      ----------------------------------------------------------------------
NUON_ERWT9      ------------------ATLAVVGLNLALFSLYFVAGPMDVTPLLRIDAYSMFYTGLVILASLATCTFA
NU4M_ARATH      ----------------------------------------------------------------------
NU4C3_SYNP2     ----------------------------------------------------------------------
NU4C3_ANASP     ----------------------------------------------------------------------
NU4C2_SYNP6     ----------------------------------------------------------------------
NU4C2_SYNE7     ----------------------------------------------------------------------
NU4C2_ANAVT     ----------------------------------------------------------------------
NU4C_SYNR3      ----------------------------------------------------------------------
NU4C_PROM5      ----------------------------------------------------------------------
NU4C2_MICAN     ----------------------------------------------------------------------
NDHF_BACSU      ------------------------------------VGPWHL------DSLACLMTFFVLAIGFIIQRFS
MNHD2_STAES     ----------------------------------------------------------------------
MNHD2_STAEQ     ----------------------------------------------------------------------
NU4M_WHEAT      ----------------------------------------------------------------------
NU2C_SYNJA      ----------------------------------------------------------------------
NU4C_PROMP      ----------------------------------------------------------------------
NU4C_PROM4      ----------------------------------------------------------------------
NU4C_PROMM      ----------------------------------------------------------------------
NU4C_PROMA      ----------------------------------------------------------------------
NU4C2_SYNY3     ----------------------------------------------------------------------
NU4C2_SYNP2     ----------------------------------------------------------------------
NU4C_SYNS3      ----------------------------------------------------------------------
NU4C_SYNPX      ----------------------------------------------------------------------
NU4C_PROMT      ----------------------------------------------------------------------
NU4C_PROM1      ----------------------------------------------------------------------
NU4C1_THEEB     ----------------------------------------------------------------------
NU4C_SYNSC      ----------------------------------------------------------------------
NU4C_PROMS      ----------------------------------------------------------------------
NU4C_PROM3      ----------------------------------------------------------------------
NU4C_PROM2      ----------------------------------------------------------------------
NU4C_PROM0      ----------------------------------------------------------------------
NU4C1_SYNJA     ----------------------------------------------------------------------
NU4M_PROWI      ----------------------------------------------------------------------
NU4C1_TRIEI     ----------------------------------------------------------------------
NU4C1_SYNJB     ----------------------------------------------------------------------
Y1309_METJA     ----------------------------------------------------------------------
NU4M_BRACM      ----------------------------------------------------------------------
NU4C_SYNS9      ----------------------------------------------------------------------
NU4C_SYNPW      ----------------------------------------------------------------------
NU4C_PROM9      ----------------------------------------------------------------------
NU4C_GLOVI      ----------------------------------------------------------------------
NU2C_SYNP6      ----------------ALAITGLSAAIAVLTLQWNTSQNLAFLGGFNGDNLSIVFRGIVLLSAAVTILLS
NU2C_SYNE7      ----------------ALAITGLSAAIAVLTLQWNTSQNLAFLGGFNGDNLSIVFRGIVLLSAAVTILLS
NUON2_RHIME     ----------------------------------------------------------------------
NU4C_ANTFO      ----------------------------------------------------------------------
NU2C_CHAGL      ----------------------------------------------------------------------
NU4C2_THEEB     ----------------------------------------------------------------------
NU4C_NEPOL      ----------------------------------------------------------------------
NU4C2_TRIEI     ----------------------------------------------------------------------
NU4C1_SYNY3     ----------------------------------------------------------------------
NU4C1_SYNP6     ----------------------------------------------------------------------
NU4C1_SYNE7     ----------------------------------------------------------------------
NU2C_STAPU      ----------------------------------------------------------------------
NU4C3_ANAVT     ----------------------------------------------------------------------
NU4C1_ANASP     ----------------------------------------------------------------------
NU2C_CYAP7      ----------------------------------------------------------------------
NUOM_MYCTU      ----------------------------------------------------------------------
NU2C_ACAM1      -----------------LAIASLAACLYLLYTQWDQANPIGFLGSFNADNLSIVFRAIIALSTLVTILMS
NUON_MYCTU      ----------------------------------------------------------------------
NUON_MYCBO      ----------------------------------------------------------------------
NU4C1_SYNP2     ----------------------------------------------------------------------
NU2C_NEPOL      ----------------------------------------------------------------------
NU4M_ASTPE      ----------------------------------------------------------------------
NU4C_ZYGCR      ----------------------------------------------------------------------
NU4C_MARPO      ----------------------------------------------------------------------
NU2C_PHYPA      ----------------------------------------------------------------------
HYFF_ECOLI      ---------------------------------------------LHIDGLGGLFLAILGVIGFLTGIYS
NU4M_METSE      ----------------------------------------------------------------------
NU2C_PROMT      ----------------------------------------------------------------------
NU2C_SYNP2      ----------------------------------------------------------------------
NU2C_MARPO      ----------------------------------------------------------------------
NU4C_PHYPA      ----------------------------------------------------------------------
NU4C_IPOPU      ----------------------------------------------------------------------
NU2C_PROMM      ----------------------------------------------------------------------
NU2C_PROM3      ----------------------------------------------------------------------
NU2C_CYAP8      ----------------------------------------------------------------------
NUON_PSEAE      ----------------------------------------------------------------------
NU4M_ACACA      ----------------------------------------------------------------------
NU2C_TRIEI      ----------------------------------------------------------------------
NU2C_CHAVU      ----------------------------------------------------------------------
NU2C_MICAN      --------------------------------TWDNPKPVAFLGAFEGDNLSIVFRAIIALSTASTVLMS
NU4M_STRPU      ----------------------------------------------------------------------
NU4C_ADICA      ----------------------------------------------------------------------
NU2C_SYNS9      ----------------------------------------------------------------------
NU2C_SYNPW      ----------------------------------------------------------------------
NU2C_PAUCH      ----------------------------------------------------------------------
NU4C_CHLAT      ----------------------------------------------------------------------
NU2C_SYNS3      ----------------------------------------------------------------------
NU2C_SYNPX      ----------------------------------------------------------------------
NU2C_CYAA5      ----------------------------------------------------------------------
NU2C_CHLAT      ----------------------------------------------------------------------
NU4M_MYXGL      ----------------------------------------------------------------------
NU4C_MESVI      ----------------------------------------------------------------------
MNHD1_STAHJ     ----------------------------------------------------------------------
NU4C_CRYJA      ----------------------------------------------------------------------
NU2C_PROMA      ----------------------------------------------------------------------
NU2C_ADICA      ----------------------------------------------------------------------
NU4C_NYMAL      ----------------------------------------------------------------------
NU2M_ARATH      ----------------------------------------------------------------------
NQO14_PARDE     ----------------------------------------------------------------------
NUON_RHOCA      ----------------------------------------------------------------------
NU4C_ANGEV      ----------------------------------------------------------------------
NU4C1_MICAN     ----------------------------------------------------------------------
NU2C_PSINU      ----------------------------------------------------------------------
NU2C_MESVI      ----------------------------------------------------------------------
NU4C_POPTR      ----------------------------------------------------------------------
NU4C_POPAL      ----------------------------------------------------------------------
NU4M_PARLI      ----------------------------------------------------------------------
NU4C_HUPLU      ----------------------------------------------------------------------
NU4C_NUPAD      ----------------------------------------------------------------------
NU4C_LOTJA      ----------------------------------------------------------------------
NU4C_EUCGG      ----------------------------------------------------------------------
NU2C_ZYGCR      ----------------------------------------------------------------------
NU2C_CYCTA      ----------------------------------------------------------------------
NUON_RICTY      ----------------------------------------------------------------------
NU4M_USTMA      ----------------------------------------------------------------------
NU4C_PSINU      ----------------------------------------------------------------------
NU2M_OENBE      ----------------------------------------------------------------------
NUOM_BUCBP      ----------------------------------------------------------------------
NUOM_BUCAP      ----------------------------------------------------------------------
NU4C_TOBAC      ----------------------------------------------------------------------
NU4C_NICSY      ----------------------------------------------------------------------
NU4C_DRIGR      ----------------------------------------------------------------------
NU2C_ANTFO      ----------------------------------------------------------------------
NU4C_PELHO      ----------------------------------------------------------------------
NU4C_AETCO      ----------------------------------------------------------------------
NU4C_OENPA      ----------------------------------------------------------------------
NU4C_OENAR      ----------------------------------------------------------------------
NU4C_MANES      ----------------------------------------------------------------------
NU4C_ILLOL      ----------------------------------------------------------------------
NU4C_CARPA      ----------------------------------------------------------------------
NU4C_AETGR      ----------------------------------------------------------------------
NU2M_LUMTE      ----------------------------------------------------------------------
NUON_RICPR      ----------------------------------------------------------------------
NUOM_BUCAI      ----------------------------------------------------------------------
NU4C_NICTO      ----------------------------------------------------------------------
NU4C_HORVU      ----------------------------------------------------------------------
NU4C_CYCTA      ----------------------------------------------------------------------
NU4C_CHAVU      ----------------------------------------------------------------------
NU4C_BUXMI      ----------------------------------------------------------------------
NU4C_ARATH      ----------------------------------------------------------------------
NU2M_NEUCR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLM
NU5C_SYNP2      DGYMAHDPGYVRFYAYLSIFSSSMLGLVFSPNLVQVYIFWELVGMCSYLLIGFWYDRKAAADACQKAFVT
NU5C1_PAUCH     DGYMSHDKSYVRFFTYLGLFTSSMLALILSPNLLEIYVFWELVGMCSYLLIGFWYEREDAANAAQKAFVV
NU5M_OENBE      ISYMSEDPHSPRFMCYLSIFTFFMPMLVTGDNFLQLFLGWEGVGLASYLLIHFWFTRLQADKAAIKAMLV
NU5C_SYNY3      DGYMAHDPGYVRFYAYLSLFASSMLGLVISPNLVQVYIFWELVGMCSYLLIGFWYDRKAAADACQKAFVT
NU5M_WHEAT      ISYMSEDPHSPRFMCYLSIFTFFMLMLVTGDNFLQLFLGWEGVGLASYLLIHFWFTRLQADKAAIKAMLV
NUOL_RICFE      LGYMAEDKGIIRXXXXXXXXXXXXXXXVSADNFLQLFFGWEGVGVCSYLLIGFWYSKESANKAAIKAFIT
NQO12_THET8     IGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFIV
NU5M_ARATH      ISYMSEDPHSPRFMCYLSIFTFFMLMLVTGDNFLQLFLGWEGVGLASYLLIHFWFTRLQADKAAIKAMLV
NU5C_PHYPA      DSYMSYDQGYVRFFAYLSLFTASMLGLVLSPNLIQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFVT
NU5M_MARPO      ISYMSEDPHSPRFFCYLSIFTFFMLMLVTGDNFIQLFLGWEGVGLASYLLINFWFTRIQANKAAIKAMLI
NU5C_SPIOL      DNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NUOL_PSEAE      SWYMRGETGYSRFFAYTNLFIASMXXXXXXXXXXXXXXGWEGVGLCSYLLIGFYYSNRNNGNAALKAFIV
NU5M_DICDI      MDYMKEDPHKTRFFSYLSLFTFFMMLLVTADNFVQLFFGWEGVGIMSYLLINFWYTRLQANKSALKAVIL
NUOL_ECOLI      SWYMRGEEGYSRFFAYTNLFIASMVVLVLADNLLLMYLGWEGVGLCSYLLIGFYYTDPKNGAAAMKAFVV
NU5M_RABIT      MWYMHSDPKINQFFKYLLMFLITMLILVTANNMFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAILY
NU5M_DICCI      MDYMKADPHKTRFFSYLSLFTFFMMLLVTADNFVQLFFGWEGVGIMSYLLINFWYTRLQANKSALKAVIL
NU5C_CHAGL      DGYMLHDQGYIRFFAYLSLFTASMLGLIVSPNLIQVYVFWELIGMCSYLLVGFWSTRPTAASACQKAFIT
NU5C_SOLTU      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVT
NU5C_SOLLC      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVT
NU5C_SOLBU      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVT
NU5M_HIPAM      MWYMHSDPHINQFFKYLLLFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDANTAAIQAILY
NU5C_PIPCE      DNYMSHDQGYLRFFAYLNFFNASMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFVT
NU5C_IPOPU      DNYMAHDQGYLRFFTYMSFFCAAMLGLVTSSNFIQIYIFWELVGLCSYLLIGFWFTRPGAANACQKAFVT
NU5M_METSE      TAYMDGDPHVPRFMSYLSLFTFFMILLVTSDNYPQLFIGWEGVGLCSYLLINFWLTRIEANKAAIKAMLV
NU5M_HALGR      MWYMHSDPFINRFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAVLY
NU5C_PLAOC      DNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5M_PHOVI      MWYMHSDPFINRFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAVLY
NU5C_ATRBE      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVT
NU5C_TOBAC      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVT
NU5C_TECST      DNYMAHDQGYLRFFAYMSFFSTSMFGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPPAANACQKAFVT
NU5C_NICSY      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVT
NU5C_NEPOL      DEYMHVDEGYVRFFVYLSIFTTSMLGLVLSPNLVQVYGFWELVGMCSYLLVGFWFTRPTAAEASQKAFIT
NU5C_DRIGR      DKYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKALVT
NU5C_COFAR      DNYMAHDQAYLRFFAYMGFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVT
NU5C_ACOCL      DNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPTAANACQKAFVT
NU5C_ACOAM      DNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPTAANACQKAFVT
NU5C_LACSA      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFTRPVAAKACQKAFVT
NUOL_MYCTU      VGYMAEDPDRRRFFGYLNLFLASMLLLVVADNYVLLYVGWEGVGLASYLLIGFWYHKPSAATAAKKAFVM
NU5C_CICIN      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGVCSYLLIGFWFTRPVAAKACQKAFVT
NU5C_CUCSA      DNYMSHDQGYLRFFAYMSLFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPTAANACQKAFVT
NU5M_SORFM      MWYMHSDPNMNRFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAILY
NU5C_BRADI      DGYMSHDEGYLRFFIYISFFNISMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_ATHGR      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAAKACQKAFVT
NU5C_AMBTR      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAAKACQKAFVT
NU5C_ADEHI      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFTRPVAAKACQKAFVT
NU5M_PIG        MWYMHSDPFINRFFKYLVLFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAILY
NU5M_CRYPA      ISYMSGDPHNQRFFSYLSLFTFMMIILVTGNNYLLMFVGWEGVGVCSYLLVSFWFTRIAANQSSISAFLT
NU5C_PSINU      DSYMSHDQGYVRFFVYLSFFTASMLGLVLSSNLVQIYIFRELVGMCSYLLIGFWFTRPSAANACQKAFIT
NU5C_NICTO      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVT
NU5C_GOSBA      DNYMSHDEGYLRFFAYMSLFNTSMLGLVTSCNLIQIYIFWELVGMCSYLLIGFWFTRPAAANACQKAFVT
NU5M_CANLU      MWYMHSDPYINRFFKYLLLFLITMMVLVTANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAVLY
NU5C_GERJA      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGIRSYLLIGFWFTRPVAAKACQKAFVT
NU5C_DIGGR      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGVCSYLLIGFWFTRPLAANACQKAFVT
NU5C_CHAVU      HGYMSHDQSYVRFFAYLSLFTASMLGLVLSPNLFQIYIFWELVGMCSYLLIGFWFTRPNAASACQKAFIT
NU5C_ATRJA      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFTRPVAAKACQKAFVT
NU5M_RHIST      TNYMSEDPHNQRFFAYLSMFTFFMLMLVTGDNYLVMFIGWEGVGISSYLLINFWFTRLQANKAAIKALVM
NU5C_HELAN      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAAKACQKAFVT
NU5M_CHOCR      IKYMENDPHQPRFMSYLEIFTFFMLILVTADNLIQMFLGWEGVGLASYLLINFWYTRLAANQSAIKALIV
NU5C_MANES      DNYMSHDQGYLRFFAYMSFFTTSMLGLVTSSNLIQIYIFWELVGVCSYLLIGFWFTRPIASNACQKAFVT
NU5M_PHYIN      SQYMAHDPHLSRFMSYLSLFTFFMIILVTGDNFMQMFVGWEGVGFCSYLLINFWFTRLQANKAAIKAMLV
NU5C_SESIN      DNYMAHDQGYLIFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFVT
NUOL_RICPR      LGYMAEDKGIIRXXXXXXXXXXXXXXXVSADNFLQLFCGWEGVGVCSYLLIGFWHSKESANKAAIKAFIT
NU5M_POLOR      IYYMHTDILINRFFKYLLTFLIAMMILVTANNMFQLFIGWEGVGIMSFLLIGWWYGRADANMAALQAVIY
NU5C_GOSHI      DNYMSHDEGYLRFFAYMSLFNTSMLGLVTSCNLIQIYIFWELVGMCSYLLIGFWFTRPAAANACQKAFVT
NU5C_FLARA      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAAKACQKAFVT
NU5C_DAMDI      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVT
NU5M_ALLMA      IGYMQGDPHIQRFFSYLSLFTFFMLLLVTGNNYLLMFVGWEGIGVSSYLLINFWFTRIQANKASMQAMLV
NU5C_GUIAB      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAAKACQKAFVT
NU5C_CRYJA      DNYMSHDKTYVRFFAYLNFFNASMLGLVISPNLLQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFIT
NU5M_SCYCA      LWYMHLDPNINRFFKYLLLFLISMIILVTANNMFQLFIGWEGVGIMSFLLIGWWYSRTDANTAALQAVIY
NU5M_DASNO      LWYMHSDPYINQFFKYLLLFLITMMILVTANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILY
NU5C_LIRTU      DNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIHIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NUOL_CAMJE      IFYMAHDEGFNKFFAYLGLFVFSMLFLVMSDNFLGLFVGWEGVGLCSWLLIGFWYKNDTYSFAANEAFIM
NU5M_RHIUN      IWYMHSDPHITQFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILY
NU5M_DUGDU      LWYMNSDPYINRFFKYXXXXXXXXXXXXXANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAMIY
NU5C_LOLPR      DGYMSHDEGYLRFFVYISFFTTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_HORVU      DGYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5M_LEMCA      MWYMHSDPNMNQFFKYLLMFLITMLILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILY
NU5M_NEUCR      ISYMSHDPHNQRFFSYLSLFTFMMIILVTANNYLLMFVGWEGVGVCSYLLVSFWFTRIAANQSSMSAFLT
NU5M_GEOPE      TWYMKHDPHLKRFLNYLSLFLITMLILVTANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAIIY
NU5C_CYCTA      DNYMSHDQGYVRFFAYLSLFNASMLGLVISPNLVQIYIFWELVGMCSYLLIGSWFTRPSAANACQKAFIT
NU5M_PENMA      ISYMSHDPHNQRFFSYLSLFTFMMIILVTGNNYLLMFVGWEGVGICSYLLINFWFTRIAANQSSISALLT
NU5C_NYMAL      DNYMSHDRGYLRFFAYMSFFNTAMLGLVTSPNLIQIHIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5M_HORSE      LWYMHSDPYITRFFKYLLTFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILY
NU5M_BOSIN      MWYMHSDPNINKFFKYXXXXXXXXXXXVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAVLY
NU5C_LEMMI      DNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPSAASACQKAFIT
NU5C_CAPBA      DNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVT
NU5M_SHEEP      MWYMHSDPNINQFFKYXXXXXXXXXXXVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILY
NU5M_EQUAS      LWYMHSDPYITRFFKYLLTFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILY
NU5M_BOVIN      MWYMYSDPNINKFFKYXXXXXXXXXXXVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAILY
NU5C_CARPA      DSYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQVYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5M_PODAN      ISYMSSDPHNQRFFSYLSLFTFMMIILVTANNYLLMFVGWEGVGVCSYLLVSFWFTRIAANQSSISAFLA
NU5M_BALPH      MWYMHSDPYINQFFKYXXXXXXXXXXXVTANNLFQLFIGWEGVGIMSFLLIGWWFGRTDANTAALQAILY
NU5M_BALMU      MWYMHSDPYINQFFKYXXXXXXXXXXXVTANNLFQLFIGWEGVGIMSFLLIGWWFGRTDANTAALQAILY
NU5M_ASPNG      ISYMSHDPHNQRFFSYLSLFTFMMIILVTGNNYLIMFVGWEGVGVCSYLLVNFWFTRIAANQSSLSALLT
NU5C_CERDE      DNYMSHDQGYLRFFSYLSFFNASMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFARPIAANACQKAFVT
NU5M_CANFA      MWYMHSDPYINRFFKYLLLFLITMMVLVTANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAVLY
NU5C_POAPR      DGYMSHDEGYLRFFVYISFFTTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_ILLOL      DNYMSHDQGYLRFFASMSFSNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_ANTFO      DGYMSHDEGYVRFFVYLSLFTASMLGLVLSPNLIQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFIT
NUOL_RICTY      LGYMANDKGIIRXXXXXXXXXXXXXXXVSADNFLQLFCGWEGVGVCSYLLIGFWYSKESANKAAMKAFIT
NU5C_SORBI      DDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_NUPAD      DNYMSHDQGYLRFFAYMSFFNTSMLGLVTSPNLIQIHIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NUOL_RICCN      LGYMAEDKGIIRXXXXXXXXXXXXXXXXXXDNFLQLFFGWEGVGVCSYLLIGFWYSKESXXXXXXXXXXX
NUOL_RHOCA      WGYMAHEAYKARFFAYLSFFTFAMLMLVTSDNLVQMFFGWEGVGVASYLLIGFYYKKPSANAAAIKAFVV
NUOL_BUCAI      SWYMRYKEGQSRFFAYTNLFIASMSVLVLADNFLFMYLGWEGVSVCSYLLIGFYYTELKNNLCAFKAFIL
NU5M_TRIRE      IGYMSHDPHSQRFFSYLSLFTFMMIILVTGNNYLLMFVGWEGVGVCSYLLVSFWFTRIAANQSSLSAFLT
NU5M_MACRO      LWYMHSDPYIHRFFKYLITFLLTMIILVSANNLFQLFIGWEGVGIMSFMLIGWWFGRTDANTAALQAVLY
NU5M_GORGO      LWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLIGWWYARTDANTAAVQAILY
NU5M_PANTR      LWYMDSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARTDANTAAIQAILY
NU5M_FELCA      MWYMHSDPYINRFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAILY
NU5C_CARTI      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFTRPVAAKACQKAFVT
NU5M_CERSI      MWYMHSDPHITQFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLISWWYGRTDANTAALQAILY
NU5M_MYOGL      LWYMHSDPYINRFFKYLLLFLITMIILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRPDANTAALQAVLY
NU5M_HYLLA      LWYMHSDPNINQFFKYLLIFLTTMLILVTANNLFQLFIGWEGVGIMSFLLIGWWHAREEANTAAIQAILY
NU5M_DIDMA      LWYMHSDPNISQFFKYLIIFLLTMIILVSANNLFQLFIGWEGVGIMSFLLIGWWYGRSDANTAALQAILY
NU5C_ZYGCR      HGYMSHDQGYVRFFAYLSLFTASMLGLVLSPNLVQVYAFWELVGMCSYLLVGFWFTRPSAAYACQKAFIT
NU5C_MALAR      DNYMSHDQGYLRFFAYMSLFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPAAANACQKAFVT
NU5M_PANPA      LWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARTDANTAAIQAILY
NU5C_POPAL      DSYMSHDQGYLRFFVYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIVSNACQKAFVT
NU5C_DAUCA      DNYMSYDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAANACQKAFVT
NQO12_PARDE     LGYMADEHYKARFFAYLSFFTFAMLMLVTADNLLQMFFGWEGVGVASYLLIGFYYXXXXXXXXXXXXFIV
NU5M_SCHCO      VNYMANDPHIQRFFSYLSLFTFFMAILVTGANYFVLFVGWEGIGVVSYLLINFWFTRIQANKAAILAFNT
NU5C_WHEAT      DGYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_POPTR      DSYMSHDQGYLRFFVYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIVSNACQKAFVT
NU5C_OENPA      DNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAATACQKAFVT
NU5C_OENGL      DNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAATACQKAFVT
NU5C_OENEH      DNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAATACQKAFVT
NU5C_OENBI      DNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAATACQKAFVT
NU5C_OENAR      DNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAATACQKAFVT
NU5C_MAIZE      DDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_FAGEA      DNYMVHDQGYLRFFAYLSFFNTSMLGLVTSSNFIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_EUCGG      DNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPSAATACQKAFVT
PHAAB_RHIME     RYYMAEEDPVPRFFALFLAFMGSMLGVVLSGNLILLAVFWELTSIVSFLLIGYWHHNAHARDGARMALTI
NU5M_ROUAM      MWYMHSDPYINRFFKYXXXXXXXXXXXVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILY
NU5C_PANGI      DNYMSHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAANACQKAFVT
NU5C_ASTCO      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAAKACQKAFVT
NU5C_RANMC      DNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVT
NU5C_MUTAC      DNYMSHDHGYLRFFVYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFTRPVAAKACQKAFVT
NU5M_PETMA      QWYMAKERHMDKFFKYXXXXXXXXXXXXSANNLLQLFIGWEGVGIMSFLLISWWSGRTKANISALQAVAY
NU5C_STAPU      DGYMSHDQGYVRFFLYLSLFTASMLGLVLSSNLVQIYAFWELVGMCSYLLVGFWFSRPSAAAACQKAFVT
NU5C_HUPLU      DSYMSHDQGYVRFFAYLSLSTASMLGLVISPNLIQIYIFRELVGMCSYLLIGFWFTRPSAANACQKAFIT
NU5C_CARCG      DSYMSHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVT
NU5M_RAT        SWYMHSDPHINRFIKYLMMFLNNMLILTSANNLFQLFIGWEGVGIMSFLLIGWWYGLADANTAALQAILY
NU5C_PACAQ      DNYMSHDQGYLRFFAYMSLFNTSMLGLLTXSNLIQIYXFWELVGMCSYLLIGFWFTXPAAANACQKAFVT
NU5C_ANIIN      DNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAAKACQKAFVT
NU5M_TRIRU      IGYMSHDPHNQRFFSYLSLFTFMMIILVTANNYLLMFLGVEGVGVCSYLLVNFWFTRIAANQSSISAFLT
NU5M_ACACA      IDYMSGDPHIIRFLGYLSLFTFFMLMLVTSGNFVQLFLGWEGVGLSSYLLINFWYTRIQANKSAMKAIIV
NU5C_AMBTC      DNYMSHDKGYLRFFAYMSFFNTSMLGLVISPNLIQIYIFWELVGMCSYLSIGFWFTRPSAANACQKAFVT
NU5M_PAPHA      LWYMSSDPNINQFFKYXXXXXXXXXXXXXANNLFQLFIGWEGVGIMSFLLISWWHARTDANTAAIQAVLY
NU5C_ANGEV      DSYMSHDQGYVRFFAYLSLFTASMLGLVLSPNPVQIYIFWELVGMCSYLLIGFWFSRPSAANACQKAFIT
NU5M_ORNAN      IWYMSSDPKINQFMKYXXXXXXXXXXXXSANNLFQLFIGWEGVGIMSFMLIGWWHARTDANTAALQAILY
NU5C_LOTJA      DNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQVYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_CALFG      DNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPTAANACQKAFVT
MRPA_BACSU      IFYLSKEKEQLGFYVYLLMFMGAMLGVVLVDNVMVLYMFWELTSLSSFLLIGYWYKREKSRYGAAKSLLI
NUOL_NEIMB      IGYMHDEVGYQRFFSYISLFTFSMLMLIMSNNFIQLFFGWEAVGLVSYLLIGFYFKRPSATFANLKAFLI
NUOL_NEIMA      IGYMHDEVGYQRFFSYISLFTFSMLMLIMSNNFIQLFFGWEAVGLVSYLLIGFYFKRPSATFANLKAFLI
NU5M_SQUAC      LWYMHSDPNMNRFFKYLLLFLISMIILVTANNMFQLFIGWEGVGIMSFLLIGWWYSRADANTAALQAVIY
NU5C_NANDO      DNYMSHDQGYLRFFAYMSFSNASMLGLVTSCNLIQIYIFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5M_CHIMO      SWYMYSDPNINRFFKYXXXXXXXXXXXVTANNMFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAVIY
NU5C_LIGVU      DNYMAHDQGYLRXXXXXXXXXXXXLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVT
NU5C_LEPVR      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_VITVI      DNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_SOYBN      DNYMSHDQGYLRFFAYLTLFNISMLGLVTSSNLIQIYVFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5M_CRYNV      ISYMAGDPHNQRFFSYLSMFTFFMLVLVAGDNYFIMFVGWEGIGISSYLLINFWYTRMQANKAGMKALTV
NU5C_VICFA      DSYMSHDQGYLRFFTYMSFFNTSMLGLVTSSNLIQVYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_CITSI      DNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNFIQIYIFWELVGMCSYLLIGFWFTRPIAAGACQKAFVT
NU5C_DRANE      DNYMAHDQGYLRFFAYLGFFTTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_DIOEL      DNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIHIFWELVGMCSYLLIGFWFTRPIAASACQKAFVI
NU5M_MYXGL      LWYM-HEHNNTLFFKYLTMFLISMLFFLSANNLLQLILGWEGMGIMSFLLINWWHNRLEANSAAMQAIIY
NU5M_EMENI      ISYMSHDPHNQRFFSYLSLFTFMMIILVTGNNYLIMFVGWEVVGVCSYLLVNFWFTRIAANQSSLSALLT
NU5M_DEBHA      IDYMRYDPNRNRFYIILSVFAIFMTVLVISDNYIMMFMGWEFVGVVSYLLISFWNTRIAAMKSALSAILL
NU5C_PELHO      EKYMFHDQGYLRFFSYMTLFHVSMLGLVTSSNLIQIYICWEFVGMFSYLLIGFWFTRPVAANACQKAFVT
NU5C_CHLSC      DNYMSHDQGYLRFLSYMSFSNTSMLGLVTSSNLIQIHIFWELVGMCSYLLIGFWSTRTVAANACQKAFVT
NUOL_STRCO      VAYMEHDERRRRFFGYLNLFLAAMLILVLADNYLLLYVGWEGVGLASYLLIGFWQHKPSAATAAKKAFLV
NU5M_CARAU      LWYMHSDPYIDRFFKYLLTFLVAMIILVTANNMFQLFIGWEGVGIMSFLLIGWWHGRADANTAALQAVIY
MNHA2_STAES     TQYLSHSTDNPRFFIYLLLFMFSMIGIVIANNTILMYVFWELTSISSFLLISYWYNNGESQLGAIQSFMI
MNHA2_STAEQ     TQYLSHSTDNPRFFIYLLLFMFSMIGIVIANNTILMYVFWELTSISSFLLISYWYNNGESQLGAIQSFMI
NU5C_OLIPU      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5M_USTMA      VDYMSADPHNQRFFAYLSMFTFFMLVLVTGDNYLIMFVGWEGIGISSYLLINFWFTRIQANKSAIKALVV
NU5C_NASOF      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5M_MOUSE      SWYMHSDPNINRFIKYXXXXXXXXXXXXSANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILY
NU5C_ORYSJ      DDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_ORYSI      DDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_ORYSA      DDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_ORYNI      DDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_CICAR      DSYMSHDQSYLRFFTYLSFFNTSMLGLVTSSNLIQVYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5M_LOXAF      LWYMHSDPHINRFFKYXXXXXXXXXXXVSANNLLQLFMGWEGVGIMSFLLISWWHGRTDANTAALQAMLY
NU5M_DINSE      LWYMATDPNINKFIKYLLTFLITMLVIITANNMYQLFIGWEGVGIMSFLLIGWWHGRQDANTAALQAIIY
NU5M_PARLI      YYYMKEDPNGKAFFRPFGHFSLNMLILTSSNSLFLVFLGWEGVGFLSFLLISWWATRNDASSSALEAVIY
NU5M_CYPCA      LWYMHSDPNIDRFFKYLLTFLVAMIILVTANNMFQLFIGWEGVGIMSFLLIGWWHGRADANTAALQAVIY
NU5M_PONPY      LWYMASDPNINQFFKYXXXXXXXXXXXXXANNLLQLFIGWEGVGIMSFLLISWWYARTDANTAAIQAILY
NU5M_LATCH      NWYMHQDPKMNQFFKYLLLFLITMMILVTANNMFQLFIGWEGVGIMSFLLIGWWHGRANANTAALQAVIY
NU5M_STRCA      MWYMASEPHVTKFFIYLLMFLIAMLTLTIANNMFMLFIGWEGVGIMSFLLISWWHGRAEANTAALQAVIY
NU5C_CAPBU      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPVAANACQKAFVT
NU5C_MARPO      DSYMFYDEGYIKFFCYLSLFTASMLGLVLSPNLIQVYIFWELVGMCSYLLIGFWFTRPSAANACQKAFVT
NU5C_BARVE      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_ARATH      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NUOL_BUCBP      SWYIKLQDEYTRFFSYMNLFIASMVXXXXXXXXXVMYIGWEGVGLCSYLLVGFYYSKINSGYAAIKGFII
NU5M_ONCMY      SWYMHADPNMNRFFKYLLLFLIAMIILVTANNMFQLFIGWEGVGIMSFLLIGWWHGRADANTAAMQAVIY
NU5M_HUMAN      LWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILY
NU5C_LOBMA      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_CRUWA      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5C_CHLAT      DSYMSYDQGYVRFFAYLSLFTASMLGLVLSPNLVQIYVFWELVGMCSYLLIGFWFTRPAAADACQKAFVT
NU5C_ARAHI      DNNMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIPANACQKAFVT
NU5M_PONAB      LWYMASDPNXXXXXXXXXXXXXXXXXXVTANNLLQLFIGWEGVGIMSFLLISWWYARTDANTAAIQAILY
NU5M_GADMO      TWYMHSDPFMNRFFKYLLTFLVAMLILVSANNLFQLFIGWEGVGIMSFLLIGWWHGRADANTAALQAVLY
NU5M_XENLA      TWYMASDPMISRFFKYLLTFLVAMVILVTANNFFQFFIGWEGVGIMSFLLIGWWYARAEPNTAALQAVIY
MNHA2_STAS1     TQYLSKEHDNPRFYVYLLLFMFSMLGIVTANNTILMYVFWELTSVSSFLLIVYWYSKGDSQFGAIQSFMI
NU5M_CHICK      TWYMASEPFITKFFTYLLTFLIAMLTLTIANNMFLLFVGWEGVGIMSFLLIGWWQGRAEANTAALQAMIY
NU5M_TETNG      SWYMHADPFMNRFFKYLLTFLIAMIILVTANNMFQLFIGWEGVGIMSFLLIGWWYARADANTAALQAVLY
NU5C_MORIN      DNYMSHDQGYLRFFAYMSFFNTSMVGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPTAANACQKAFVT
NU5C_AETGR      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
MNHA1_STAES     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNFIILYLFWEXXXXXXXXXXXXWREKKASIYGAQKSLII
MNHA1_STAEQ     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNFIILYLFWEXXXXXXXXXXXXWREKKASIYGAQKSLII
NUOL_RICBR      LGYMSRDKGIVRXXXXXXXXXXXXXXXVSADNFLQLFFGWEGVGICSYLLIG------------------
NU5C_ADICA      DSYMCYDRGYTRFYAYLSLFTASMLGLVLSPNLIQLYVFWELVGMCSYLLVGFWFARSSAANACQKAFVT
NU5C_BUXMI      DNYMSHDQGYLRFFAYMSFSNISMLGLVTSSNLIQIHIFWELVGVCSYLLIGFWFTRPIAANACQKAFVT
NU5M_CROLA      SWYMHADPYVNRFFKYLLTFLIAMITLVTANNMFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAWIY
NU5M_CHLRE      CDYMRQDPHLNLFLGYLSYFTGFMCVLVAADNLLVMLVGWEGIGVCSYLLIGYWSHRLSAVKSAQKAILV
NU5M_SALSA      SWYMHADPNMNRFFKYLLLFLIAMIILVTANNMFQLFIGWEGVGIMSFLLIGWWYGRADANTAAMQAVIY
NU5C_MESVI      DGYMSYDEGYVRFFAYLSLFTTSMLGLVLSPNLLQIYVFWELVGMCSYLLIGFWFTRPAAADACQKAFVT
MRPA_BACPF      IFYLSKKTSLNNFYVYLLMFMGAMLGVVLSDNLIVLYVFWELTSLASSLLISYWFHREKSTYGAQKSMLI
MNHA1_STAS1     ISYLSRQEQLGHFYCYLLLFMGAMLGLVLSDNLIILYLFWEXXXXXXXXXXXXWRDKQASIYGAQKSMLV
NU5M_ELEMA      LWYMHSDPHINRFFKYXXXXXXXXXXXVSANNLLQLFMGWEGVGIMSFLLISWWHGRTDANTAALQAMLY
NU5C_AGRST      DGYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPLAASACQKAFVT
NU5C_SACOF      DDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5C_SACHY      DDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVT
NU5M_MAMPR      LWYMHSDPHINRFFKYXXXXXXXXXXXVSANNLLQLFMGWEGVGIMSFLLISWWHGRTDANTAALQAMLY
MNHA2_STAHJ     TQYLSNRDNLPRXXXXXXXXXXXXXGIVVSNNTILMYVFWELTSVSSFLLISYWYSNAESQLGAIQSFII
NU5C_JASNU      DNYMAHDQGYLRXXXXXXXXXXXXLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVT
NU5M_BRALA      FYYMSTDPRIDLFCKYLGLFLIAMLLLVSAESLFQLLIGWEGVGIMSYLLISWWYARSDANTAALQAIFY
NU5C_AETCO      DNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVT
NU5M_DANRE      SWYMASYPQXXXXXXXXXXXXMSMIILVTANNLFQLFIGWEGVGIMSFLLIGWWFGRTEANTASLQAVIY
NU5M_PELSU      KWYMASDRDLKKXXXXXXXXXXXXXXXXAANNFFPMLVGWGTMGLMSYLLISWWHGRTEATTSGLQAILY
NU5M_BRAFL      FYYMSTDPRIDLFCKYLGLFLIAMLLLVSAESLFQLLIGWEGVGIMSYLLISWWYARSDANTAALQAIFY
MNHA1_STAHJ     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNLIILYLFWEXXXXXXXXXXXXWREKKASIYGAQKSLII
NU5M_PICCA      --YMKDDSHNPRFYTYLALFTLFMIILVLGDNYLILFLGWEYIGIASFLLIGFWYNNIDNIKSSLNALFI
NU5C_PHAVU      DNYMSHDQGYLRFFAYMTLFNISMLGLVTSSNLIQIYFFWELIGMCSYLLIGFWFTRPIAANACQKAFVT
MNHA2_STAAR     TQYLSSRKDNPRFYLYLTLFMFSMLGIVLADNTILMYVFWELTSVSSFLLISYWYNNGDSQFGAMQSFMI
NU5M_STRPU      FYYMTEDPNSSAFFRXXXXXXXXXXXXXCSNSLFLIFLGWEGGGFLSFLLISWWTTRNDASSSALEAVIT
NU5M_YARLI      IGYMETDPHQVRFFSLLSMFTFWMIILVTGSNYFVLFVGWEFIGVTSYLLISFWVTRLQAMKSALSAVLM
MNHA2_STAAN     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAAM     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAA9     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAA2     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAA1     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAAW     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAMQSFMI
MNHA2_STAAU     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAAT     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAAS     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAMQSFMI
MNHA2_STAAE     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAAC     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAA8     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA2_STAA3     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGAIQSFMI
MNHA1_STAAR     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAAW     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAAU     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAAT     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAAS     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAAN     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAAM     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAAE     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAAC     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAA9     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAA8     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAA3     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAA2     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
MNHA1_STAA1     IGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
NUOL_BUCAP      TWYMKDKEGYSRFFAYTNLFIASMSLLVLADNFLFMYLGWEIVSICSYLLIGFYYKTTNNTSCALKAFVF
MNHA2_STAAB     TQYLSSRKDNPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDNQFGAIQSFMI
MNHA1_STAAB     IGYLNKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQASIYGAQKSLII
NU5M_LUMTE      ----------------------------------------------------------------------
NU5M_CANAL      IEYMSHDPNRNRFYIILSIFAVFMTILVVSDNYLMMFIGWEFVGVISYLLISFWSTRITAMKSALSAILL
NU5M_CANPA      IEYMSHDPNRNTFYIILSVFAIFMTILVVSDNYIMMFIGWEFVGVISYLLISFWSTRIAAMKAALSAILL
NU5M_ASTPE      ------------------------------------FIGWEGVGFLSFLLISWWTSRANANNSAIQAVIY
HYFD_ECOLI      TGYLTDKNGTNRYYAFLLVFIGAMAXXXXXXXXXXXXXFFEITGGCSWALISYYQSD-KAQRSALKALLI
NU5M_ALBCO      NEYMSEDHYNIRFGWILISFVASMGILILSGSIFTXXXXXXXXXXTSFALIA-YYDNYNASSSAFLTL-M
NU5M_DROME      ----------------------------------------------------------------------
NU5M_DROYA      ----------------------------------------------------------------------
NU5C_PEA        ----------------------------------------------------------------------
NU5H_NYCOV      VEYMLREAFAYNVLATLVLFSASIICFIVSYSFGLMIIFWEISGTLSLFLIDMYYARIRTTQAVTRTFAL
NU5M_RHISA      ----------------------------------------------------------------------
NU5M_ARTSF      SYYMMGETFVNRFMYMMLGFISSMVLLIMSSDGLSLMLGWDGLGITSYLLI-MFYKNYNSSSSGMITILS
NU5M_MYTED      KWYMAEELYYNRFMGLVWLFVLSMVFMILVPNLLMLLIGWDGLGLTSFLLVAYYQNN-KSLSAAMLTALT
NU5M_ASCSU      ----------------------------------------------------------------------
NU5M_AEDAE      ----------------------------------------------------------------------
NU5M_LOCMI      NDYMHNEKNINRFIMIVLMFILSMAFXXXXXXXXXXXXGWDGLGLVSYCLV-IYYQNVKSYNAGMLTALS
NU5C2_PAUCH     ----------------------------------------------------------------------
NU5M_PARTE      ----------------------------------------------------------------------
NU5M_PEA        -----------RFMCYLSILTFFMPMLVTGDNSLQLFLGWEGVGLASYLLIHFWFTRLQADKAATKAMPV
NU5M_ANOGA      ----------------------------------------------------------------------
NU5M_ANOAR      ----------------------------------------------------------------------
NU5M_ANOQU      ----------------------------------------------------------------------
NU5M_APILI      ----------------------------------------------------------------------
MRPD_BACPF      ----------------------------------------------------------------------
NUOM_PSEAE      ----------------------------------------------------------------------
Y051_MYCTU      IGYVRREHLGRVPMAVVPLFVAAMLLVPAAGSVTTFLLAWELMAIASLILVLSEHARPQVRSAGLWYAVM
NUOM_RICPR      ----------------------------------------------------------------------
NU5M_CAEEL      ----------------------------------------------------------------------
HYFB_ECOLI      ----------------------------------------------------------------------
NUOM_ECOLI      ----------------------------------------------------------------------
NUOM_ECO57      ----------------------------------------------------------------------
NUOM_RICBR      ----------------------------------------------------------------------
NU5M_ANOQN      ----------------------------------------------------------------------
NUOM_RICFE      ----------------------------------------------------------------------
NQO13_PARDE     ----------------------------------------------------------------------
MRPD_BACSU      FRSVGEKRERSFYYSGVQFLLAGVSGAFLTGDLFNMYVFFELLLIASYMLIVLGGTKIQLRES-LKYIVF
NU5M_TRYBB      ----------------------------------------------------------------------
NUOM_RICCN      ----------------------------------------------------------------------
NUOM_RHOCA      ----------------------------------------------------------------------
MNHD2_STAS1     ----------------------------------------------------------------------
HYCC_ECOLI      ----------------------------------------------------------------------
MNHD1_STAES     ----------------------------------------------------------------------
MNHD1_STAEQ     ----------------------------------------------------------------------
NUOM_RICTY      ----------------------------------------------------------------------
NU4C2_SYNJA     ----------------------------------------------------------------------
MNHD2_STAAR     ----------------------------------------------------------------------
MNHD2_STAHJ     ----------------------------------------------------------------------
MNHD1_STAAW     ----------------------------------------------------------------------
MNHD1_STAAU     ----------------------------------------------------------------------
MNHD1_STAAT     ----------------------------------------------------------------------
MNHD1_STAAS     ----------------------------------------------------------------------
MNHD1_STAAR     ----------------------------------------------------------------------
MNHD1_STAAN     ----------------------------------------------------------------------
MNHD1_STAAM     ----------------------------------------------------------------------
MNHD1_STAAE     ----------------------------------------------------------------------
MNHD1_STAAC     ----------------------------------------------------------------------
MNHD1_STAAB     ----------------------------------------------------------------------
MNHD1_STAA9     ----------------------------------------------------------------------
MNHD1_STAA8     ----------------------------------------------------------------------
MNHD1_STAA3     ----------------------------------------------------------------------
MNHD1_STAA2     ----------------------------------------------------------------------
MNHD1_STAA1     ----------------------------------------------------------------------
MNHD2_STAAW     ----------------------------------------------------------------------
MNHD2_STAAU     ----------------------------------------------------------------------
MNHD2_STAAT     ----------------------------------------------------------------------
MNHD2_STAAS     ----------------------------------------------------------------------
MNHD2_STAAN     ----------------------------------------------------------------------
MNHD2_STAAM     ----------------------------------------------------------------------
MNHD2_STAAE     ----------------------------------------------------------------------
MNHD2_STAAC     ----------------------------------------------------------------------
MNHD2_STAAB     ----------------------------------------------------------------------
MNHD2_STAA9     ----------------------------------------------------------------------
MNHD2_STAA8     ----------------------------------------------------------------------
MNHD2_STAA3     ----------------------------------------------------------------------
MNHD2_STAA2     ----------------------------------------------------------------------
MNHD2_STAA1     ----------------------------------------------------------------------
NU4C2_SYNJB     ----------------------------------------------------------------------
NU4M_MARPO      VKSYKKEY-MIAFFICESFLIAVFCSLDLLIF----YVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLY
NU4C2_ANASP     ----------------------------------------------------------------------
NU4C1_ANAVT     ----------------------------------------------------------------------
NU4C_ACAM1      ----------------------------------------------------------------------
NU4M_CHOCR      ------------------------------------YIYFESVLIPMFLIVGVWGSRQRKIRAAYQFFLY
NUON_ERWT9      YPWLATYPNREEFYXXXXXXXXXXXXXXXXXHLASLFIGIELISLPLFGLVGYAFQQKRSLEAAIKYTIL
NU4M_ARATH      ----------------------------------------ESVLIPMFIIIGVWGSRQRKIKAAYQFFLY
NU4C3_SYNP2     ----------------------------------------------------------------------
NU4C3_ANASP     ----------------------------------------------------------------------
NU4C2_SYNP6     ----------------------------------------------------------------------
NU4C2_SYNE7     ----------------------------------------------------------------------
NU4C2_ANAVT     ----------------------------------------------------------------------
NU4C_SYNR3      ----------------------------------------------------------------------
NU4C_PROM5      ----------------------------------------------------------------------
NU4C2_MICAN     ----------------------------------------------------------------------
NDHF_BACSU      VRYLMGDRSYRKYFTLFTFTTGAASMTWLSGDLRLMVLFWGATLVGLTLLIRLNSAWQVASEAAKISGRX
MNHD2_STAES     ----------------------------------------------------------------------
MNHD2_STAEQ     ----------------------------------------------------------------------
NU4M_WHEAT      ----------------------------------------------------------------------
NU2C_SYNJA      ------------------------------------FVSLETLGIASYLMAGYTKRDPRSSEAALKYLLT
NU4C_PROMP      ----------------------------------------------------------------------
NU4C_PROM4      ----------------------------------------------------------------------
NU4C_PROMM      ----------------------------------------------------------------------
NU4C_PROMA      ----------------------------------------------------------------------
NU4C2_SYNY3     ----------------------------------------------------------------------
NU4C2_SYNP2     ----------------------------------------------------------------------
NU4C_SYNS3      ----------------------------------------------------------------------
NU4C_SYNPX      ----------------------------------------------------------------------
NU4C_PROMT      ----------------------------------------------------------------------
NU4C_PROM1      ----------------------------------------------------------------------
NU4C1_THEEB     ----------------------------------------------------------------------
NU4C_SYNSC      ----------------------------------------------------------------------
NU4C_PROMS      ----------------------------------------------------------------------
NU4C_PROM3      ----------------------------------------------------------------------
NU4C_PROM2      ----------------------------------------------------------------------
NU4C_PROM0      ----------------------------------------------------------------------
NU4C1_SYNJA     ----------------------------------------------------------------------
NU4M_PROWI      ------------------------------------YIFFESVLIPMFIIIGVWGSRERKIRAAYQFFLY
NU4C1_TRIEI     ----------------------------------------------------------------------
NU4C1_SYNJB     ----------------------------------------------------------------------
Y1309_METJA     ----------------------------------------------------------------------
NU4M_BRACM      ----------------------------------------ESVPIPMFIIIGVWGSRQRKIKAAYQFFLY
NU4C_SYNS9      ----------------------------------------------------------------------
NU4C_SYNPW      ----------------------------------------------------------------------
NU4C_PROM9      ----------------------------------------------------------------------
NU4C_GLOVI      ----------------------------------------------------------------------
NU2C_SYNP6      IRYVEQSGTSLGEFITLTASLGGMFLSGANELVTI-FVSLETLSISSYLLTGYMKRDPRSNEAALKYLLI
NU2C_SYNE7      IRYVEQSGTSLGEFITLTASLGGMFLSGANELVTI-FVSLETLSISSYLLTGYMKRDPRSNEAALKYLLI
NUON2_RHIME     --------GRSEYYVLLLFALVGMMIMASAIDLLSIYVGLELMVLCTYVLTGFLRKERRSNEAALKYVIL
NU4C_ANTFO      ----------------------------------------------------------------------
NU2C_CHAGL      ----------------------------------------------------------------------
NU4C2_THEEB     ----------------------------------------------------------------------
NU4C_NEPOL      ----------------------------------------------------------------------
NU4C2_TRIEI     ----------------------------------------------------------------------
NU4C1_SYNY3     ----------------------------------------------------------------------
NU4C1_SYNP6     ----------------------------------------------------------------------
NU4C1_SYNE7     ----------------------------------------------------------------------
NU2C_STAPU      ----------------------------------------------------------------------
NU4C3_ANAVT     ----------------------------------------------------------------------
NU4C1_ANASP     ----------------------------------------------------------------------
NU2C_CYAP7      ----------------------------------------------------------------------
NUOM_MYCTU      ----------------------------------------------------------------------
NU2C_ACAM1      VRYIEQSGSSIGEFVLLTATVGAMFLCGAEELVMI-FISLETLSIASYLMTGYMKRDSRSNEAALKYLLI
NUON_MYCTU      ----------------------------------------------------------------------
NUON_MYCBO      ----------------------------------------------------------------------
NU4C1_SYNP2     ----------------------------------------------------------------------
NU2C_NEPOL      ------------------------------------FVSLETLGLASYLLTGYMKRDVRSNEASLKYLLV
NU4M_ASTPE      ----------------------------------------------------------------------
NU4C_ZYGCR      ----------------------------------------------------------------------
NU4C_MARPO      ----------------------------------------------------------------------
NU2C_PHYPA      ----------------------------------------------------------------------
HYFF_ECOLI      IGYMRHEVAHGEYYGFFHLFLFTMLLVVTSNNLIVMWAAIEATTLSSAFLVGIY-GQRSSLEAAWKYIII
NU4M_METSE      ------------------------------------YILFEGILIPMFLLIGVWGSREEKVRASYYFFFY
NU2C_PROMT      ------------------------------------FVSLETLSVASYLLSGYLKRDSRSSEAALKYLLV
NU2C_SYNP2      ----------------------------------------------------------------------
NU2C_MARPO      ----------------------------------------------------------------------
NU4C_PHYPA      ----------------------------------------------------------------------
NU4C_IPOPU      ----------------------------------------------------------------------
NU2C_PROMM      ----------------------------------------------------------------------
NU2C_PROM3      ----------------------------------------------------------------------
NU2C_CYAP8      ----------------------------------------------------------------------
NUON_PSEAE      ----------------------------------------------------------------------
NU4M_ACACA      ----------------------------------------------------------------------
NU2C_TRIEI      ----------------------------------------------------------------------
NU2C_CHAVU      ----------------------------------------------------------------------
NU2C_MICAN      IRYV-EQAGTSEFLAMLTATLGGMFLSGASELVMI-FISLEMLSISSYLMTGYMKRDPRSNEAALKYLLI
NU4M_STRPU      ----------------------------------------------------------------------
NU4C_ADICA      ----------------------------------------------------------------------
NU2C_SYNS9      ----------------------------------------------------------------------
NU2C_SYNPW      ----------------------------------------------------------------------
NU2C_PAUCH      ------------------------------------FVSLETLSVSSYLLAGYMKQDARSSEAALKYLLV
NU4C_CHLAT      ----------------------------------------------------------------------
NU2C_SYNS3      ----------------------------------------------------------------------
NU2C_SYNPX      ----------------------------------------------------------------------
NU2C_CYAA5      ----------------------------------------------------------------------
NU2C_CHLAT      ----------------------------------------------------------------------
NU4M_MYXGL      ----------------------------------------------------------------------
NU4C_MESVI      ----------------------------------------------------------------------
MNHD1_STAHJ     ----------------------------------------------------------------------
NU4C_CRYJA      ----------------------------------------------------------------------
NU2C_PROMA      ----------------------------------------------------------------------
NU2C_ADICA      ----------------------------------------------------------------------
NU4C_NYMAL      ----------------------------------------------------------------------
NU2M_ARATH      ----------------------------------------------------------------------
NQO14_PARDE     ----------------------------------------------------------------------
NUON_RHOCA      ----------------------------------------------------------------------
NU4C_ANGEV      ----------------------------------------------------------------------
NU4C1_MICAN     ----------------------------------------------------------------------
NU2C_PSINU      ------------------------------------FVASECLALSSYLLSGYTKRDVRSNEAMMKYLLM
NU2C_MESVI      ----------------------------------------------------------------------
NU4C_POPTR      ----------------------------------------------------------------------
NU4C_POPAL      ----------------------------------------------------------------------
NU4M_PARLI      ----------------------------------------------------------------------
NU4C_HUPLU      ----------------------------------------------------------------------
NU4C_NUPAD      ----------------------------------------------------------------------
NU4C_LOTJA      ----------------------------------------------------------------------
NU4C_EUCGG      ----------------------------------------------------------------------
NU2C_ZYGCR      ----------------------------------------------------------------------
NU2C_CYCTA      ------------------------------------FVALECFSLCSYLLSGYTKRDVRSNEATMKYLLM
NUON_RICTY      ----------------------------------------------------------------------
NU4M_USTMA      ------------------------------------YVFFESVLIPLFLIVGIWGGSATRVRAAFLLFLY
NU4C_PSINU      ----------------------------------------------------------------------
NU2M_OENBE      ----------------------------------------------------------------------
NUOM_BUCBP      ----------------------------------------------------------------------
NUOM_BUCAP      ----------------------------------------------------------------------
NU4C_TOBAC      ----------------------------------------------------------------------
NU4C_NICSY      ----------------------------------------------------------------------
NU4C_DRIGR      ----------------------------------------------------------------------
NU2C_ANTFO      ----------------------------------------------------------------------
NU4C_PELHO      ----------------------------------------------------------------------
NU4C_AETCO      ----------------------------------------------------------------------
NU4C_OENPA      ----------------------------------------------------------------------
NU4C_OENAR      ----------------------------------------------------------------------
NU4C_MANES      ----------------------------------------------------------------------
NU4C_ILLOL      ----------------------------------------------------------------------
NU4C_CARPA      ----------------------------------------------------------------------
NU4C_AETGR      ----------------------------------------------------------------------
NU2M_LUMTE      ----------------------------------------------------------------------
NUON_RICPR      ----------------------------------------------------------------------
NUOM_BUCAI      ----------------------------------------------------------------------
NU4C_NICTO      ----------------------------------------------------------------------
NU4C_HORVU      ----------------------------------------------------------------------
NU4C_CYCTA      ----------------------------------------------------------------------
NU4C_CHAVU      ----------------------------------------------------------------------
NU4C_BUXMI      ----------------------------------------------------------------------
NU4C_ARATH      ----------------------------------------------------------------------
NU2M_NEUCR      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMA
NU5C_SYNP2      NRVGDFXXXXXXXXXYWATGSFEFDLMGDRLMDLVSTGQISSXXXXXXXXXXVAKSAQFPLHVWLPDAME
NU5C1_PAUCH     NRVXXXXXXXXXXXXXWATNSFDFQKMAASISDGSIPHWAAIALCLLLFMGPMAKSAQFPLHVWLPDAME
NU5M_OENBE      NRVGDFGLALGILGCFTLFQTVDFSTIFACASSCNMRLNAITLICILLLIGAVGKSAQIGLHTWLPDAME
NU5C_SYNY3      NRVGDFXXXXXXXXXYWATGSFDFGTIGERLESGVLSGXXXXXXXXXVFLGPVAKSAQFPLHVWLPDAME
NU5M_WHEAT      NRVGDFGLALGIFGCFTLFQTVDFSTIFACASAPRNEWIFCNMRLNAITLICIGKSAQIGLHTWLPDAME
NUOL_RICFE      NRASDFAFILGIITIIVYCGSANYKDVFSSAEKIFLQFSILDVICLLLFIGCMGKSAQIGLHVWLPDAME
NQO12_THET8     NRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDXXXXXXXXXXXXXXXKSAQIPLMVWLPDAMA
NU5M_ARATH      NRVGDFGLALGILGCFTLFQTVDFSTIFACASVPRNSWIFCNMRLNAISLICIGKSAQIGLHTWLPDAME
NU5C_PHYPA      NRXXXXXXXXXXXXXYWITGSFEFEILFKRFNDLVINHEVNLYFANFCALLLIAKSAQFPLHIWLPDAME
NU5M_MARPO      NRVGDFGLALGIMGCFTIFQTVDFSTIFACASAFSEPHHYFLFCNMGFHAITVGKSAQIGLHTWLPDAME
NU5C_SPIOL      NRVGDFXXXXXXXXXYWITGSFEFRDLFELIKNNEVNSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NUOL_PSEAE      TRVGDVFMAFGLFILFQQFGTLNIQELLVLAQKFPEGNLWXXXXXXXXXXXXVGKSAQLPLQTWLADAMA
NU5M_DICDI      NRXXXXXXXXXXXXXXXXXKSVDIAPFITEINLLGYEVNAITLIGSFIVIGVVGKSAQLGLHMWLPDAME
NUOL_ECOLI      TRVGDVFLAFALFILYNELGTLN---FREMVEHFADGNNMLMWATLMLLGGAVGKSAQLPLQTWLADAMA
NU5M_RABIT      NRIGDIGFIMALAWFAINLNTWELQQIF------ILDNNITILPLMGLILAATGKSAQFGLHPWLPSAME
NU5M_DICCI      NRXXXXXXXXXXXXXXXXXKSVDVAPFITEINLLGYEVNAITLIGSFIVIGVVGKSAQLGLHMWLPDAME
NU5C_CHAGL      NRVXXXXXXXXXXXXYWLTGSFQ----FDIIQDRXXXXXXXXXXXXXXXIISIAKSAQFPLHIWLPDAME
NU5C_SOLTU      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIYNNEVNFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDAME
NU5C_SOLLC      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIYNNELNFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDAME
NU5C_SOLBU      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIYNNEVNFLFVTLCAVLLFAGAVSKSAQFPLHVWLPDAME
NU5M_HIPAM      NRIGDVGFIMAMAWFLSNLNTWDMQQIFM------INPTHSNLPLMGLILAATGKSAQFGLHPWLPSAME
NU5C_PIPCE      NRVGDFXXXXXXXXXYWITGSFEFRDLFELVHNNTINXXXXXXXXXXXXXGAIAKSAQFPLHVWLPDAME
NU5C_IPOPU      NRVXXXXXXXXXXXXYWITGSFEFRELFQLISSKEVNLLFVTLCAALLFVGAIAKSAQFPLHVWLPDAME
NU5M_METSE      NRVGDIGFVLAMLAIWDQFGCLDFASVFNIVA--LAPSDNTTLICLFLFIGAVGKSAQLGLHTWLPDAME
NU5M_HALGR      NRIGDVGFIMAMAWFLINLNTWELQQIF------ISHHNNLNVPLMGLLLAATGKSAQFGLHPWLPSAME
NU5C_PLAOC      NRVGDFXXXXXXXXXYWITGSFEFRDLFELIYNNRVNSLFVTLCASLLFVGAVAKSAQFPLHIWLPDAME
NU5M_PHOVI      NRIGDVGFIMAMAWFLINLNTWELQQIF------ISHHXXXXXXXXXXXXAATGKSAQFGLHPWLPSAME
NU5C_ATRBE      NRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLSSNNEVNFLFVTLCAVLLVAKSAQFPLHVWLPDAME
NU5C_TOBAC      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIYNNEVDFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDAME
NU5C_TECST      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNSPFVTLCAALLFAGAVAKSAQFPLHIWLPDAME
NU5C_NICSY      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIYNNEVDFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDAME
NU5C_NEPOL      NRVGDFGLLLGILALYWMTGSFEFASIADRLGDLLIAIPSLRTIACIACILVIAKSAQFPLHVWLPDAME
NU5C_DRIGR      NRVGDFXXXXXXXXXYWITGSFEFRDLFELIHNNGVNSLFATLCASLLFAGAVAKSAQFPLHVWLPDAME
NU5C_COFAR      NRXXXXXXXXXXXXXYWITGSFEFRDLFELIYDNEVNSLFVTLCAGLVFAGAVAKSAQFPLHVWLPDAME
NU5C_ACOCL      NRVGDFXXXXXXXXXYWITGSFEFRDLFELIHNNEVNXXXXXXXXXXXXVGAVAKSAQFPLHVWLPDAME
NU5C_ACOAM      NRVGDFXXXXXXXXXYWITGSFEFRDLFELIHNNEVNXXXXXXXXXXXXVGAVAKSAQFPLHVWLPDAME
NU5C_LACSA      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNFLFVTLCAILLFAGAIAKSAQFPLHVWLPDAME
NUOL_MYCTU      NRVGDAGLAVGMFLTFSTFGTLSYAGVFAGVP--AASRAVLTAIGLLMLLGACAKSAQVPLQAWLGDAME
NU5C_CICIN      NRVXXXXXXXXXXXXYWITGSFEFSDLFQLISNNEVNFLFVTLCAILLFAGAIAKSAQFPLHVWLPDAME
NU5C_CUCSA      NRVGDFXXXXXXXXXYWTTGSFEFRDLFQLIDNNEVNFLFLTLCAVLLFAGAVAKSAQFPLHVWLPDAME
NU5M_SORFM      NRIGDIGFILAMAWFLFNSNSWELQQIFM------LDTNQNXXXXXXXXXAATGKSAQFGLHPWLPSAME
NU5C_BRADI      NRXXXXXXXXXXXXXXXXTGSLEFRDLFQTIPNNGXXXXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_ATHGR      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNFLFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5C_AMBTR      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNFLFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5C_ADEHI      NRVXXXXXXXXXXXXYWITGSFEFRNLFQLISNNEVNLLFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5M_PIG        NRIGDIGFVLSMAWFLTHSNAWDLQQIFMLNNE------CPNMPLIGLLLAAAGKSAQFGLHPWLPSAME
NU5M_CRYPA      NRVGDCFLTIGMFAILWSLGNLDYATVFSLAP--YXXXXXXXXXXXXXXXGAMAKSSQVGLHVWLPMAME
NU5C_PSINU      NRVGDFXXXXXXXXXYWITGSFEIHDLSERFDEXXXXXXXXXXXXXTCAILLVAKSAQFPLHVWLPDAME
NU5C_NICTO      NRVXXXXXXXXXXXXYWITGSXXXXXXXXXIYNNEVDFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDAME
NU5C_GOSBA      NRXXXXXXXXXXXXXYWITGSFEFQDLFELIYNNEVHFLFVTLCASLLFAGAVAKSAQFPLHVWLPDAME
NU5M_CANLU      NRIGDVGFIMTMAWFLLNLNTWDLQQIFITTNDNFNXXXXXXXXAAT------GKSAQFGLHPWLPSAME
NU5C_GERJA      NRVXXXXXXXXXXXXYWITGSFEFRNLFQLISNNEVNFLFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5C_DIGGR      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIVNNQVNYLFVTLCAALLFAGAVAKSAQFPLHVWLPDAME
NU5C_CHAVU      NRIGDFCLLLGILGLYWFTNSFDFITVTKRTEEIISNNNSHLYFFIFCSFLLIAKSAQFPLHIWLPDAME
NU5C_ATRJA      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNFVFVTLCAVLLFAGAVAKSAQFPLHVWLPDAME
NU5M_RHIST      NRVGDWGFSIGLWAIFWTFGNLDFTTVFSLAP--FINEELITIISICLLVAAMGKSAQIGLHTWLPDAME
NU5C_HELAN      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNSVFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5M_CHOCR      NRVGDFGLSLGIFLIFWVFNSVDLVPLFQFLTFLGFKLHVLTLISLFLFIGAIGKSAQLGLHTWLPDAME
NU5C_MANES      NRVGDFXXXXXXXXXYWITGSFEFRDLFKLIYNNQVNFLFVTLCAVLLFSGAIAKSAQFPLHVWLPDAME
NU5M_PHYIN      NRISDLILLLGVLTIFYNIRTIEYFSTFAAVKDFKFIFFNYILSIIDVACILIGKSAQIFLHLWLPDAME
NU5C_SESIN      NRVXXXXXXXXXXXXYWITGSFEFQDLFELIYNNQVNSPFVTLCAALLFAGAVAKSAQFPLHVWLPDAME
NUOL_RICPR      NRVSDFAFILGIITIIVYYGSANYKDVFSSAKKIFVHFSILDIICLLLFIGCMGKSAQIGLHVWLPDAME
NU5M_POLOR      NRVGDIGLMMTMSWLLINTNSWDIQQLFGLTKNMDXXXXXXXXXXXXXX-----KSAQFGLHPWLPAAME
NU5C_GOSHI      NRXXXXXXXXXXXXXYWITGSFEFQDLFELIYNNEVHFLFVTLCASLLFAGAVAKSAQFPLHVWLPDAME
NU5C_FLARA      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNLLFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5C_DAMDI      NRVGDFXXXXXXXXXYWITGSFEFRDLFQLISNNEVNFLFVTFCALLLFTGAIAKSAQFPLHVWLPDAME
NU5M_ALLMA      NRVGDXXXXXXXXXXXXXXXSSDYDTV--GIIAYKLDEQYITIVTLFLLIAAIGKSAQLGLHTWLPSAME
NU5C_GUIAB      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNFVFVTLCAILLFAGAIAKSAQFPLHVWLPDAME
NU5C_CRYJA      NRAXXXXXXXXXXXXYWVTGSFEFQYLSEKLNELTAIDGVGSFFVTSCAFLLVAKSAQFPLHVWLPDAME
NU5M_SCYCA      NRIGDIGLILSMAWLAMNLNSWEIQQIFILSKDKDXXXXXXXXXXXXX-----GKSAQFGLHPWLPSAME
NU5M_DASNO      NRIGDIGFILTMAWLLLHLNSWDLQQIFM-------LKPTNXXXXXXXXVAAAGKSAQFGLHPWLPSAME
NU5C_LIRTU      NRVXXXXXXXXXXXXYWITGSLEFRDLFELIHTNGVNSLFATLCAFLLFVGAVAKSAQFPLHVWLPDAME
NUOL_CAMJE      NRIADLGMLLGIFWLYLQAGTLKYDEVFSMAQSLDHNALILIATCLFIGA--MGKSAQFPFHTWLADAMA
NU5M_RHIUN      NRIGDIGFIMSMAWFLSNMNSWDLQQIFT------LDPNHTNLPLMGLLLAATGKSAQFGLHPWLPSAME
NU5M_DUGDU      NRIGDVGFVAAMAWFLLHSNSWELQQIFLTV------PKGNTLPLTGLLLAAMGKSAQFGLHPWLPSAME
NU5C_LOLPR      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNGINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_HORVU      NRVXXXXXXXXXXXXXWITGSLEFRDLFQWIPNNGINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5M_LEMCA      NRIGDIGFILAMAWFLMYSNTWE----FQQM--FMLNYHPDMIPLIGLLLAATGKSAQFGLHPWLPSAME
NU5M_NEUCR      NRVGDCFLTIGMFVVLWTLGNLDYATVFSLAP--YINSDIATIIGICLLIGAMAKSSQVGLHVWLPMAME
NU5M_GEOPE      NRVGDIGLVIAMAWFYKNSNSWELQQIFS-------LGTTSNLPLIGLILAAMGKSAQFGLHPWLPSAME
NU5C_CYCTA      NRXXXXXXXXXXXXXYQITGSFKFRYLLESIASNEVSSXXXXXXXXXXXXGPVAKSAQFPLHVWLPDAME
NU5M_PENMA      NRVGDCFLTIGIFAMLWSFGNIDLAPYYNE--------NIITMIGICLVIGATAKSSQVGLHIWLPQAME
NU5C_NYMAL      NRVXXXXXXXXXXXXXXXXXSFEFQDLXXXXXXXXXXXXXXXXXXATLCAFLVAKSAQFPLHVWLPDAME
NU5M_HORSE      NRIGDIGFIMAMAWFLFNTNTWDLQQIFM------LDXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAME
NU5M_BOSIN      NRIGDIGFILAMAWFLTNLNTWDLQQIFM------LNPSDSNMPLIGLALAATGKSAQFGLHPWLPSAME
NU5C_LEMMI      NRVXXXXXXXXXXXXYWITGSFEFRDLFETFNNNEGNSLFPTLCAFLLFLGAIAKSAQFPLHVWLPDAME
NU5C_CAPBA      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIYNNEVNFLFVTLCAVLLFVGAVAKSAQFPLHVWLPDAME
NU5M_SHEEP      NRIGDIGFILAMAWFLINLNTWDLQQIFM------LNPNDSNLPLMGLILAATGKSAQFGLHPWLPSAME
NU5M_EQUAS      NRIGDIGFIMAMAWFLFNTNTWDLQQIFM------LDXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAME
NU5M_BOVIN      NRIGDIGFILAMAWFLTNLNTWDLQQIFM------LNPSDSNMPLIGLALAATGKSAQFGLHPWLPSAME
NU5C_CARPA      NRVGDFXXXXXXXXXYWITGSFEFQDLFELIYNNQVHFLFVTLCAFLLFAGPVAKSAQFPLHVWLPDAME
NU5M_PODAN      NRVGDCFLTIGMFAILWSLGNLDYSTVFSLAP--YINSKVVXXXXXXXXXXAMAKSSQVGLHVWLPMAME
NU5M_BALPH      NRIGDIGLLASMAWFLSNMNTWDLEQIFMLNQN------PLNFPLMGLVLAAAGKSAQFGLHPWLPSAME
NU5M_BALMU      NRIGDIGLLASMAWFLSNMNTWDLQQIFMLNQN------PLNFPLMGLVLAAAGKSAQFGLHPWLPSAME
NU5M_ASPNG      NREGDTLLTVGMFAILWSFGNIDLAPYYNE--------NXXXXXXXXXXXXXXXKSSQVGLHIWLPQAME
NU5C_CERDE      NRVGDFXXXXXXXXXYWITGSFEFRDLFELIPNNGVNSXXXXXXXXXXXXXXVAKSAQFPLHVWLPDAME
NU5M_CANFA      NRIGDVGFIMTMAWFLLNLNTWDLQQIFITTNDNFNXXXXXXXXAAT------GKSAQFGLHPWLPSAME
NU5C_POAPR      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNGINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_ILLOL      NRVGDFXXXXXXXXXYWITGSFEFRDLFKLIHNNGVNSLFVTFFASLLFLGAVAKSAQFPLHIWLPDAME
NU5C_ANTFO      NRXXXXXXXXXXXXXYWITGSFEFENLFKGFKDLLINNEVSPFFAILCASFLVAKSAQFPLHVWLPDAME
NUOL_RICTY      NRVSDFAFXXXXXXXXXYNGSANYKDVFLSAKKILVHFXXXXXXXXXXXXXXXXKSAQIGLHVWLPDAME
NU5C_SORBI      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNGINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_NUPAD      NRVXXXXXXXXXXXXXXXXXSFEFQDLXXXXXXXXXXXXXXXXXXATLCAFLVAKSAQFPLHVWLPDAME
NUOL_RICCN      XXXSDFAFILGVITIIVYCGSANYKDVLSSAEKIFLHFSILDIICLLLFIGCMGKSAQIGLHVWLPDAME
NUOL_RHOCA      NRVGDFGFALGIMGLFFLTDSIDMDVIFASAPELAKTELHFLAWEFXXXXXXMGKSAQLFLHTWLPDAME
NUOL_BUCAI      TRVSDVFLMIGMFLIYREFNSFNFQEIFLNVENFYYLDYITLFLLLGV----IGKSAQLPLQTWLSDAMV
NU5M_TRIRE      NRVGDCFLTIGMFVILWSLGNLDYSTVFSLAP--YXXXXXXXXXXXXXXXXAMAKSSQVGLHIWLPMAME
NU5M_MACRO      NRIGDIGFMLAMAWLMINNSSWDLQHIFMTNMDTLALMGLVIAAT--------GKSAQFGLHPWLPSAME
NU5M_GORGO      NRIGDIGFILALAWFLLHSNS------WDPQQMSXXXXXXXXXXXXGFLLAAAGKSAQLGLHPWLPSAME
NU5M_PANTR      NRIGDIGFVLALAWFLLHSNS------WDPQQMILLSTNTDLTPLLGFLLAAAGKSAQLGLHPWLPSAME
NU5M_FELCA      NRIGDVGFIMAMAWFLTNSNAWD----FQQI--FITQHENLNIPXXXXXXAATGKSAQFGLHPWLPSAME
NU5C_CARTI      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNFLFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5M_CERSI      NRIGDIGFIMSMAWFLFNTNSWDLQQIFS------LNYNHTDLPLMGLLLAATGKSAQFGLHPWLPSAME
NU5M_MYOGL      NRIGDIGFVLSMAWFLMHSSS------WEXXXXXXXXXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAME
NU5M_HYLLA      NRIGDIGFILALAWFLLHTNS------WEPQQMILLNSNPNFXXXXXXXXXXRGKSAQLGLHPWLPSAME
NU5M_DIDMA      NRIGDIGFMLTMAWLMLNCNSWDLQHIFSM--------NMHPIALLGLIIAATGKSAQFSLHPWLPSAME
NU5C_ZYGCR      NRVXXXXXXXXXXXXXXXXXSLEFDIVHQLLVENSANXXXXXXXXXXXFLGPIAKSAQFPLHVWLPDAME
NU5C_MALAR      NRXXXXXXXXXXXXXYWITGSFEFQXLFELIYNNEVHLLFVTLCASLLFAGAVAKSAQFPLHVWLPDAMX
NU5M_PANPA      NRIGDIGFILALAWFLLHSNS------WDPQQMVXXXXXXXXXXXXGFLLAAAGKSAQLGLHPWLPSAME
NU5C_POPAL      NRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNDNEVHFLFVTLCAFLLFSGAIAKSAQFPLHVWLPDAME
NU5C_DAUCA      NRVXXXXXXXXXXXXYWITGSFEFRDLFKLISNNEVNFLFVTFCAVLLFAGAVAKSAQFPLHVWLPDAME
NQO12_PARDE     NRVGDXXXXXXXXXXYWLTGSVQFDEIFRQVPQLAQTEIDFLWRDWNAANLLMGKSAQLLLHTWLPDAME
NU5M_SCHCO      NRIGDMALSIAYFVMLPAFGSADLPAYINQTT--------ITIIGFLLLVGAMAKSSQIPLHNWLPGSME
NU5C_WHEAT      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNGVNSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_POPTR      NRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNDNEVHFLFVTLCAFLLFSGAIAKSAQFPLHVWLPDAME
NU5C_OENPA      NRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTLCSFLVAKSAQFPLHVWLPDAME
NU5C_OENGL      NRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTLCSFLVAKSAQFPLHVWLPDAME
NU5C_OENEH      NRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTLCSFLVAKSAQFPLHVWLPDAME
NU5C_OENBI      NRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTLCSFLVAKSAQFPLHVWLPDAME
NU5C_OENAR      NRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTLCSFLVAKSAQFPLHVWLPDAME
NU5C_MAIZE      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNGINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_FAGEA      NRVXXXXXXXXXXXXXXXXXSFEFRDLFELIYNNEVHFLVGTVCTFLLFAGAVAKSAQFPLHVWLPDAME
NU5C_EUCGG      NRVGDFXXXXXXXXXYWITGSFEFRDLFQLIYNNEVPXXXXXXXXXXXXAGAVAKSAQFPLHVWLPDAME
PHAAB_RHIME     TGTGGLAMFVGLIIIGKIVGSYELDAVLAS-GDAIRNHPLYGTXXXXXXXGALTKSAQFPFHFWLPHAMA
NU5M_ROUAM      NRIGDVGFLVAMAWFLFNLNTWELQQIF------XXXXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAME
NU5C_PANGI      NRVXXXXXXXXXXXXYWITGSFEFRDLFKLIYNNEVNFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDAME
NU5C_ASTCO      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISTNQVNFLFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5C_RANMC      NRVGDFSLFLGILGLYWITGSFEFRDFFELIDNNGYNXXXXXXXXXXXXVGAVAKSAQFPLHVWLPDAME
NU5C_MUTAC      NRVXXXXXXXXXXXXYWITGSFEFRNLFQLISNNEVNFLFVTLCAVLLFAGAIAKSAQFPLHVWLPDAME
NU5M_PETMA      NRIGDIGLMMSMVWMCSNTNSWDLQQITMLLSDQQYLIPTLGFLIAAT-----GKSAQFGLHPWLPAAME
NU5C_STAPU      NRVXXXXXXXXXXXXYWITGSTITTRFSELLNTNNVNVSFAIVCSLLLFLGPVAKSAQFPLHVWLPDAME
NU5C_HUPLU      NRVGDFGLLLGTSGFYWITGSFKFEDLFERFNESLANHEVSLFLATPCALLFVAKSAQFPLHVWLPDAME
NU5C_CARCG      NRXXXXXXXXXXXXFYWITGSFEFRDLFQIVTNLIYNNEVNLVFLTICAVLLVAKSAQFPLHVWLPDAME
NU5M_RAT        NRVGDIGFILAMTWFCLNMNSWELQQIFXXXXXXXXXXXXXXXIAAT------GKSAQFGLHPWLPSAME
NU5C_PACAQ      NRICDFGLSLXILRXYWITGXFEFQDLFELIYNNEVHFLFVTLCASLLFAGAVAKSAQFPLHVWLPDAME
NU5C_ANIIN      NRVXXXXXXXXXXXXYWITGSFEFRDLFQLISNNEVNFFFVTLCAVLLFGGAIAKSAQFPLHVWLPDAME
NU5M_TRIRU      NRVGDCFLTIGMFIIIWSFGNLSLAPYFNQ--------EFITLIGICLLIGAMAKSSQIGLHVWLPQAME
NU5M_ACACA      NRFGDFGIYXXXXXXXXXXNLVQFLDTQPRMSFLGFSLNRVDLIVIFLFLGAIGKSAQLGLHTWLPDAME
NU5C_AMBTC      NRVGDFXXXXXXXXXYWIAGSFEFXXXXXXXXXXXXXXXFAILCASLLFLGAVAKSAQFPLHVWLPDAME
NU5M_PAPHA      NRIGDIGLILAMVWFLLHYNSWD----FQQM--LALNPHPSPLPLMGLLLAAVGKSAQFGLHPWLPSAME
NU5C_ANGEV      NRVGDFGLLLGILGTYWITGSFDIHSLSERFNDLIDSNGVNLFLANMCALLLFAKSAQFPLHVWLPDAME
NU5M_ORNAN      NRIGDIGFILAMAWFLIHTNSWE----FQQM----FXXXXXXXXXXXXXXAATGKSAQFGLHPWLPFAME
NU5C_LOTJA      NRVGDFXXXXXXXXXYWITGSLEFRDLFQLIDQNEVNIFFITLCALLLFCGSVAKSAQFPLHVWLPDAME
NU5C_CALFG      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIHNNGVNSLFATLCAFLLFVGAVAKSAQFPLHVWLPDAME
MRPA_BACSU      TVSGGLCMLGGFILLYLITDSFSIREMVHQVQ-LIAGHELFIPAMILILLGAFTKSAQFPFYIWLPDAME
NUOL_NEIMB      NRVGDFGFLLGIGLVLAYFGGSDVFAYLPNVQNATIQLFPGVEWSLITVTCLLGKSAQFPLHVWLPDSME
NUOL_NEIMA      NRVGDFGFLLGIGLVLAYFGGSDVFAYLPNVQNATIQLFPGVEWSLITVTCLLGKSAQFPLHVWLPDSME
NU5M_SQUAC      NRVGDIGLILSMAWLAMNLNSWEIQQLFILSKDKDXXXXXXXXXXXXX-----GKSAQFGLHPWLPSAME
NU5C_NANDO      NRVXXXXXXXXXXXXXXITGSFEFRDLFELMDNGGVNSLFLTLCASLLFVGAIAKSAQFPLHVWLPDAME
NU5M_CHIMO      NRIGDIGLILSMIWLATNLNSWEMNQFM-----VLSKXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAME
NU5C_LIGVU      NRVXXXXXXXXXXXXYWITGSFEFRDLFEILNNFISKNEVNSSFGTLCAALLVAKSAQFPLHVWLPDAME
NU5C_LEPVR      NRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXXXXXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NU5C_VITVI      NRVGDFXXXXXXXXXYWITGSFEFRDLFEXXXXXXXXXXXXXXXLFVSLCALVAKSAQFPLHVWLPDAME
NU5C_SOYBN      NRVGDFXXXXXXXXXYWITGSLEFRDLFQIINNLIYKNEVNIFFLTLVALLLVAKSAQFPLHVWLPDAME
NU5M_CRYNV      NRVGDMFLSVGFFAIFWVFGNVDYASVFSVAP--YINETAITIIGLLLLVGAMAKSANIPLHTWLPDAME
NU5C_VICFA      NRVXXXXXXXXXXXXYWITGSLEFRDLFQIFKNLIYKNEVNILFVTLCALLLVAKSAQFPLHVWLPDAME
NU5C_CITSI      NRVXXXXXXXXXXXXXXXXXSFEFRDLFEILKNLIYNNEVNLLFVTLCAFLLVAKSAQFPLHVWLPDAME
NU5C_DRANE      NRVGDFXXXXXXXXXYWITGSFEFQDLFEXXXXXXXXXXXXXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NU5C_DIOEL      NRVXXXXXXXXXXXXYWITGSLEFRDLFEIVNNLIHNNGVNFRFAILCACLLVAKSAQFPLHVWLPDAME
NU5M_MYXGL      NRIGDTGLIIFMIWSALFTNSWNM----KQIFILQNNSMDLWLPLLGIVLAATGKSAQFMLHPWLLSAME
NU5M_EMENI      NRVGDTLLTVGMFAILWSFGNIDLAPYYNE--------NXXXXXXXXXXXXXXXKSSQVGLHIWLPQAME
NU5M_DEBHA      NRMGDTLFV--------ICIGTMLSYFFETMETPHTDTYXXXXXXXXXXXXXXXKSAQLGLHGWLLSAME
NU5C_PELHO      NRVGDFSFLLGILGLYWITGSFEFRDFYNLVHNNEIPXXXXXXXXXXXXXXXXXKSAQFPLHVWLPDAME
NU5C_CHLSC      NRXXXXXXXXXXXXXXXXXXSFEFRDLFELIHSNGVHFVFATLCASLLFVGAVAKSAQFPLHVWLPDAME
NUOL_STRCO      NRVGDMGLSIGIMLMFLWFGTFAFGPVXXXXXXXXXXXXXXXXKXXXXXXXXXGKSAQVPLQSWLGDAME
NU5M_CARAU      NRVGDIGLIMTMAWFAMNLNSWEIQQIFVLSKNFDMTIPLMGLALAAT-----GKSAQFGLHPWLPSAME
MNHA2_STAES     TVFGGLALLTGFIILYIITGTNTITDILNQ-RNAISRHXXXXXXXXXXXXGAFTKSAQFPFHIWLPKAMA
MNHA2_STAEQ     TVFGGLALLTGFIILYIITGTNTITDILNQ-RNAISRHXXXXXXXXXXXXGAFTKSAQFPFHIWLPKAMA
NU5C_OLIPU      NRVGDFXXXXXXXXXYWITGSFEFQDLFELILNNRVNXXXXXXXXXXXXVGPIAKSAQFPLHVWLPDAME
NU5M_USTMA      NRVGDMFLSIGFFAIFFVFGNLDYSTVFSIAP--FINEXXXXXXXXXXXXAAMGKSAQLGLHTWLPDSME
NU5C_NASOF      NRVGDFXXXXXXXXXYWITGSFEFQDLFEXXXXXXXXXXXXXXXXXXXXVGPIAKSAQFPLHVWLPDAME
NU5M_MOUSE      NRIGDIGFILAMVWFSLNMNSWEL----QQI--MFSNNNDNLIPLMGLLIAATGKSAQFGLHPWLPSAME
NU5C_ORYSJ      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNEINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_ORYSI      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNEINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_ORYSA      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNEINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_ORYNI      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNEINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_CICAR      NRVXXXXXXXXXXXXYWITGSLEFRDLFQLIYKNEVNIFFVTLCALLLFCGSVAKSAQFPLHVWLPDAME
NU5M_LOXAF      NRIGDMGFIMMMAWFTIHLNSWE----FQQI--FXXXXXXXXXXXXXXXXXXXXXXAQFGLHPWLPSAME
NU5M_DINSE      NRIGDIGLIMTTAWMMT-TSSINMQELMIQHE------VVNIIPLLGLVAAATGKSAQFSLHPWLPSAME
NU5M_PARLI      NRIGDIGLITFMSLAVLTTNSWNLT----EIITNEPNNHFVLFMLFGLILAAAGKSAQFGLHPWLPAAME
NU5M_CYPCA      NRVGDIGLIMTMAWLAMNLNSWEIQQIFALSKNFDMTIPLMGLALAAT-----GKSAQFGLHPWLPVAME
NU5M_PONPY      NRIGDIGFILTLAWFLLHSNSWELQQVF------XXXXXXXXXXXXXXXXXXXXKSAQLGLHPWLPSAME
NU5M_LATCH      NRVGDIGLTLSMVWFAINLNTWEMQQMF-----IMSYNTDMTIPLLGLTLAAAGKSAQFGLHPWLPAAME
NU5M_STRCA      NRIGDVGLILSMAWLASTLNTWEI----QQIS---YESQXXXXXXXXXXXXXXXKSAQFGLHPWLPAAME
NU5C_CAPBU      NRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXRVNXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NU5C_MARPO      NRXXXXXXXXXXXXXYWITGSFDFQQFFELLSYNQINLVFATLCALFLFLGPVAKSAQFPLHIWLPDAME
NU5C_BARVE      NRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXRVNXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NU5C_ARATH      NRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXXXXXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NUOL_BUCBP      TRIGDIFLILAIFFIYKNFGTLELKLIFETT-NVVENFKFLNYVSLFLLIAAIAKSAQVPLQTWLIDAMA
NU5M_ONCMY      NRVGDIGLILSMAWFATNLNSWEIQQMFASSKGLDLTLPLMGLILAAT-----GKSAQFGLHPWLPSAME
NU5M_HUMAN      NRIGDIGFILALAWFILHSNSWDPQQMALLNANPSXXXXXXXXXXXXXXXXXXXXHPWLP------SAME
NU5C_LOBMA      NRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLILTNRVNXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NU5C_CRUWA      NRXXXXXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXRVNXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NU5C_CHLAT      NRVXXXXXXXXXXXXYWVTGSFEFQTISNRLSNVLLGDFVLPGSHPVQVEXXMAKSAQFPLHVWLPDAME
NU5C_ARAHI      NRVGDFXXXXXXXXXYWITGSFEFQDLFEXXXXXXXXXXXXXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NU5M_PONAB      NRIGDIGFILALAWFLLHSNSWELQQVF------XXXXXXXXXXXXXXXXXXXXKSAQLGLHPWLPSAME
NU5M_GADMO      NRVGDIGLILGMAWLATNVNSWDIQQMFILSKNLDMTLPLLGLILAAT-----GKSAQFGLHPWLPAAME
NU5M_XENLA      NRVGDIGLILSMAWVAMNLNSWEMQQVFMLNSD------NXXXXXXXXXXXXXXKSAQFGLHPWLPAAME
MNHA2_STAS1     TVFGGLALLAGFIMIYIVTGTNSITSIIEQ-SDKIAQSHXXXXXXXXXXXGAFTKSAQFPFHIWLPKAMA
NU5M_CHICK      NRIGDIGLILSMAWLASSLNTWEI----QQITHPNQTPTLPLLGLILAAT---GKSAQFGLHPWLPAAME
NU5M_TETNG      NRVGDIGLVFSMAWMATHLNSWEIQQIFFSSKDMDXXXXXXXXXXXXX-----GKSAQFGLHPWLPSAME
NU5C_MORIN      NRVXXXXXXXXXXXXYWITGSLEFRDLFEXXXXXXXXXXXXXXXXXXXXXGAIAKSAQFPLHVWLPDAME
NU5C_AETGR      NRVGDFXXXXXXXXXYWVTGSFEFQDXXXXXXXXXXXXXXXXXXXXXXXXXXIAKSAQFPLHVWLPDAME
MNHA1_STAES     TVXXXXXXXXXXXXXXXATDTFSIQAMISKASDIQNSPFFILVMILFMIGAFT-KSAQVPFYIWLPDAME
MNHA1_STAEQ     TVXXXXXXXXXXXXXXXATDTFSIQAMISKASDIQNSPFFILVMILFMIGAFT-KSAQVPFYIWLPDAME
NUOL_RICBR      ----------------------------------------------------MGKSAQIGLHVWLPDAME
NU5C_ADICA      NRXXXXXXXXXXXXXYWTTGSFEISEFAKLKEIGFSNPILTNIIAFLLLAGPVAKSAQFPLHVWLPDAME
NU5C_BUXMI      NRVXXXXXXXXXXXXYWITGSFEFRDLFELIYNNQVNSLFVILCASLLFVGAVAKSAQFPLHVWLPDAME
NU5M_CROLA      NRVGDIGLIMSMAWLAMNLNSWEIQQIFFLSKDFDMTLPLMGLILAAT-----GKSAQFGLHPWLPAAME
NU5M_CHLRE      NRVSDGLLMWGVLWVWYHLGSLEY--------DLLNVYSASGFVGLSILIGAMGKSAQILFHVWLADAME
NU5M_SALSA      NRVGDIGLILSMAWFATNLNSWEIQQMFASSKELDLTLPLMGLILAAT-----GKSAQFGLHPWLPSAME
NU5C_MESVI      NRVXXXXXXXXXXXXYWMTGSFEFDKLLQLAEYDNFNTQLAXXXXXXXXXXPVAKSAQFPLHVWLPDAME
MRPA_BACPF      TVFGGFAMLGGFSLLYVMTGTFSIRGIIENV-DLVTSSELFLPAMILVLLGAFTKSAQFPFHIWLPDAME
MNHA1_STAS1     TVFXXXXXXXXXXXXXXXXXTTSIQELINNASEIQTSPFFIFSMILVLIGA-MTKSAQFPFYVWLPDAME
NU5M_ELEMA      NRIGDMGFIMMMAWFIIHLNSWE----FQQI--FXXXXXXXXXXXXXXXXXXXXXXAQFGLHPWLPSAME
NU5C_AGRST      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNGINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_SACOF      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNGINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5C_SACHY      NRVXXXXXXXXXXXXXWITGSLEFRDLFKWIPNNGINSXXXXXXXXXXXXGAVAKSAQFPLHVWLPDAME
NU5M_MAMPR      NRIGDMGFIMMMAWFIIHLNSWE----FQQI--FXXXXXXXXXXXXXXXXXXXXXXXQFGLHPWLPSAME
MNHA2_STAHJ     TVLGGLALLTGFIMLYIITGTNTISELLTQSHSISEHALFIPMMIMLLIGAFT-KSAQFPFHIWLPKAMA
NU5C_JASNU      NRVGDFCLLLGILGFYWITGSFEFRDFFEILKNLIYNNEVNSSFLTLCASLLVAKSAQFPLHVWLPDAME
NU5M_BRALA      NRVGDIGLLIMLMWSLVTLGDWSFTGLYA-------LDFVNTFFLLGVVLAAAGKSAQLGLHPWLPAAME
NU5C_AETCO      NRVGDFXXXXXXXXXYWVTGSFEFQDXXXXXXXXXXXXXXXXXXXXXXXXXXIAKSAQFPLHVWLPDAME
NU5M_DANRE      NRMGDIGFILTLAWMAMYLNSWDIQQIFILSKDFDMTIPQIGLIIAAT-----GKSAQFTLHPWLPSAME
NU5M_PELSU      NRLADIGFILTFSWCITYMSSLDLNTFFAT------STLVTGVPILGMLMAAMGKSAQFGMHPWLPAAME
NU5M_BRAFL      NRVGDIGLLIMLMWSLVTLGDWSFTGLYA-------LDFVNTFFLLGVVLAAAGKSAQLGLHPWLPAAME
MNHA1_STAHJ     TVXXXXXXXXXXXXXXXAGDSLSLHELIANASEIQHSPLFIFAMVLIMLGAFT-KSAQVPFYIWLPDAME
NU5M_PICCA      NKIGDXXXXXXXXXXXXXXXXXXXXXXFSLVS--YXXXXXXXXXXLCLVIAASAKSAQFGLHNWLIWAMA
NU5C_PHAVU      NRVGDFXXXXXXXXXYWITGSLEFRDLFQIINNLISKNEMNXXXXXXXXXXXVAKSAQFPLHVWLPDAME
MNHA2_STAAR     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHALFIPMIIMFLLGAFTKSAQFPFHIWLPRAMA
NU5M_STRPU      NRIGNIGLITFMALS---AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSAQFGLHPWLPALLE
NU5M_YARLI      NRFGDAFFVLGLCVIAYVFGTLNYSTIFATA--YLINTDXXXXXXXXXXXXXXXKSAQFGLHNWLTLAME
MNHA2_STAAN     TVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAAM     TVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAA9     TVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAA2     TVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAA1     TVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAAW     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAAU     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAAT     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAAS     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAAE     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAAC     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAA8     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA2_STAA3     TVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA1_STAAR     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAAW     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAAU     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAAT     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAAS     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAAN     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAAM     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAAE     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAAC     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAA9     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAA8     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAA3     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAA2     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
MNHA1_STAA1     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
NUOL_BUCAP      TRISDVFLIISMFLIYNKYGTFNFQEIFLNVEDCFDXXXXXXXXXXGV----MGKSAQLPLHTWLSDAMV
MNHA2_STAAB     TVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFMPMIFMFLLGAFTKSAQFPFHIWLPRAMA
MNHA1_STAAB     TVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFT-KSAQFPFYIWLPDAME
NU5M_LUMTE      ------------------------------------------------------KSAQMPFSSWLPAAMA
NU5M_CANAL      NR----------------------------------------------------------LHAWLLQAME
NU5M_CANPA      NR----------------------------------------------------------LHAWLLQAME
NU5M_ASTPE      NRVGDIGXXXXXXXXXXXXNTWSLPEIFS----ISAPNTFNNXXXXXXXXXXXXKSAQFGLHPWLPAAME
HYFD_ECOLI      THIGSLGLYLAAATLFLQTGTFALSAMSELHGDARYLVYGGILFAAW------GKSAQLPMQAWLPDAME
NU5M_ALBCO      TNRLGDVLIIATFSVILVTGTVHFPPY-----------TLVWLSSILFTIASFTKSAQYPFSAWLPAAMA
NU5M_DROME      ------------------------------------------------------KSAQIPFSSWLPAAMA
NU5M_DROYA      ------------------------------------------------------KSAQIPFSSWLPAAMA
NU5C_PEA        ----------------------------------------------------VAKSAQFPLHVWLPDAME
NU5H_NYCOV      NRFGDLWMFTASIEIYSLCHNDALPTLFALLPYAQFNLSILGNLIFDFTIPTVCKCAQFLLFVWLPDAME
NU5M_RHISA      ------------------------------------------------------KSAQIPFSAWLPAAMA
NU5M_ARTSF      NRVGDVLILWSLGLM-----------FYSKSWDYXXXXXXXXXXXXXXXXXXXTKSAQLPFSAWLPAAMA
NU5M_MYTED      NRIGDVLVLISISIFLSEGGW--LIYSYHPVQ-------MWLNLGFMVVFAGMTKSAQMPFCAWLPAAMA
NU5M_ASCSU      ------------------------------------------------------KSAQFPFSGWLPKAMS
NU5M_AEDAE      ------------------------------------------------------KSAQIPFSSWLPAAMA
NU5M_LOCMI      NRIGDVAILISISWMLNF-GSWNXXXXXXFISDSFEXXXXXXXXXXXXXXX----SAQIPFSSWLPAAMA
NU5C2_PAUCH     ------------------------------------------------------KCAQFPMHLWLDEAME
NU5M_PARTE      ------------------------------------------------------KSAQFGFHVWLPDSME
NU5M_PEA        NRVGDFGLAPGISGRFTLFQTVDFSTIFARASSCNMRLNAITLICILLLIGAVGKSAQIGSHTWSPDAME
NU5M_ANOGA      ------------------------------------------------------KSAQIPFSSWLPAAMA
NU5M_ANOAR      ------------------------------------------------------KSAQIPFSSWLPAAMA
NU5M_ANOQU      ------------------------------------------------------KSAQIPFSSWLPAAMA
NU5M_APILI      ------------------------------------------------------KSAQIPFSTWLPMAMM
MRPD_BACPF      ------------------------------------------------------KGGLFPLYFWLPRSYF
NUOM_PSEAE      ------------------------------------------------------KMPVVPVHSWLPDAHA
Y051_MYCTU      TQLGFIAIXXXXXXXXXXXXSDRFAGLGAVCDGVRAAVFMLTLVGFG------SKAGLVPLHAWLPRAHP
NUOM_RICPR      ------------------------------------------------------KTPMIPFHTWLPDAVQ
NU5M_CAEEL      ------------------------------------------------------KSAQFPFSSWLPKAMS
HYFB_ECOLI      ----------------------------------------------------------MPLHSWLPRXXX
NUOM_ECOLI      ------------------------------------------------------KMPVVPLHGWLPDAHS
NUOM_ECO57      ------------------------------------------------------KMPVVPLHGWLPDAHS
NUOM_RICBR      ---------------------------------------------------------------WLPDAVQ
NU5M_ANOQN      ------------------------------------------------------KSAQIPFSSWLPAAMA
NUOM_RICFE      ----------------------------------------------------------IPFHTWLPDAVQ
NQO13_PARDE     ------------------------------------------------------KMPMWPVHTWLPDAVQ
MRPD_BACSU      NIVSSALFVIGVGFLYAVTGTLNMADLSVKISESGQXXXXXXXXXXXXXXFGM-KGGIFPLYFWLPGSYY
NU5M_TRYBB      ------------------------------------------------------KSTQFGLHIWLPDAME
NUOM_RICCN      ----------------------------------------------------------IPFHTWLPDAVQ
NUOM_RHOCA      ------------------------------------------------------KMPMWPVHTWLPDAVQ
MNHD2_STAS1     --------------------------------------------------------AALVLFMWLPKAYA
HYCC_ECOLI      ----------------------------------------------------------IPLHGWVPQXXX
MNHD1_STAES     ------------------------------------------------------KAGVFPMYVWLPGAYY
MNHD1_STAEQ     ------------------------------------------------------KAGVFPMYVWLPGAYY
NUOM_RICTY      ------------------------------------------------------KIPMIPFHTWLPDAVQ
NU4C2_SYNJA     -----------------------------------------------------------PLHTWLPDAHG
MNHD2_STAAR     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAHJ     --------------------------------------------------------AALVLFMWLPKAYA
MNHD1_STAAW     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAU     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAT     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAS     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAR     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAN     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAM     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAE     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAC     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAAB     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAA9     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAA8     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAA3     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAA2     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD1_STAA1     ------------------------------------------------------KAGVFPMFVWLPSXXX
MNHD2_STAAW     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAAU     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAAT     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAAS     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAAN     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAAM     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAAE     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAAC     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAAB     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAA9     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAA8     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAA3     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAA2     --------------------------------------------------------AALVLFMWLPKAYA
MNHD2_STAA1     --------------------------------------------------------AALVLFMWLPKAYA
NU4C2_SYNJB     -----------------------------------------------------------PLHTWLPDAHG
NU4M_MARPO      TLMGSXXXXXXXXXXXXQTGTTDL----QILLTTEFSERRQILLWIAFFASFSVKVPMVPVHIWLPEAHV
NU4C2_ANASP     ----------------------------------------------------------IPLHTWLPDAHG
NU4C1_ANAVT     ----------------------------------------------------------IPLHTWLPDAHG
NU4C_ACAM1      ----------------------------------------------------------VPLHTWLPDAHG
NU4M_CHOCR      TXXXXXXXXXXXXNIYFQTGTTDLQILFSEISQIFLWLSFFASFAV--------KIPMIPFHIWLPEAHA
NUON_ERWT9      SAAASSFLLFGMALVYADSGNLGFMALGRSLNDDVIHQPLLLAGLGLMIVGFGFKLSLVPFHLWTPDVQG
NU4M_ARATH      TXXXXXXXXXXXXXXXFQTGTTDL----QILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHV
NU4C3_SYNP2     ------------------------------------------------------KLAIFPLHTWLPDAHG
NU4C3_ANASP     ------------------------------------------------------KLAIFPLHTWLPDAHG
NU4C2_SYNP6     ----------------------------------------------------------VPLHTWLPDAHG
NU4C2_SYNE7     ----------------------------------------------------------VPLHTWLPDAHG
NU4C2_ANAVT     ------------------------------------------------------KLAIFPLHTWLPDAHG
NU4C_SYNR3      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROM5      ----------------------------------------------------------VPLHTWLPDAHG
NU4C2_MICAN     ------------------------------------------------------KLAIFPLHTWLPDAHG
NDHF_BACSU      XXXXXXXXXXAMMWLFHATGQWQLSLVVTNESLAGLGEWERTGIQLLIVLAVIIPAAQWPFQRWLVESIV
MNHD2_STAES     --------------------------------------------------------AALVIFMWLPKAYA
MNHD2_STAEQ     --------------------------------------------------------AALVIFMWLPKAYA
NU4M_WHEAT      ------------------------------------------------------KVPMVPVHIWLPEAHV
NU2C_SYNJA      TAIFXXXXXXXXXXXXXQTQLAAIAPYLANA-------GLVGILALVFCLGGIGKLAAVPFHQWTPDVYG
NU4C_PROMP      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROM4      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROMM      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROMA      ----------------------------------------------------------VPLHTWLPDAHG
NU4C2_SYNY3     ------------------------------------------------------KLAIFPFHTWLPDAHG
NU4C2_SYNP2     -----------------------------------------------------------PLHTWLPDAHG
NU4C_SYNS3      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_SYNPX      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROMT      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROM1      ----------------------------------------------------------VPLHTWLPDAHG
NU4C1_THEEB     ----------------------------------------------------------VPLHTWLPDAHG
NU4C_SYNSC      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROMS      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROM3      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROM2      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROM0      ----------------------------------------------------------VPLHTWLPDAHG
NU4C1_SYNJA     -----------------------------------------------------------PLHTWLPDAHS
NU4M_PROWI      TLFGSVLMLLAILLIYFQTGTLDIEMLY--LSDFSETRQCILWLAFFASFAV--KVPMVPVHIWLPEAHV
NU4C1_TRIEI     -----------------------------------------------------------PLHTWLPDAHG
NU4C1_SYNJB     -----------------------------------------------------------PLHTWLPDAHS
Y1309_METJA     ----------------------------------------------------------------------
NU4M_BRACM      TXXXXXXXXXXXXXXXFQTGTTDL----QISLTTEFSERRQIFLWIASFASFAVKVPMVPVHIWLPEAVE
NU4C_SYNS9      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_SYNPW      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_PROM9      ----------------------------------------------------------VPLHTWLPDAHG
NU4C_GLOVI      -----------------------------------------------------------PLHTWLPDAHG
NU2C_SYNP6      GAASSAIFLYGVSLLYGLAGETQLPAIAEKLGEAQPLALLISLIFVIAGIAF--KISAVPFHQWTPDVYG
NU2C_SYNE7      GAASSAIFLYGVSLLYGLAGETQLPAIAEKLGEAQPLALLISLIFVIAGIAF--KISAVPFHQWTPDVYG
NUON2_RHIME     GAVSTAIFLYGVSLIYGLTGTTQLDRMAEAVSGGPLDPALLLAVVFIVAGL-VFKIGAVPFHMWVPDVYG
NU4C_ANTFO      ------------------------------------------------------KLPMVPLHTWLPDTHG
NU2C_CHAGL      ------------------------------------------------------KISAVPFHQWTPDVYG
NU4C2_THEEB     -----------------------------------------------------------PLHTWLPDAHG
NU4C_NEPOL      ------------------------------------------------------KLPAIPVHTWLPDTHG
NU4C2_TRIEI     ------------------------------------------------------KLAVFPLHTWLPDAHG
NU4C1_SYNY3     -----------------------------------------------------------PLHTWLPDAHG
NU4C1_SYNP6     ------------------------------------------------------KLSIFPLHTWLPDAHG
NU4C1_SYNE7     ------------------------------------------------------KLSIFPLHTWLPDAHG
NU2C_STAPU      ------------------------------------------------------KISAVPFHQWTPDVYG
NU4C3_ANAVT     -----------------------------------------------------------PLHTWLPDAHG
NU4C1_ANASP     -----------------------------------------------------------PLHTWLPDAHG
NU2C_CYAP7      ------------------------------------------------------KISAVPFHQWTPDVYG
NUOM_MYCTU      ------------------------------------------------------KAPLWPFHRWLPDAAV
NU2C_ACAM1      AASSAVFXXXXXXXXXXXXXKTHLDDIALALTDTSKSLALVISLVFVIASVSF-KIAAVPFHQWTPDVYG
NUON_MYCTU      -----------------------------------------------------------PFHSWIPDVQG
NUON_MYCBO      -----------------------------------------------------------PFHSWIPDVQG
NU4C1_SYNP2     -----------------------------------------------------------PLHTWLPDAHS
NU2C_NEPOL      GAASSGLFLYGISWMYGISGGMELNSIAHAIVSLDETKTTTCALALVLMTVGVGKVAAAPFHQWTPDVQG
NU4M_ASTPE      ---------------------------------------------------------------WLPKAHV
NU4C_ZYGCR      ------------------------------------------------------KLPAFPLHTWLPDTHG
NU4C_MARPO      ----------------------------------------------------------IPFHTWLPDTHG
NU2C_PHYPA      ------------------------------------------------------KLSLVPFHQWTPDVYG
HYFF_ECOLI      VAFGLFGTVLVYANAASVMPQAEMAIFWSEVQSSLLDPTLMLLAFVFLLIGFGTKTGLFPMHAWLPDAHS
NU4M_METSE      TFVGSVFMLLGIFQLYSSVGTTD----YQALLNIELPISTQKWIFAGFFLSLAVKIPQVPFHIWLPQAVE
NU2C_PROMT      GSAAAAVFLYGASLLYGISGSTNLKEIGXXXXXXXXXXXXXXXVFVLSTVAF--KIAAVPFHQWTPDVYG
NU2C_SYNP2      ------------------------------------------------------KISAVPFHQWTPDVYG
NU2C_MARPO      ------------------------------------------------------KLSLVPFHQWTPDIYG
NU4C_PHYPA      -----------------------------------------------------------PLHTWLPDTHG
NU4C_IPOPU      ------------------------------------------------------KSPILPLHTWLPDTHG
NU2C_PROMM      ------------------------------------------------------KIAAVPFHQWTPDVYG
NU2C_PROM3      ------------------------------------------------------KIAAVPFHQWTPDVYG
NU2C_CYAP8      ------------------------------------------------------KISAVPFHQWTPDVYG
NUON_PSEAE      ------------------------------------------------------KLSLVPFHLWTPDVYG
NU4M_ACACA      -----------------------------------------------------------PFHIWLPEAHV
NU2C_TRIEI      ------------------------------------------------------KISAVPFHQWTPDVYG
NU2C_CHAVU      ------------------------------------------------------KLSLVPFHRWSPDVYG
NU2C_MICAN      ASSSAIFXXXXXXXXXXXXXETSLSAIAQKLTDVNGGQSXXXXXXXXXXXXXXXKISAVPFHQWTPDVYG
NU4M_STRPU      ---------------------------------------------------------------WLPKAHV
NU4C_ADICA      -----------------------------------------------------------PFHTWLPDTHG
NU2C_SYNS9      ------------------------------------------------------KIAAVPFHQWTPDVYG
NU2C_SYNPW      ------------------------------------------------------KIAAVPFHQWTPDVYG
NU2C_PAUCH      GSATAAVFLYGASLLYGLTGSTNLDAVALALQSSDTPXXXXXXXXXXXXXXX--KIAAVPFHQWTPDVYG
NU4C_CHLAT      ------------------------------------------------------KLPAFPLHTWLPDTHG
NU2C_SYNS3      ------------------------------------------------------KIAAVPFHQWTPDVYG
NU2C_SYNPX      ------------------------------------------------------KIAAVPFHQWTPDVYG
NU2C_CYAA5      ------------------------------------------------------KISAVPFHQWTPDVYG
NU2C_CHLAT      ------------------------------------------------------KVAAAPFHQWAPDVYG
NU4M_MYXGL      ---------------------------------------------------------------WLPKAHV
NU4C_MESVI      ------------------------------------------------------KLPAFPVHTWLPDTHG
MNHD1_STAHJ     ------------------------------------------------------KAGAFPMYVWLPGSXX
NU4C_CRYJA      -----------------------------------------------------------PLHTWLPDTHG
NU2C_PROMA      ------------------------------------------------------KIAAVPFHQWTPDVYG
NU2C_ADICA      ------------------------------------------------------KLSLFPFHQWTPDVYG
NU4C_NYMAL      ------------------------------------------------------KSPIIPLHTWLPDTHG
NU2M_ARATH      ------------------------------------------------------KITAVPFHMWAPDIYG
NQO14_PARDE     ------------------------------------------------------KVSAVPFHMWTPDVYG
NUON_RHOCA      ------------------------------------------------------KVSAVPFHMWTPDVYG
NU4C_ANGEV      -----------------------------------------------------------PFHTWLPDTHG
NU4C1_MICAN     -----------------------------------------------------------PLHTWLPDAHG
NU2C_PSINU