[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57113.1

[Show Plain Result]


## Summary of Sequence Search
    1::228
    2::207     7e-30  38%  221 aa  PP_LAMBD RecName: Full=Serine/threonine-protein phosphatase;       
   20::212     1e-27  39%  216 aa  PRP1_SALTY RecName: Full=Serine/threonine-protein phosphatase 1;   
   20::217     2e-26  38%  218 aa  PRP1_ECOLI RecName: Full=Serine/threonine-protein phosphatase 1;   
    4::206     2e-26  37%  218 aa  PRP2_SALTY RecName: Full=Serine/threonine-protein phosphatase 2;   
    5::206     1e-24  35%  218 aa  PRP2_ECOLI RecName: Full=Serine/threonine-protein phosphatase 2;   
    4::78      6e-12  55%  288 aa  APAH_PSEPW RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::71      1e-11  47%  276 aa  APAH_DECAR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::75      3e-11  52%  283 aa  APAH_PSEFS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-11  47%  283 aa  APAH_SERP5 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::78      5e-11  49%  272 aa  APAH_PSEMY RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      9e-11  54%  283 aa  APAH_PSEAE RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      9e-11  54%  283 aa  APAH_PSEAB RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      9e-11  54%  283 aa  APAH_PSEA8 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      9e-11  54%  283 aa  APAH_PSEA7 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      9e-11  45%  278 aa  APAH_METCA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::73      1e-10  51%  288 aa  APAH_PSEPK RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::73      1e-10  51%  288 aa  APAH_PSEP1 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERPY RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERPS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERPP RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERPN RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERPG RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERPE RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERPB RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERPA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  289 aa  APAH_YERP3 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  274 aa  APAH_SHESW RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-10  48%  274 aa  APAH_SHEPC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      3e-10  56%  289 aa  APAH_PSEF5 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::73      4e-10  54%  288 aa  APAH_PSEPG RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::71      4e-10  42%  273 aa  APAH_AZOSE RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::52      5e-10  53%  270 aa  APAH_THISH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-10  45%  273 aa  APAH_PROMH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::51      5e-10  50%  277 aa  APAH_METFK RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::78      6e-10  48%  293 aa  APAH_PSEPF RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::71      6e-10  45%  275 aa  APAH_HAEI8 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      8e-10  58%  300 aa  APAH_PSESM RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      1e-09  45%  292 aa  APAH_YERE8 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      1e-09  52%  291 aa  APAH_PSEU2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::71      1e-09  45%  275 aa  APAH_HAEIN RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::71      1e-09  45%  275 aa  APAH_HAEIG RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::71      1e-09  45%  275 aa  APAH_HAEIE RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      1e-09  44%  324 aa  APAH_XANCP RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::53      1e-09  54%  272 aa  APAH_SHEFN RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::73      1e-09  52%  285 aa  APAH_PSEE4 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   21::87      1e-09  45%  291 aa  APAH_COXBU RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   21::87      1e-09  45%  291 aa  APAH_COXBR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   21::87      1e-09  45%  291 aa  APAH_COXBN RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   21::87      1e-09  45%  291 aa  APAH_COXB2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   21::87      1e-09  45%  291 aa  APAH_COXB1 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::72      2e-09  43%  275 aa  APAH_PASMU RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  45%  282 aa  APAH_ENT38 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  44%  275 aa  APAH_ACTSZ RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  44%  270 aa  APAH_ACTPJ RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  42%  318 aa  APAH_XANOR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  42%  318 aa  APAH_XANOP RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  42%  318 aa  APAH_XANOM RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  42%  318 aa  APAH_XANC5 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  42%  314 aa  APAH_XANAC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  44%  275 aa  APAH_PHOLL RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  47%  276 aa  APAH_MANSM RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  45%  282 aa  APAH_KLEP3 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  47%  274 aa  APAH_ERWT9 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  51%  288 aa  APAH_BAUCH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  42%  270 aa  APAH_ACTP7 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-09  42%  270 aa  APAH_ACTP2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      3e-09  44%  283 aa  APAH_ENTS8 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      3e-09  40%  277 aa  APAH_CHRVO RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      3e-09  51%  270 aa  APAH_CELJU RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  47%  274 aa  APAH_SHEB9 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  47%  274 aa  APAH_SHEB8 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  47%  274 aa  APAH_SHEB5 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  47%  274 aa  APAH_SHEB2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALTY RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALTI RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALSV RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALPC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALPB RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALNS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALHS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALG2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALEP RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALDC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      4e-09  48%  282 aa  APAH_SALA4 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_SHISS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_SHIFL RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_SHIF8 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_SHIDS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_SHIBS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_SHIB3 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  45%  274 aa  APAH_SHESR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  45%  274 aa  APAH_SHESM RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::53      5e-09  48%  274 aa  APAH_SHEON RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  48%  282 aa  APAH_SALCH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::78      5e-09  44%  275 aa  APAH_PSEU5 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  51%  298 aa  APAH_PSE14 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  40%  275 aa  APAH_MARMS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_KLEP7 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ESCF3 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECOUT RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECOSM RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECOSE RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECOLU RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECOLI RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase
    4::67      5e-09  44%  280 aa  APAH_ECOLC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECOL6 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECOL5 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECOK1 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECOHS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECODH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECOBW RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECO8A RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECO81 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECO7I RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECO5E RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECO57 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECO55 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECO45 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  282 aa  APAH_ECO27 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      5e-09  44%  280 aa  APAH_ECO24 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::52      5e-09  47%  279 aa  APAH_ALHEH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::53      7e-09  48%  268 aa  APAH_VIBHB RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      7e-09  48%  282 aa  APAH_SALPK RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      7e-09  48%  282 aa  APAH_SALPA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      7e-09  44%  282 aa  APAH_SALAR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      7e-09  45%  271 aa  APAH_SACD2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::52      7e-09  45%  278 aa  APAH_BUCBP RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
  245::375     9e-09  37%  515 aa  PPZ_SCHPO RecName: Full=Serine/threonine-protein phosphatase PP-Z; 
    4::67      9e-09  45%  274 aa  APAH_SHESA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::72      9e-09  43%  273 aa  APAH_HAES2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::72      9e-09  43%  273 aa  APAH_HAES1 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      9e-09  49%  277 aa  APAH_AZOVD RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::45      9e-09  52%  275 aa  APAH_ACTAC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      1e-08  44%  292 aa  APAH_XYLFA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::75      1e-08  39%  272 aa  APAH_CHRSD RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::51      1e-08  52%  274 aa  APAH_SHESH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
  581::721     2e-08  39%  881 aa  BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1;
    4::53      2e-08  46%  268 aa  APAH_VIBPA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::52      2e-08  47%  273 aa  APAH_THIDA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      2e-08  42%  282 aa  APAH_CITK8 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      3e-08  44%  281 aa  APAH_PECCP RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    3::67      3e-08  38%  275 aa  APAH_HAMD5 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      3e-08  35%  270 aa  APAH_HAEDU RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::67      3e-08  44%  281 aa  APAH_ERWCT RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::53      3e-08  44%  275 aa  APAH_NITMU RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    3::52      3e-08  44%  276 aa  APAH_LEGPH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    3::52      3e-08  44%  276 aa  APAH_LEGPC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    3::52      3e-08  44%  276 aa  APAH_LEGPA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   61::197     4e-08  36%  312 aa  PP15_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
   71::141     4e-08  49%  321 aa  PP14_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
    3::52      4e-08  46%  276 aa  APAH_LEGPL RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::73      4e-08  40%  281 aa  APAH_DELAS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::49      4e-08  46%  280 aa  APAH_ACIAC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   63::193     6e-08  34%  324 aa  PP18_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
   74::144     6e-08  48%  318 aa  PP11_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
    5::67      6e-08  45%  279 aa  APAH_EDWI9 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::49      6e-08  48%  281 aa  APAH_ACISJ RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
  416::481     7e-08  47%  692 aa  PPZ1_YEAST RecName: Full=Serine/threonine-protein phosphatase
   76::146     7e-08  48%  316 aa  PP1_BRAOL RecName: Full=Serine/threonine-protein phosphatase PP1;  
    4::53      7e-08  46%  274 aa  APAH_SHELP RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::181     7e-08  30%  278 aa  APAH_NITOC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   67::197     1e-07  35%  312 aa  PP12_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
  583::723     1e-07  37%  883 aa  BSL1_ORYSJ RecName: Full=Serine/threonine protein phosphatase BSL1
    3::67      1e-07  44%  269 aa  APAH_VIBVU RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::53      1e-07  42%  276 aa  APAH_PSYIN RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::49      1e-07  48%  281 aa  APAH_DIAST RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    1::129     1e-07  35%  255 aa  PP1_BRANA RecName: Full=Serine/threonine-protein phosphatase PP1;  
    4::52      1e-07  41%  268 aa  APAH_NITEU RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::72      1e-07  37%  272 aa  APAH_HAEPS RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   72::142     2e-07  48%  322 aa  PP1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase PP1;  
    3::67      2e-07  44%  269 aa  APAH_VIBCM RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    3::67      2e-07  44%  269 aa  APAH_VIBCH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    3::67      2e-07  44%  269 aa  APAH_VIBC3 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::53      2e-07  46%  273 aa  APAH_PHOPR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::45      2e-07  48%  295 aa  APAH_XYLFT RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::45      2e-07  48%  295 aa  APAH_XYLF2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::49      2e-07  50%  282 aa  APAH_SODGM RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::53      2e-07  44%  285 aa  APAH_COLP3 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
  451::516     3e-07  45%  710 aa  PPZ2_YEAST RecName: Full=Serine/threonine-protein phosphatase
   60::130     3e-07  46%  330 aa  PP1B_DROME RecName: Full=Serine/threonine-protein phosphatase beta
   63::193     3e-07  34%  318 aa  PP19_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
   57::127     3e-07  46%  322 aa  PP12_SCHPO RecName: Full=Serine/threonine-protein phosphatase
   57::127     4e-07  43%  314 aa  PPY_DROME RecName: Full=Serine/threonine-protein phosphatase PP-Y; 
   55::125     4e-07  46%  314 aa  PP1_PHAVU RecName: Full=Serine/threonine-protein phosphatase PP1;  
   60::130     4e-07  46%  327 aa  PP1B_XENTR RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_XENLA RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_RAT RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_RABIT RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_PONAB RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_PIG RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_MOUSE RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_HUMAN RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_CHICK RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_CANFA RecName: Full=Serine/threonine-protein phosphatase
   60::130     4e-07  46%  327 aa  PP1B_BOVIN RecName: Full=Serine/threonine-protein phosphatase
   60::128     4e-07  49%  304 aa  PP13_TOBAC RecName: Full=Serine/threonine-protein phosphatase PP1
   58::128     4e-07  46%  319 aa  PP12_ACECL RecName: Full=Serine/threonine-protein phosphatase PP1
   58::128     4e-07  46%  319 aa  PP11_ACECL RecName: Full=Serine/threonine-protein phosphatase PP1
   61::131     4e-07  46%  329 aa  GLC7A_CAEEL RecName: Full=Serine/threonine-protein phosphatase
   61::131     4e-07  46%  329 aa  GLC7A_CAEBR RecName: Full=Serine/threonine-protein phosphatase
    6::67      4e-07  43%  273 aa  APAH_AERS4 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   61::131     5e-07  46%  323 aa  PP1G_CANFA RecName: Full=Serine/threonine-protein phosphatase
   57::127     5e-07  43%  331 aa  PP17_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
   60::190     5e-07  34%  312 aa  PP12_YEAST RecName: Full=Serine/threonine-protein phosphatase
   65::135     5e-07  46%  310 aa  PP12_TOBAC RecName: Full=Serine/threonine-protein phosphatase PP1
   72::142     5e-07  46%  317 aa  PP11_TOBAC RecName: Full=Serine/threonine-protein phosphatase PP1
    4::71      5e-07  35%  276 aa  APAH_NEIG2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::71      5e-07  35%  276 aa  APAH_NEIG1 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    6::67      5e-07  43%  273 aa  APAH_AERHH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   61::131     6e-07  46%  323 aa  PPIG_XENTR RecName: Full=Serine/threonine-protein phosphatase
   61::191     6e-07  34%  308 aa  PP1_NEUCR RecName: Full=Serine/threonine-protein phosphatase PP1;  
   60::190     6e-07  34%  323 aa  PP1_EMENI RecName: Full=Serine/threonine-protein phosphatase PP1;  
   57::127     6e-07  46%  321 aa  PP1_DICDI RecName: Full=Serine/threonine-protein phosphatase PP1;  
   61::131     6e-07  46%  323 aa  PP1G_RAT RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  323 aa  PP1G_MOUSE RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  323 aa  PP1G_HUMAN RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  323 aa  PP1G_BOVIN RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  323 aa  PP1GB_XENLA RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  323 aa  PP1GA_XENLA RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  330 aa  PP1A_RAT RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  330 aa  PP1A_RABIT RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  330 aa  PP1A_HUMAN RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  330 aa  PP1A_CANFA RecName: Full=Serine/threonine-protein phosphatase
   61::131     6e-07  46%  330 aa  PP1A_BOVIN RecName: Full=Serine/threonine-protein phosphatase
    3::71      6e-07  39%  269 aa  APAH_VIBVY RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::52      6e-07  47%  276 aa  APAH_TOLAT RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   61::131     8e-07  46%  330 aa  PP1A_MOUSE RecName: Full=Serine/threonine-protein phosphatase
   60::130     8e-07  46%  327 aa  PP11_SCHPO RecName: Full=Serine/threonine-protein phosphatase
   60::130     8e-07  45%  333 aa  GLC7B_CAEEL RecName: Full=Serine/threonine-protein phosphatase
   60::130     8e-07  45%  333 aa  GLC7B_CAEBR RecName: Full=Serine/threonine-protein phosphatase
    4::49      8e-07  41%  276 aa  APAH_NEIMA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::52      8e-07  41%  274 aa  APAH_BUCAT RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   58::128     1e-06  42%  316 aa  PP1_MAIZE RecName: Full=Serine/threonine-protein phosphatase PP1;  
    4::73      1e-06  39%  271 aa  APAH_TERTT RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   62::132     2e-06  45%  465 aa  YY06_CAEEL RecName: Full=Putative serine/threonine-protein
    4::52      2e-06  41%  274 aa  APAH_BUCAI RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::52      2e-06  41%  274 aa  APAH_BUCA5 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::45      2e-06  40%  272 aa  APAH_WIGBR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    5::213     4e-06  28%  245 aa  PRPE_GEOSW RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
   85::150     4e-06  45%  534 aa  PP2B_ASPFU RecName: Full=Serine/threonine-protein phosphatase 2B
   99::169     5e-06  40%  346 aa  PP12_TRYBB RecName: Full=Serine/threonine-protein phosphatase
   59::129     5e-06  45%  302 aa  PP12_DROME RecName: Full=Serine/threonine-protein phosphatase
   59::129     5e-06  45%  327 aa  PP11_DROME RecName: Full=Serine/threonine-protein phosphatase
  708::848     5e-06  33% 1009 aa  BSL2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL2
  125::190     7e-06  48%  558 aa  PP2B_NEUCR RecName: Full=Serine/threonine-protein phosphatase 2B
   99::169     7e-06  40%  346 aa  PP11_TRYBB RecName: Full=Serine/threonine-protein phosphatase
    4::53      7e-06  40%  273 aa  APAH_ALISL RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   85::150     9e-06  43%  530 aa  PP2B_EMENI RecName: Full=Serine/threonine-protein phosphatase 2B
  239::352     1e-05  40%  499 aa  PPP5_RAT RecName: Full=Serine/threonine-protein phosphatase 5;     
  239::352     1e-05  40%  499 aa  PPP5_MOUSE RecName: Full=Serine/threonine-protein phosphatase 5;   
  239::352     1e-05  40%  499 aa  PPP5_HUMAN RecName: Full=Serine/threonine-protein phosphatase 5;   
   58::128     1e-05  42%  321 aa  PP1_MEDVA RecName: Full=Serine/threonine-protein phosphatase PP1;  
   58::128     1e-05  40%  322 aa  PP16_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
    5::220     2e-05  34%  245 aa  PRPE_GEOKA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
  298::428     2e-05  31%  549 aa  PPQ1_YEAST RecName: Full=Serine/threonine-protein phosphatase PPQ; 
  176::247     2e-05  43%  757 aa  PPE2_MOUSE RecName: Full=Serine/threonine-protein phosphatase with
   59::129     2e-05  43%  302 aa  PP13_DROME RecName: Full=Serine/threonine-protein phosphatase
    5::57      2e-05  44%  246 aa  PRPE_BACHD RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      2e-05  43%  246 aa  PRPE_BACCR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      2e-05  43%  246 aa  PRPE_BACC4 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      2e-05  43%  246 aa  PRPE_BACC2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
   58::128     2e-05  42%  322 aa  PP13_ARATH RecName: Full=Serine/threonine-protein phosphatase PP1
    4::53      2e-05  40%  271 aa  APAH_VIBFM RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    4::53      2e-05  40%  271 aa  APAH_VIBF1 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
    5::60      3e-05  40%  246 aa  PRPE_BACLD RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
  176::247     3e-05  43%  753 aa  PPE2_HUMAN RecName: Full=Serine/threonine-protein phosphatase with
  157::241     3e-05  34%  640 aa  PPE1_RAT RecName: Full=Serine/threonine-protein phosphatase with
   54::201     3e-05  33%  309 aa  PP2A_BRANA RecName: Full=Serine/threonine-protein phosphatase PP2A
    5::53      4e-05  49%  245 aa  PRPE_GEOTN RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
  141::206     4e-05  47%  604 aa  PP2B2_YEAST RecName: Full=Serine/threonine-protein phosphatase 2B
  116::181     4e-05  43%  553 aa  PP2B1_YEAST RecName: Full=Serine/threonine-protein phosphatase 2B
   58::166     4e-05  33%  313 aa  PP2A4_ARATH RecName: Full=Serine/threonine-protein phosphatase
  507::583     4e-05  45%  793 aa  BSU1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSU1;
    4::67      4e-05  39%  275 aa  APAH_HERAR RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
   90::160     6e-05  35%  364 aa  YT91_CAEEL RecName: Full=Putative serine/threonine-protein
    5::61      6e-05  43%  246 aa  PRPE_BACHK RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  43%  246 aa  PRPE_BACCZ RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  41%  246 aa  PRPE_BACCQ RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  43%  246 aa  PRPE_BACC7 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  43%  246 aa  PRPE_BACC3 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  41%  246 aa  PRPE_BACC1 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  43%  246 aa  PRPE_BACC0 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  43%  246 aa  PRPE_BACAN RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  43%  246 aa  PRPE_BACAH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  43%  246 aa  PRPE_BACAC RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
    5::61      6e-05  43%  246 aa  PRPE_BACAA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
  117::182     6e-05  43%  639 aa  PP2B1_CRYNV RecName: Full=Serine/threonine-protein phosphatase 2B
  706::846     6e-05  35% 1006 aa  BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3;
  169::240     8e-05  36%  653 aa  PPE1_HUMAN RecName: Full=Serine/threonine-protein phosphatase with
  116::181     8e-05  43%  554 aa  PP2B_SCHPO RecName: Full=Serine/threonine-protein phosphatase 2B
   59::206     8e-05  30%  314 aa  PP2A5_TOBAC RecName: Full=Serine/threonine-protein phosphatase
  172::243     1e-04  36%  650 aa  PPE1_MOUSE RecName: Full=Serine/threonine-protein phosphatase with
   57::204     1e-04  30%  312 aa  PP2A_TOBAC RecName: Full=Serine/threonine-protein phosphatase PP2A
   54::192     1e-04  28%  309 aa  PP2AB_RAT RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     1e-04  28%  309 aa  PP2AB_RABIT RecName: Full=Serine/threonine-protein phosphatase 2A
   38::176     1e-04  28%  293 aa  PP2AB_PIG RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     1e-04  28%  309 aa  PP2AB_MOUSE RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     1e-04  28%  309 aa  PP2AB_HUMAN RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     1e-04  28%  309 aa  PP2AB_BOVIN RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     1e-04  28%  309 aa  PP2AA_CHICK RecName: Full=Serine/threonine-protein phosphatase 2A
   58::166     1e-04  33%  313 aa  PP2A3_ARATH RecName: Full=Serine/threonine-protein phosphatase
   74::212     1e-04  29%  329 aa  PP2A1_EMENI RecName: Full=Serine/threonine-protein phosphatase PP2A
    5::60      2e-04  38%  249 aa  PRPE_BACA2 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
  127::192     2e-04  45%  622 aa  PP2B1_DROME RecName: Full=Serine/threonine-protein phosphatase 2B
   51::198     2e-04  31%  306 aa  PP2AA_DICDI RecName: Full=Serine/threonine-protein phosphatase 2A
   73::152     2e-04  44%  521 aa  PP2BA_RAT RecName: Full=Serine/threonine-protein phosphatase 2B
   73::152     2e-04  44%  521 aa  PP2BA_MOUSE RecName: Full=Serine/threonine-protein phosphatase 2B
   73::152     2e-04  44%  521 aa  PP2BA_HUMAN RecName: Full=Serine/threonine-protein phosphatase 2B
   73::152     2e-04  44%  521 aa  PP2BA_BOVIN RecName: Full=Serine/threonine-protein phosphatase 2B
   52::160     2e-04  33%  307 aa  PP2A2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase
   52::160     2e-04  33%  307 aa  PP2A2_ORYSI RecName: Full=Serine/threonine-protein phosphatase
   54::192     2e-04  29%  309 aa  PP2A1_SCHPO RecName: Full=Minor serine/threonine-protein
    5::220     3e-04  27%  245 aa  PRPE_ANOFW RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase prpE
  279::392     3e-04  36%  538 aa  PPP5_ARATH RecName: Full=Serine/threonine protein phosphatase 5;   
   83::148     3e-04  43%  512 aa  PP2BC_HUMAN RecName: Full=Serine/threonine-protein phosphatase 2B
  135::202     3e-04  39%  623 aa  PP2BA_DICDI RecName: Full=Calcineurin subunit A;       
   47::112     3e-04  42%  368 aa  PP2A4_YEAST RecName: Full=Serine/threonine-protein phosphatase
  331::434     3e-04  29%  854 aa  ENV_FIVWO RecName: Full=Envelope glycoprotein gp150;AltName:
   83::148     4e-04  42%  513 aa  PP2BC_MOUSE RecName: Full=Serine/threonine-protein phosphatase 2B
   96::161     4e-04  43%  525 aa  PP2BB_RAT RecName: Full=Serine/threonine-protein phosphatase 2B
   96::161     4e-04  43%  525 aa  PP2BB_MOUSE RecName: Full=Serine/threonine-protein phosphatase 2B
   96::161     4e-04  43%  524 aa  PP2BB_HUMAN RecName: Full=Serine/threonine-protein phosphatase 2B
   58::123     4e-04  43%  313 aa  PP2A_MEDSA RecName: Full=Serine/threonine-protein phosphatase PP2A
   73::211     4e-04  29%  328 aa  PP2A2_ERYGR RecName: Full=Serine/threonine-protein phosphatase
    4::45      4e-04  38%  274 aa  APAH_JANMA RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase,
  214::314     5e-04  33%  473 aa  PPT1_SCHPO RecName: Full=Serine/threonine-protein phosphatase T;   
   50::197     5e-04  30%  305 aa  PPP6_RAT RecName: Full=Serine/threonine-protein phosphatase 6
   50::197     5e-04  30%  305 aa  PPP6_MOUSE RecName: Full=Serine/threonine-protein phosphatase 6
   50::197     5e-04  30%  305 aa  PPP6_HUMAN RecName: Full=Serine/threonine-protein phosphatase 6
  292::410     5e-04  40%  556 aa  PPP5_SOLLC RecName: Full=Serine/threonine protein phosphatase 5;   
  153::218     5e-04  42%  570 aa  PP2B2_DROME RecName: Full=Serine/threonine-protein phosphatase 2B
   61::144     6e-04  29%  326 aa  YNV7_YEAST RecName: Full=Putative metallophosphoesterase YNL217W;  
   48::113     6e-04  45%  307 aa  YD44_SCHPO RecName: Full=Putative serine/threonine-protein
   51::116     6e-04  42%  307 aa  PP2A_ACECL RecName: Full=Serine/threonine-protein phosphatase
   72::178     6e-04  35%  327 aa  PP2A1_NEUCR RecName: Full=Serine/threonine-protein phosphatase PP2A
   47::112     6e-04  42%  303 aa  FYPP_PEA RecName: Full=Phytochrome-associated serine/threonine
   47::112     6e-04  42%  303 aa  FYPP3_ARATH RecName: Full=Phytochrome-associated serine/threonine
   48::137     8e-04  37%  303 aa  PPP6_DROME RecName: Full=Serine/threonine-protein phosphatase 6
  161::226     8e-04  40%  584 aa  PP2B3_DROME RecName: Full=Serine/threonine-protein phosphatase 2B
   50::188     8e-04  29%  305 aa  PP2A_HELAN RecName: Full=Serine/threonine-protein phosphatase PP2A
   54::192     8e-04  26%  309 aa  PP2AA_RAT RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     8e-04  26%  309 aa  PP2AA_RABIT RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     8e-04  26%  309 aa  PP2AA_PIG RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     8e-04  26%  309 aa  PP2AA_MOUSE RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     8e-04  26%  309 aa  PP2AA_HUMAN RecName: Full=Serine/threonine-protein phosphatase 2A
   54::192     8e-04  26%  309 aa  PP2AA_BOVIN RecName: Full=Serine/threonine-protein phosphatase 2A
   59::197     8e-04  27%  314 aa  PP2A4_ORYSJ RecName: Full=Serine/threonine-protein phosphatase
   60::198     8e-04  27%  315 aa  PP2A4_ORYSI RecName: Full=Putative serine/threonine-protein
  190::313     8e-04  33%  457 aa  PP1L_ENCCU RecName: Full=Probable serine/threonine-protein
   50::116     8e-04  39%  311 aa  PP11_YEAST RecName: Full=Serine/threonine-protein phosphatase
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRFKRFSKNLAGKDYVVGDIHGTYSLLAQALERVGFDPSQDRLFAVGDLVDRGPESPDALTWLEYPWFHS
PP_LAMBD        ----RYYEKIDGSKYVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRA
PRP1_SALTY      --------------WVVGDIHGCFSMLMKRLRECRFDPQQDLLVSVGDLIDRGPDSLGCLALLRESWMTA
PRP1_ECOLI      --------------WLSGDIHGCLEQLRRKLWHCRFDPWRDLLISVGDVIDRGPQSLRCLQLLEQHWVCA
PRP2_SALTY      IRYADINSDLYRHIWVVGDIHGCYSLLLTRLAQLNFSPDTDLLISTGDNIDRGKENLETLRLLNTPWFIS
PRP2_ECOLI      -RYQKINAHHYRHIWVVGDIHGEYQLLQSRLHQLSFFPKIDLLISVGDNIDRGPESLDVLRLLNQPWFTS
APAH_PSEPW      --------------YAVGDLQGCLQPLKCLLERVKFDPAVDRLWLVGDLVNRGPESLQTLRYL-YSIRHS
APAH_DECAR      --------------YAIGDIQGCYDSLQRLLERCAFDPASDRLWLVGDLVNRGPKSLATLRLIKSPAALT
APAH_PSEFS      --------------YAVGDLQGCLEPLKCLLDRVAFDPAKDRLWLVGDVVNRGPESLETLRYL-----YS
APAH_SERP5      --------------YLIGDVHGCFDELKSLLAQVAFDPQQDQLWLTGDLVARGPGSLDVLRYVRSPAVRM
APAH_PSEMY      --------------YAVGDLQGCLQPLKCLLEQVAFDPAQDQLWLVGDLVNRGPQSLETLRFL-YSIRHA
APAH_PSEAE      --------------YAVGDLQGCLDPLKCLLERVAFDPAKDRLWLVGDLVNRGPQSLETLRFL-YAMRES
APAH_PSEAB      --------------YAVGDLQGCLDPLKCLLERVAFDPAKDRLWLVGDLVNRGPQSLETLRFL-YAMRES
APAH_PSEA8      --------------YAVGDLQGCLDPLKCLLERVAFDPAKDRLWLVGDLVNRGPQSLETLRFL-YAMRES
APAH_PSEA7      --------------YAVGDLQGCLEPLKCLLERVAFDPAKDRLWLVGDLVNRGPQSLETLRFL-YAMRES
APAH_METCA      --------------YAIGDVQGCYAELRRLLELIRFDPAKDRLLFTGDLVNRGPQSLETLRFIRGPAAAT
APAH_PSEPK      --------------YAVGDLQGCLQPLKCLLDRVSFNPAVDRLWLVGDLVNRGPESLETLRFL-YSIRHS
APAH_PSEP1      --------------YAVGDLQGCLQPLKCLLDRVSFNPAVDRLWLVGDLVNRGPESLETLRFL-YSIRHS
APAH_YERPY      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_YERPS      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_YERPP      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_YERPN      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_YERPG      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_YERPE      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_YERPB      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_YERPA      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_YERP3      --------------YLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_SHESW      --------------YFVGDVQGCFTELQKVLEKVDFNPSQDELWAVGDLVARGPDSLATLRFFKSDSAKT
APAH_SHEPC      --------------YFVGDVQGCFTELQKVLEKVDFNPSQDELWAVGDLVARGPDSLATLRFFKSDSAKT
APAH_PSEF5      --------------YAVGDLQGCLEPLQCLLEQVAFDPARDRLWLVGDLVNRGPQSLETLRYL-----YS
APAH_PSEPG      --------------YAVGDLQGCLQPLKCLLERVSFNPAVDRLWLVGDLVNRGPESLETLRFL-----YS
APAH_AZOSE      --------------YAIGDIQGCFREFRELVDQCGFDPSSDRLWLVGDLVNRGPASLETLRFVRSDAAVS
APAH_THISH      --------------YAVGDLQGCLTPLKRLLEQVRFDPAADQLWLVGDLVNRGPESLEALRFV-------
APAH_PROMH      --------------YLIGDVHGCYRELRQLLNQVNFDANQDTLWLTGDLVARGPDSLEVLRFVKSSALKL
APAH_METFK      --------------YAIGDIQGCYHSLLSLLELIQFDPVKDKLWLVGDLINRGPGSLETLRW--------
APAH_PSEPF      --------------YAVGDLQGCLEPLKCLLQQVAFDPALDRLWLVGDLVNRGPQSLETLRFL-YGMRES
APAH_HAEI8      --------------YFVGDLQGCYDELQLLLERVNFNPTQDKLYLVGDLVARGDKSLECLRFVKSDSAQT
APAH_PSESM      --------------YAVGDLQGCLEPLQCLLEHVRFDPVQDRLWLVGDLVNRGPQSLQTLRYL-----YS
APAH_YERE8      --------------YLIGDVHGCLDELLALLAQVDFDPQHDTLWLTGDLVARGPASLDVLRYVRSPAVRM
APAH_PSEU2      --------------YAVGDLQGCLEPLQCLLEHVHFNPEQDRLWLVGDLVNRGPQSLETLRYL-YSLRES
APAH_HAEIN      --------------YFVGDLQGCYDELQLLLERVDFNPTQDKLYLVGDLVARGDKSLECLRFVKSNAAQT
APAH_HAEIG      --------------YFVGDLQGCYDELQLLLERVDFNPTQDKLYLVGDLVARGDKSLECLCFVKSNAAQT
APAH_HAEIE      --------------YFVGDLQGCYDELQLLLERVDFNPTQDKLYLVGDLVARGDKSLECLRFVKSNAAQT
APAH_XANCP      --------------WAIGDLQGCYDITQQLLEKIRFDPAQDTLWFCGDLVNRGGQSLETLRLVHSLRAHS
APAH_SHEFN      --------------YFVGDIQGCYSELQLLLQKVAFNPSKDQLWAVGDLVARGTESLATLRFFQ------
APAH_PSEE4      --------------YAVGDLQGCLQPLKCLLERAHFNPAVDRLWLVGDLVNRGPESLETLRYL-----YS
APAH_COXBU      --------------YIIGDVQGCYRELQELLELIQFDSTKDRLGFVGDLVNRGPNSLEVLRFLKSPLI--
APAH_COXBR      --------------YIIGDVQGCYRELQELLELIQFDSTKDRLGFVGDLVNRGPNSLEVLRFLKSPLI--
APAH_COXBN      --------------YIIGDVQGCYRELQELLELIQFDSTKDRLGFVGDLVNRGPNSLEVLRFLKSPLI--
APAH_COXB2      --------------YIIGDVQGCYRELQELLELIQFDSTKDRLGFVGDLVNRGPNSLEVLRFLKSPLI--
APAH_COXB1      --------------YIIGDVQGCYRELQELLELIQFDSTKDRLGFVGDLVNRGPNSLEVLRFLKSPLI--
APAH_PASMU      --------------YLVGDLQGCYDELQRLLEKVQFDSTQDQLYLVGDLVARGDKSLECLRFVKSKSAKT
APAH_ENT38      --------------YLIGDVHGCYDELIALLKQVDFTPGQDTLWLTGDLVARGPGSLDVLRFVKSDSVRL
APAH_ACTSZ      --------------YFVGDLHGCFDELQKLLERVRFDPVKDKLYFTGDLIARGEKSLECLRFVKNTSAQT
APAH_ACTPJ      --------------YVVGDLHGCFDELQLLLKQVNYNPAQDELWLTGDLVARGAKSLECLRFVKDPKNNT
APAH_XANOR      --------------WAIGDLQGCYDITQRLLEKINFDPAQDTLWFCGDLVNRGGQSLETLRLVHSLRAHS
APAH_XANOP      --------------WAIGDLQGCYDITQRLLEKINFDPAQDTLWFCGDLVNRGGQSLETLRLVHSLRAHS
APAH_XANOM      --------------WAIGDLQGCYDITQRLLEKINFDPAQDTLWFCGDLVNRGGQSLETLRLVHSLRAHS
APAH_XANC5      --------------WAIGDLQGCYDITQRLLEKINFDPAQDTLWFCGDLVNRGGQSLETLRLVHSLRAHS
APAH_XANAC      --------------WAIGDLQGCYDITQRLLEKINFDPAQDTLWFCGDLVNRGGQSLETLRLVHSLRAHS
APAH_PHOLL      --------------YLIGDIHGCYRELRALLTKANFDPTKDTLWLTGDLVARGPDSLKVLRYVKQSAARM
APAH_MANSM      --------------YFVGDLQGCYDELQRLLEKVRFDPTQDLLYLVGDLVARGDKSLECLRLVKSKSAQT
APAH_KLEP3      --------------YLIGDVHGCYDELIALLAQVEFDPSTDTLWLTGDLVARGPGSLEVLRYVKSDSVRL
APAH_ERWT9      --------------YLIGDIHGCYHELQSLLDQVQFNPETDQLWLTGDLVARGPDSLEVLRFVRA--LGN
APAH_BAUCH      --------------YFIGDIHGCYDELQTILEKVAFDPLIDTLWLTGDLVARGPSSLEVLRMIR-RLGNS
APAH_ACTP7      --------------YIVGDLHGCFDELQLLLKQVNYNPAQDELWLTGDLVARGAKSLECLRFVKDPKNNT
APAH_ACTP2      --------------YIVGDLHGCFDELQLLLKQVNYNPAQDELWLTGDLVARGAKSLECLRFVKDPKNNT
APAH_ENTS8      --------------YLIGDVHGCYDELVALLQQVEFTPGQDTLWLTGDLVARGPGSLEVLRYVRSDSVRM
APAH_CHRVO      --------------YAIGDIQGCFEPFQQLLRLIDFNPGKDTLWLTGDLVNRGPQSLEVLRWVHQDQVEM
APAH_CELJU      --------------YAIGDIQGCYEPLQCLLEKIDFDTAKDKLWLVGDLINRGPDSLATLRFL-----YS
APAH_SHEB9      --------------YFVGDIQGCFAELQKLLAKVDFNPSRDELWAVGDLVARGPDSLATLRFFRSDSAKT
APAH_SHEB8      --------------YFVGDIQGCFAELQKLLAKVDFNPSRDELWAVGDLVARGPDSLATLRFFRSDSAKT
APAH_SHEB5      --------------YFVGDIQGCFAELQKLLAKVDFNPSRDELWAVGDLVARGPDSLATLRFFRSDSAKT
APAH_SHEB2      --------------YFVGDIQGCFAELQKLLAKVDFNPSRDELWAVGDLVARGPDSLATLRFFRSDSAKT
APAH_SALTY      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALTI      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALSV      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALPC      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALPB      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALNS      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALHS      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALG2      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALEP      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALDC      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALA4      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SHISS      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_SHIFL      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_SHIF8      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_SHIDS      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_SHIBS      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_SHIB3      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_SHESR      --------------YFVGDVQGCFAELKRLLAEVDFNPSRDELWAVGDLVARGPDSLATLRYFQSDAGKT
APAH_SHESM      --------------YFVGDVQGCFAELKRLLAEVDFNPSRDELWAVGDLVARGPDSLATLRYFQSDAGKT
APAH_SHEON      --------------YFVGDVQGCFAELQRLLAKVDFNPSRDELWAVGDLVARGPDSLATLRFFQ------
APAH_SALCH      --------------YLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGSLDMLRYVK-SLGNS
APAH_PSEU5      --------------YAVGDLQGCLEPLTCLLERVDFSPSRDCLWLAGDLVNRGPQSLEALRFVRESSAIT
APAH_PSE14      --------------YAVGDLQGCLEPLQCLLEHVHFNPEHDRLWLVGDLVNRGPQSLETLRYL-YGLRES
APAH_MARMS      --------------YVIGDLQGCLTPLVQLLEQINYHPEQDKLWFAGDLINRGEESLETLRFIKSLGNNA
APAH_KLEP7      --------------YLIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSDSVRL
APAH_ESCF3      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOUT      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOSM      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOSE      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOLU      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOLI      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOLC      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOL6      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOL5      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOK1      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOHS      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECODH      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECOBW      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO8A      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO81      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO7I      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO5E      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO57      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO55      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO45      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO27      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ECO24      --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_ALHEH      --------------YAIGDLQGCLSPLEALLEQLRFDPARDRIWFVGDLVNRGPDSVRVLRYV-------
APAH_VIBHB      --------------YIVGDIQGCFDELQQLLEQVNFSASHDQLWLAGDLVARGPKSLETLRFVK------
APAH_SALPK      --------------YLIGDVHGCYDELIALLQQVEFMPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALPA      --------------YLIGDVHGCYDELIALLQQVEFMPDTDTLWLTGDLVARGPGSLDVLRYVK-SLGNS
APAH_SALAR      --------------YLIGDVHGCYDELIALLQQVEFTPETDTLWLTGDLVARGPGSLDVLRYVKSDSVRL
APAH_SACD2      --------------YAVGDIQGCYRALKLLLKKVKFNADNDHLWVAGDLVNRGPESLKSLRYIKKPSATL
APAH_BUCBP      --------------YFIGDIHGCFNELMHLLEKVSFDANSDVLWLTGDLINRGPKSLEVLRFV-------
PPZ_SCHPO       ---------------IVGDVHGQYSDLIRLFEMCGFPPSSNYLF-LGDYVDRGKQSLETILLLRYPEFFL
APAH_SHESA      --------------YFVGDVQGCFAELQRLLAKVDFNPSCDELWAVGDLVARGPDSLATLRYFQSDAGKT
APAH_HAES2      --------------YLVGDLQGCYDELQLLLETVQFNPVQDKLYLVGDLVARGDKSLECLRFVKSAAAQM
APAH_HAES1      --------------YLVGDLQGCYDELQLLLETVQFNPVQDKLYLVGDLVARGDKSLECLRFVKSAAAQM
APAH_AZOVD      --------------YATGDLQGCLEPLKCLLDRVAFEPGRDRLWLTGDLVNRGPQSLETLRFI-----HG
APAH_ACTAC      --------------YLIGDLHGCYDEFQMLLERVRFDPAQDTLYLTGDLLARGDNS--------------
APAH_XYLFA      --------------WAIGDLQGCYDATQRLLENIRFDPSQDTLWFCGDLVNRGGQSLETLRLVYSLRSHS
APAH_CHRSD      --------------YAIGDLQGCHAEFEALLERIAFEPRRDRLWLVGDLVNRGPGSLACLRAVK------
APAH_SHESH      --------------YFVGDIQGCFEELQLLLNNVDFNPSKDQLWAVGDLVARGPGSLETLRY--------
BSL1_ARATH      ---------------VFGDLHGQFGDLMRLFDEYGFPSTADYLF-LGDYVDRGQHSLETITLLEYPEVHL
APAH_VIBPA      --------------YIVGDIQGCFDELQQLLKRVNFSTQHDQLWLAGDLVARGPKSLETLRFVK------
APAH_THIDA      --------------YAIGDIQGCHEPLLRLLDVVRFDAASDRLWFVGDLVNRGPDSLETLRFI-------
APAH_CITK8      --------------YLIGDVHGCYDELIALLHQVEFTPGSDTLWLTGDLVARGPGSLEVLRYVKSDCVRL
APAH_PECCP      --------------YLVGDVHGCLVELKALLAQVSFNPEQDTLWLTGDLVARGPDSLQVLRFVRSSAVRM
APAH_HAMD5      -------------NYLIGDVHGCFDELKALLAKVNFDKEKDTLWLTGDLISRGPQSLKVLRYARSKALRM
APAH_HAEDU      --------------YIMGDLHGCFTEFQQLLDKISYNPNYDELWLTGDIVARGEHSLACLRFIKDPKIKT
APAH_ERWCT      --------------YLVGDVHGCLVELKALLAQVSFNPEQDTLWLTGDLVARGPDSLQVLRFVRSSSVRM
APAH_NITMU      --------------YAVGDLQGCYREFRELLDLVRFDETKDKLWLVGDLVNRGPDSLSVLRFVK------
APAH_LEGPH      -------------DYAIGDVQGCYDPLQRLLELIDFNEKEDCLWFVGDLVNRGPDSLAVLRFI-------
APAH_LEGPC      -------------DYAIGDVQGCYDPLQRLLELIDFNEKEDCLWFVGDLVNRGPDSLAVLRFI-------
APAH_LEGPA      -------------DYAIGDVQGCYDPLQRLLELIDFNEKEDCLWFVGDLVNRGPDSLAVLRFI-------
PP15_ARATH      ---------LAAPVKICGDIHGQYSDLLRLFEYGGFPPAANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP14_ARATH      ---------------ICGDIHGQYSDLLRLFEYGGFPPSANYLF-LGDYVDRGKQSLETICLLKYPGFFL
APAH_LEGPL      -------------DYAIGDIQGCYDPLQRLLELIDFNEKDDCLWFVGDLVNRGPDSLAVLRFI-------
APAH_DELAS      --------------YCIGDIQGCHDAFERLLHRVDFSASRDTLYILGDLVNRGPESDKVLCMAAGDSMRA
APAH_ACIAC      --------------YCIGDIQGCDAALQRLLDTVDFSPSRDTVYLLGDLVNRGPQSAEVL----------
PP18_ARATH      ---------------ICGDIHGQYQDLLRLFEYGGYPPSANYLF-LGDYVDRGKQSLETICLLRYPKIYL
PP11_ARATH      ---------------ICGDIHGQYSDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
APAH_EDWI9      ---------------LIGDVHGCYHELRDLLSLADFDPARDTLWLTGDLVARGPDSLAVLRYVK-SLGDS
APAH_ACISJ      --------------YCVGDIQGCDDAFERLLATIGFSPSRDALYVLGDLVNRGPDSAAVL----------
PPZ1_YEAST      ---------------IVGDVHGQYGDLLRLFTKCGFPPSSNYLF-LGDYVDRGKQSLETILLLKYPEFFL
PP1_BRAOL       ---------------ICGDIHGQYSDLLRLFEYGGFPPDANYLF-LGDYVDRGKQSLETICFLKYPEFFL
APAH_SHELP      --------------YFVGDIQGCFDELHVLLAKVDFNPSKDELWVVGDMVARGTQSLETLRYLK------
APAH_NITOC      --------------YAIGDIQGCYDEFQQLLKEIHFDEQADQLWLAGDLVNRGPKSLEVIRFVHGLGKRA
PP12_ARATH      ---------------ICGDIHGQYSDLLRLFEYGGFPPTANYLF-LGDYVDRGKQSLETICLLKYPEFFL
BSL1_ORYSJ      ---------------VFGDLHGQFGDLMRLFDEYGYPSTADYLF-LGDYVDRGQHSLETITLLEYPEVHL
APAH_VIBVU      -------------NYIVGDIQGCFDELMLLLAQCQFDKNQDTLWVAGDLVARGPKSLETLRFIK-SLGNS
APAH_PSYIN      --------------YIVGDVHGCFDELQALLELAQFKKNKDQLWITGDLVGRGPKSLETLRFVK------
APAH_DIAST      --------------YCVGDIQGCDDAFERLLATIGFSPSRDTLYVLGDLVNRGPHSAAVL----------
PP1_BRANA       -----------------GDIHGQYQDLLRLFEYGGYPPSANFLF-LGDYVDRGKQSLETICLLRYPKIYL
APAH_NITEU      --------------YAIGDLQGCHRHFLELLDLIGFNATRDRLWLVGDIVNRGPDSLSLLRTL-------
APAH_HAEPS      --------------YIVGDLHGCFDEFQLLLEQANFDPQYDELWLTGDLVARGENSLACLRYVKALGERA
PP1_ORYSJ       ---------------ICGDIHGQYSDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
APAH_VIBCM      -------------NYIVGDIQGCFDELQQLLKQAEFNSQLDTLWFAGDLVARGPKSLETLRFV-YQLGDA
APAH_VIBCH      -------------NYIVGDIQGCFDELQQLLKQAEFNSQLDTLWFAGDLVARGPKSLETLRFV-YQLGDA
APAH_VIBC3      -------------NYIVGDIQGCFDELQQLLKQAEFNSQLDTLWFAGDLVARGPKSLETLRFV-YQLGDA
APAH_PHOPR      --------------YLVGDIQGCLDDLLYLLEQAKFTPKQDELWLAGDLVARGPKSLETLRFVK------
APAH_XYLFT      --------------WAIGDLQGCYDATQRLLENIRFDPSQDTLWFCGDLVNRGGQS--------------
APAH_XYLF2      --------------WAIGDLQGCYDATQRLLENIRFDPSQDTLWFCGDLVNRGGQS--------------
APAH_SODGM      --------------YLIGDIHGCYDELKIILAQVRFDPAVDTLWLTGDLVARGTGSLEVL----------
APAH_COLP3      --------------YLVGDIQGCFNELSSLLLQVNFDRNNDVLYLAGDLVARGPNSLETLRFVK------
PPZ2_YEAST      ---------------IVGDVHGQYADLLRLFTKCGFPPMANYLF-LGDYVDRGKQSLETILLLKYPEFFL
PP1B_DROME      ---------------ICGDIHGQYTDLLRLFEYGGFPPAANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP19_ARATH      ---------------ICGDIHGQYQDLLRLFEYGGYPPSANYLF-LGDYVDRGKQSLETICLLRYPKIFL
PP12_SCHPO      ---------------ICGDIHGQYSDLLRLFEYGGYPPDANYLF-LGDYVDRGKQSLEVICLLKYPEFFL
PPY_DROME       ---------------ICGDIHGQFTDLLRIFKACGFPPKANYLF-LGDYVDRGKQSLETICLLKYPLFFL
PP1_PHAVU       ---------------VCGDIHGQYQDLLRLFEYGGYPPAANYLF-LGDYVDRGKQSLETICLLRYPKIFL
PP1B_XENTR      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_XENLA      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_RAT        ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_RABIT      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_PONAB      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_PIG        ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_MOUSE      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_HUMAN      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_CHICK      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_CANFA      ---------------ICGDIHGQYADLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1B_BOVIN      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP13_TOBAC      -----------------GDIHGQYSDLLRLFEYGGFPPEANYLF-LGDYVDRGRQSLETICLLKYPEFFL
PP12_ACECL      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPKFFL
PP11_ACECL      ---------------ICGDIHGQYTDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFI
GLC7A_CAEEL     ---------------ICGDIHGQYNDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
GLC7A_CAEBR     ---------------ICGDIHGQYNDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
APAH_AERS4      ----------------VGDIQGCYDDLRRLLDLAKFDPAKDVLWLCGDLVARGPDSLKTLRYVKSLGQRA
PP1G_CANFA      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP17_ARATH      ---------------ICGDIHGQYPDLLRLFEHGGYPPNSNYLF-LGDYVDRGKQSLETICLLKFPEFFL
PP12_YEAST      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFI
PP12_TOBAC      ---------------ICGDIHGQYGDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP11_TOBAC      ---------------ICGDIHGQYGDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFL
APAH_NEIG2      --------------YAIGDIQGCFDELTALLGKIGFNHGTDTLWLTGDIVNRGPKSLETLQFCHENSVQI
APAH_NEIG1      --------------YAIGDIQGCFDELTALLGKIGFNHGTDTLWLTGDIVNRGPKSLETLQFCHENSVQI
APAH_AERHH      ----------------VGDIQGCYDDLRRLLDLAEFDPANDVLWLCGDLVARGPDSLNTLRFVKGLGNRA
PPIG_XENTR      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1_NEUCR       ---------------ICGDIHGQYYDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFI
PP1_EMENI       ---------------ICGDIHGQYYDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLETICLLKYPEFFV
PP1_DICDI       ---------------ICGDIHGQYYDLLRLFEYGGFPPQSNYLF-LGDYVDRGKQSLETICLLKYPEFFI
PP1G_RAT        ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1G_MOUSE      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1G_HUMAN      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1G_BOVIN      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1GB_XENLA     ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1GA_XENLA     ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1A_RAT        ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1A_RABIT      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1A_HUMAN      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1A_CANFA      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
PP1A_BOVIN      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
APAH_VIBVY      -------------NYIVGDIQGCFDELMLLLAQCQFDKNVDTLWVAGDLVARGPKSLETLRFIKSLGDSA
APAH_TOLAT      --------------YFVGDIQGCNDELQQLLALAQFNPQHDELWLTGDLVARGPKSLDVLRFV-------
PP1A_MOUSE      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLRYPEFFL
PP11_SCHPO      ---------------ICGDIHGQYYDLLRLFEYGGFPPEANYLF-LGDYVDRGKQSLEVICLLKYPEFFI
GLC7B_CAEEL     ---------------ICGDVHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
GLC7B_CAEBR     ---------------ICGDVHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYPEFFL
APAH_NEIMA      --------------YAIGDIQGCFDELTALLGKIGFNHGTDTLWLTGDIVNRGPKSLETL----------
APAH_BUCAT      --------------YFISDIHGCYEEFRILLEKSSFNDKKDYLWIAGDLVSRGPDSLEVVKYL-------
PP1_MAIZE       ---------------ICGDVHGQYSDLLRLFDYGGYPPQANYLF-LGDYVDRGKQSLETICLLKYPEFFL
APAH_TERTT      --------------YAIGDVQGCLKALERLLDKLNFDERNDRLWFAGDLVNRGENSLGVLR-LVYGLGDA
YY06_CAEEL      ---------------VFGDIHGQLGDLLQFTNEVGRPPDFQYLF-LGDYVDRGPNSLEVTVWLFSKKVHL
APAH_BUCAI      --------------YFISDIHGCYEEFRILLEKSSFNDKKDYLWIAGDLVSRGPDSLKVVKYL-------
APAH_BUCA5      --------------YFISDIHGCYEEFRILLEKSSFNDKKDYLWIAGDLVSRGPDSLKVVKYL-------
APAH_WIGBR      --------------YLIGDIHGCYSEFKSMLDLINFNLKNDIIWIAGDFIGRGPDS--------------
PRPE_GEOSW      ---------------IIGDIHGCYSEFVKLTKKLGYEPDGRKLGFVGDLTDRGPQSLQTVSLVERESAYY
PP2B_ASPFU      ---------------VCGDVHGQYYDLMKLFE-VGGDPSETRYLFLGDYVDRGYFSIECVLWALKIWYPN
PP12_TRYBB      ---------------ICGDVHGQYTDLLRLFDLGGFPPDANYIF-LGDYVDRGDQSLETICLLSFPTFFL
PP12_DROME      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYSEFFL
PP11_DROME      ---------------ICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLLKYAEFFL
BSL2_ORYSJ      ---------------IFGDLHGQFGDLMRLFDEYGAPSTADYLF-LGDYVDRGQHSLETITLLEYPLVHL
PP2B_NEUCR      ---------------VCGDVHGQYYDLMKLFE-VGGDPAETRYLFLGDYVDRGYFSIECVLYLHYPWL--
PP11_TRYBB      ---------------ICGDVHGQYTDLLRLFDLGGFPPDANYIF-LGDYVDRGDQSLERICLLSFPTFFL
APAH_ALISL      --------------YFVGDIQGCXXXXXXXXXQVSFDKEKDQLWLTGDLVARGPKSLETLRFVK------
PP2B_EMENI      ---------------VCGDVHGQYYDLMKLFE-VGGDPAETRYLFLGDYVDRGYFSIECVLWALKIWYPN
PPP5_RAT        ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
PPP5_MOUSE      ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
PPP5_HUMAN      ---------------VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLLYPHFHL
PP1_MEDVA       ---------------ICGDVHGQFSDLLRLFEYGGYPPEANYLF-LGDYVDRGKQSIETICLLKYKEFFL
PP16_ARATH      ---------------ICGDVHGQFPDLLRLFEYGGYPPAANYLF-LGDYVDRGKQSIETICLLKYKFFFL
PRPE_GEOKA      ---------------IIGDIHGCFREFAALTETLGYHPDGRKLGFVGDLTDRGPESLNMIALVERNLAYY
PPQ1_YEAST      ---------------VVGDVHGQFNDLLRILKLSGV-PSDTNYLFLGDYVDRGKNSLETIXXIKYDNFFM
PPE2_MOUSE      ---------------VCGDLHGQLDDLIFIFYKNGL-PSPERAYVFGDFVDRGKDSVEVLMMLVYPEFHL
PP13_DROME      ---------------ICGDIHGQYYDLLRLFEYGGYPPEANYLF-LGDYVDRGKQSLETICLLKYSEFFL
PRPE_BACHD      ---------------IIGDVHGCYDELMELIDKLGYDHPDGRLLAVGDLTDRGPHSLEVI----------
PRPE_BACCR      ---------------IIGDIHGCFQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACC4      ---------------IIGDIHGCFQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACC2      ---------------IIGDIHGCFQEFQNLTEKLGYNPEQRKLAFVGDITDRGPHS---LRMIEIVW---
PP13_ARATH      ---------------ICGDTHGQFSDLLRLFEYGGYPPAANYLF-LGDYVDRGKQSVETICLLKYKEFFL
APAH_VIBFM      --------------YFVGDIQGCXXXXXXXXXRVEFNREKDQLWLTGDLVARGPKSLETLRFVK------
APAH_VIBF1      --------------YFVGDIQGCXXXXXXXXXRVEFNREKDQLWLTGDLVARGPKSLETLRFVK------
PRPE_BACLD      ---------------VIGDIHGCYDEMIALIEKLGYSPENRTLVFLGDLTDRGPKSLEVVEFV-------
PPE2_HUMAN      ---------------VCGDLHGQLDDLIFIFYKNGL-PSPERSYVFGDFVDRGKDSVEILMMLVYPEFHL
PPE1_RAT        --FTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEKNPYVFNGDFVDRGNNSMEILSFLVYPTLHL
PP2A_BRANA      ---------------ICGDIHGQFHDLAELFRIGGMCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PRPE_GEOTN      ---------------IIGDIHGCYREFTALTEKLGYHPDGRKLGFVGDLTDRGPES--------------
PP2B2_YEAST     ---------------VCGDIHGQYFDLLKLFE-VGGDPATTSYLFLGDYVDRGSFSFECLIYLDHFWL--
PP2B1_YEAST     ---------------ICGDIHGQYYDLLKLFE-VGGDPAEIDYLFLGDYVDRGAFSFECLIYLNLGRFWM
PP2A4_ARATH     ---------------ICGDIHGQFHDLAELFRIGGMCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
BSU1_ARATH      ---------------VFGDIHGQYGDLMRLFHEYGHPSVEDYLF-LGDYVDRGQHSLEIIMLLEYPKIHL
APAH_HERAR      --------------YAIGDLQGCHTQLLALLDKIDAITPQAQLVFVGDIVNRGPKSLATLRHL-YGLRQR
YT91_CAEEL      ---------------VIGDIHAQYQDMNRLFDLIGRVP-EEKLMFLGDYVDRGPQGIEVLILLYRDRIYL
PRPE_BACHK      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACCZ      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACCQ      ---------------IIGDIHGCFQEFQDLTKKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACC7      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACC3      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACC1      ---------------IIGDIHGCFQEFQDLTKKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACC0      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACAN      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACAH      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACAC      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PRPE_BACAA      ---------------IIGDIHGCLQEFQNLTEKLGYNPDQRKLAFVGDITDRGPHS---LRMIEIVW---
PP2B1_CRYNV     ---------------VCGDIHGQYYDLMKLFE-VGGNPADTRYLFLGDYVDRGYFSIECVLWSLKMWYPD
BSL3_ARATH      ---------------IFGDLHGQFGDLMRLFDEYG-SPSTDYLF-LGDYVDRGQHSLETITLLEYQHVHL
PPE1_HUMAN      ---------------ICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILSFLVYPDLHL
PP2B_SCHPO      ---------------VCGDIHGQYYDLMKLFE-VGGNPANTQYLFLGDYVDRGYFSIECLLWALKIWYPK
PP2A5_TOBAC     ---------------ICGDIHGQFHDLAELFRIGGQCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQLTI
PPE1_MOUSE      ---------------ICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILCFLVYPSLHL
PP2A_TOBAC      ---------------ICGDIHGQFHDLAELFRIGGKCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PP2AB_RAT       ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLRYPRITI
PP2AB_RABIT     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLRYPRITI
PP2AB_PIG       ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLRYPRITI
PP2AB_MOUSE     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLRYPRITI
PP2AB_HUMAN     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLRYPRITI
PP2AB_BOVIN     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLRYPRITI
PP2AA_CHICK     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLRYPRITI
PP2A3_ARATH     ---------------ICGDIHGQFHDLAELFRIGGKCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PP2A1_EMENI     ---------------VCGDIHGQFHDLMELFRIGGPNPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PRPE_BACA2      ---------------IISDIHGCYDEMIALMQKLGYEHSEDRLVFAGDLTDRGPKSVEVMRFV-------
PP2B1_DROME     ---------------VCGDIHGQFFDLVKLFE-VGGPPATTRYLFLGDYVDRGYFSIECVLYLTYPTTLS
PP2AA_DICDI     ---------------VCGDIHGQFHDLMELFKIGGNCPDTNYLF-MGDYVDRGFYSVETVTLLYKDRVTI
PP2BA_RAT       ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
PP2BA_MOUSE     ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
PP2BA_HUMAN     ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
PP2BA_BOVIN     ----RQEKNLLDIDAVCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
PP2A2_ORYSJ     ---------------ICGDIHGQFHDLAELFRIGGKCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PP2A2_ORYSI     ---------------ICGDIHGQFHDLAELFRIGGKCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PP2A1_SCHPO     ---------------VCGDIHGQFHDLMELFNIGGPSPDTNYLF-MGDYVDRGYHSVETVSLLRYPQITI
PRPE_ANOFW      ---------------IIGDIHGCFHEFMLLTKKLGYHPNGRKLAFVGDLADRGPQSDTVISLVQQNKAVY
PPP5_ARATH      ---------------VCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEILTLFAFKCIYL
PP2BC_HUMAN     ---------------VCGDIHGQFFDLMKLFE-VGGSPSNTRYLFLGDYVDRGYFSIECVLYLNHPTLFL
PP2BA_DICDI     ---------------VCGDTHGQFYDLIKIFENIGGNPANTNYLFLGDYVDRGYFSMEVIIYLNYPTFFL
PP2A4_YEAST     ---------------VVGDMHGQFHDMLEIFQIGGPVPDTNYLF-LGDYVDRGLYSVETIMLLRYPRIHL
ENV_FIVWO       -----------------------------------FGPNQTCMWNTSQIQD--PEIPKCGWWNQNAYYNS
PP2BC_MOUSE     ---------------VCGDVHGQFFDLMKLFE-VGGSPSNTRYLFLGDYVDRGYFSIECVLYLNHPTLFL
PP2BB_RAT       ---------------VCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
PP2BB_MOUSE     ---------------VCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
PP2BB_HUMAN     ---------------VCGDIHGQFFDLMKLFE-VGGSPANTRYLFLGDYVDRGYFSIECVLYLLYPTLFL
PP2A_MEDSA      ---------------ICGDIHGQFHDLAELFRIGGKCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PP2A2_ERYGR     ---------------VCGDIHGQFHDLMELFRIGGPNPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
APAH_JANMA      --------------YAIGDLQGCQTQLNDLLQKIDAVAPQAQLVFVGDIVNRGPRS--------------
PPT1_SCHPO      ---------------ICGDTHGQYFDLLNIFKLHGPPSPTNKYLFNGDFVDRGSWSTEAFTLYAYKLLYP
PPP6_RAT        ---------------VCGDIHGQFYDLCELFRTGGQVPDTNYIF-MGDFVDRGYYSLETFTYLKAKWITL
PPP6_MOUSE      ---------------VCGDIHGQFYDLCELFRTGGQVPDTNYIF-MGDFVDRGYYSLETFTYLKAKWITL
PPP6_HUMAN      ---------------VCGDIHGQFYDLCELFRTGGQVPDTNYIF-MGDFVDRGYYSLETFTYLKAKWITL
PPP5_SOLLC      -----------GKHFTVGDVHGQFYDLLNIFELNGL-PSEDNPYLFGDFVDRGSFSLEVLTLFAFKCIHL
PP2B2_DROME     ---------------VCGDIHGQFYDLMKLFE-VGGSPASTKYLFLGDYVDRGYFSIECVLYLTYPTLFL
YNV7_YEAST      ------------KEYVVGDVHGNYDEFIELIDKIGGLGENITMILLGDFIHKGPDSDKVVSYIHKDQVKC
YD44_SCHPO      ---------------VVGDIHGQFDDLLEIFRIGGPCPYTNYLF-LGDYVDRGYYSIETITLLRYPRITL
PP2A_ACECL      ---------------VCGDIHGQFHDMVELFKIGGTCPDTNYLF-MGDYVDRGYNSVETVTLLRYPRITI
PP2A1_NEUCR     ---------------VCGDIHGQFHDLMELFKIGGSCPDTNYLF-MGDYVDRGYYSVETVTLLRYPRITI
FYPP_PEA        ---------------VCGDIHGQFHDLMKLFQTGGHVPETNYIF-MGDFVDRGYNSLEVFTILRYPAITL
FYPP3_ARATH     ---------------VCGDIHGQFHDLMKLFQTGGHVPDTNYIF-MGDFVDRGYNSLEVFTILRYPAITL
PPP6_DROME      ---------------VCGDIHGQFYDLEQLFRTGGQVPHTNYIF-MGDFVDRGYYSLETFTRLRYPRITL
PP2B3_DROME     ---------------VCGDIHGQFYDLMKLFE-IGGSPATTKYLFLGDYVDRGYFSIECVLYLTYPTLFL
PP2A_HELAN      ---------------VCGDIHGQFHDLLELFRIGGSAPDTNYLF-MGDYVDRGYYSVETVTLLYRDRITI
PP2AA_RAT       ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
PP2AA_RABIT     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
PP2AA_PIG       ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
PP2AA_MOUSE     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
PP2AA_HUMAN     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
PP2AA_BOVIN     ---------------VCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLYRERITI
PP2A4_ORYSJ     ---------------ICGDIHGQFHDLVELFRIGGKCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PP2A4_ORYSI     ---------------ICGDIHGQFHDLVELFRIGGKCPDTNYLF-MGDYVDRGYYSVETVTLLRYPQITI
PP1L_ENCCU      ----------SGEVLIFGDTHGQYFDVVSILNKV-FDKDRMVIFN-GDYVDRGSHSVESLKILFPGRVHL
PP11_YEAST      ---------------VCGDIHGQFHDLLELFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLKYPKITL


                         .         .         *         .         .         .         .:140
query           CRGNHDEFVINAQNLEFDAAWWILVNGGEWWLDLDLTTRNLFSERFKQLPFAMEIETDQGKVGIVHADVP
PP_LAMBD        VRGNHEQMMIDGLSERGNVNHWLL-NGGGWFFNLDYDKEILLAHKADELPLIIELVSKDKKYVICHADYP
PRP1_SALTY      VRGNHEQMALDARASSQSTLW--LMNGGDWFTRLTAEHAAQAEALFQRLPWILEVRCRHSTHVIAHADYP
PRP1_ECOLI      VRGNHEQMAMDALASQQMSLW--LMNGGDWFIDNQQKQAKTALEKCQHLPFILEVHSRTGKHVIAHADYP
PRP2_SALTY      VVGNHEAMALDAFETQDGNFWY--VNGGYWYDSVTEKDRQEATETFKQRPHIIEVETSSKKYVIAHADYP
PRP2_ECOLI      VKGNHEAMALEAFETGDGNMW--LASGGDWFFDLNDSEQQEAIDKFHHLPHIIEITNDNIKYAIAHADYP
APAH_PSEPW      LTGNHDLHLLAAQNVE------------------------------------------------------
APAH_DECAR      VLGNHDLYLL------------------------------------------------------------
APAH_PSEFS      LRGNHDLHLLAASN--------------------------------------------------------
APAH_SERP5      VLGNHD----------------------------------------------------------------
APAH_PSEMY      LTGNHDHLLAVAHNIE------------------------------------------------------
APAH_PSEAE      VLGNHD----------------------------------------------------------------
APAH_PSEAB      VLGNHD----------------------------------------------------------------
APAH_PSEA8      VLGNHD----------------------------------------------------------------
APAH_PSEA7      VLGNHD----------------------------------------------------------------
APAH_METCA      VLGNHD----------------------------------------------------------------
APAH_PSEPK      VLGNHDLHLLAA----------------------------------------------------------
APAH_PSEP1      VLGNHDLHLLAA----------------------------------------------------------
APAH_YERPY      VLGNHD----------------------------------------------------------------
APAH_YERPS      VLGNHD----------------------------------------------------------------
APAH_YERPP      VLGNHD----------------------------------------------------------------
APAH_YERPN      VLGNHD----------------------------------------------------------------
APAH_YERPG      VLGNHD----------------------------------------------------------------
APAH_YERPE      VLGNHD----------------------------------------------------------------
APAH_YERPB      VLGNHD----------------------------------------------------------------
APAH_YERPA      VLGNHD----------------------------------------------------------------
APAH_YERP3      VLGNHD----------------------------------------------------------------
APAH_SHESW      VLGNHD----------------------------------------------------------------
APAH_SHEPC      VLGNHD----------------------------------------------------------------
APAH_PSEF5      IRGNHD----------------------------------------------------------------
APAH_PSEPG      IRGNHDLHLLAA----------------------------------------------------------
APAH_AZOSE      VLGNHDLYLL------------------------------------------------------------
APAH_THISH      ----------------------------------------------------------------------
APAH_PROMH      VLGNHD----------------------------------------------------------------
APAH_METFK      ----------------------------------------------------------------------
APAH_PSEPF      VLGNHDHLLAAAKNIE------------------------------------------------------
APAH_HAEI8      VLGNHDLHLI------------------------------------------------------------
APAH_PSESM      IRGNHD----------------------------------------------------------------
APAH_YERE8      VLGNHD----------------------------------------------------------------
APAH_PSEU2      VLGNHD----------------------------------------------------------------
APAH_HAEIN      VLGNHDLHLI------------------------------------------------------------
APAH_HAEIG      VLGNHDLHLI------------------------------------------------------------
APAH_HAEIE      VLGNHDLHLI------------------------------------------------------------
APAH_XANCP      VLGNHD----------------------------------------------------------------
APAH_SHEFN      ----------------------------------------------------------------------
APAH_PSEE4      IRGNHDLHLLAA----------------------------------------------------------
APAH_COXBU      VLGNHDLYLL------------------------------------------------------------
APAH_COXBR      VLGNHDLYLL------------------------------------------------------------
APAH_COXBN      VLGNHDLYLL------------------------------------------------------------
APAH_COXB2      VLGNHDLYLL------------------------------------------------------------
APAH_COXB1      VLGNHDLYLL------------------------------------------------------------
APAH_PASMU      VLGNHDLHLIS-----------------------------------------------------------
APAH_ENT38      VLGNHD----------------------------------------------------------------
APAH_ACTSZ      VLGNHD----------------------------------------------------------------
APAH_ACTPJ      ILGNHD----------------------------------------------------------------
APAH_XANOR      VLGNHD----------------------------------------------------------------
APAH_XANOP      VLGNHD----------------------------------------------------------------
APAH_XANOM      VLGNHD----------------------------------------------------------------
APAH_XANC5      VLGNHD----------------------------------------------------------------
APAH_XANAC      VLGNHD----------------------------------------------------------------
APAH_PHOLL      VLGNHD----------------------------------------------------------------
APAH_MANSM      VLGNHD----------------------------------------------------------------
APAH_KLEP3      VLGNHD----------------------------------------------------------------
APAH_ERWT9      CLGNHD----------------------------------------------------------------
APAH_BAUCH      VRGNHD----------------------------------------------------------------
APAH_ACTP7      ILGNHD----------------------------------------------------------------
APAH_ACTP2      ILGNHD----------------------------------------------------------------
APAH_ENTS8      VLGNHD----------------------------------------------------------------
APAH_CHRVO      VLGNHD----------------------------------------------------------------
APAH_CELJU      IRGNHD----------------------------------------------------------------
APAH_SHEB9      VLGNHD----------------------------------------------------------------
APAH_SHEB8      VLGNHD----------------------------------------------------------------
APAH_SHEB5      VLGNHD----------------------------------------------------------------
APAH_SHEB2      VLGNHD----------------------------------------------------------------
APAH_SALTY      VRGNHD----------------------------------------------------------------
APAH_SALTI      VRGNHD----------------------------------------------------------------
APAH_SALSV      VRGNHD----------------------------------------------------------------
APAH_SALPC      VRGNHD----------------------------------------------------------------
APAH_SALPB      VRGNHD----------------------------------------------------------------
APAH_SALNS      VRGNHD----------------------------------------------------------------
APAH_SALHS      VRGNHD----------------------------------------------------------------
APAH_SALG2      VRGNHD----------------------------------------------------------------
APAH_SALEP      VRGNHD----------------------------------------------------------------
APAH_SALDC      VRGNHD----------------------------------------------------------------
APAH_SALA4      VRGNHD----------------------------------------------------------------
APAH_SHISS      VLGNHD----------------------------------------------------------------
APAH_SHIFL      VLGNHD----------------------------------------------------------------
APAH_SHIF8      VLGNHD----------------------------------------------------------------
APAH_SHIDS      VLGNHD----------------------------------------------------------------
APAH_SHIBS      VLGNHD----------------------------------------------------------------
APAH_SHIB3      VLGNHD----------------------------------------------------------------
APAH_SHESR      VLGNHD----------------------------------------------------------------
APAH_SHESM      VLGNHD----------------------------------------------------------------
APAH_SHEON      ----------------------------------------------------------------------
APAH_SALCH      VRGNHD----------------------------------------------------------------
APAH_PSEU5      VLGNHDHLLAVAHNIE------------------------------------------------------
APAH_PSE14      VLGNHD----------------------------------------------------------------
APAH_MARMS      VLGNHD----------------------------------------------------------------
APAH_KLEP7      VLGNHD----------------------------------------------------------------
APAH_ESCF3      VLGNHD----------------------------------------------------------------
APAH_ECOUT      VLGNHD----------------------------------------------------------------
APAH_ECOSM      VLGNHD----------------------------------------------------------------
APAH_ECOSE      VLGNHD----------------------------------------------------------------
APAH_ECOLU      VLGNHD----------------------------------------------------------------
APAH_ECOLI      VLGNHD----------------------------------------------------------------
APAH_ECOLC      VLGNHD----------------------------------------------------------------
APAH_ECOL6      VLGNHD----------------------------------------------------------------
APAH_ECOL5      VLGNHD----------------------------------------------------------------
APAH_ECOK1      VLGNHD----------------------------------------------------------------
APAH_ECOHS      VLGNHD----------------------------------------------------------------
APAH_ECODH      VLGNHD----------------------------------------------------------------
APAH_ECOBW      VLGNHD----------------------------------------------------------------
APAH_ECO8A      VLGNHD----------------------------------------------------------------
APAH_ECO81      VLGNHD----------------------------------------------------------------
APAH_ECO7I      VLGNHD----------------------------------------------------------------
APAH_ECO5E      VLGNHD----------------------------------------------------------------
APAH_ECO57      VLGNHD----------------------------------------------------------------
APAH_ECO55      VLGNHD----------------------------------------------------------------
APAH_ECO45      VLGNHD----------------------------------------------------------------
APAH_ECO27      VLGNHD----------------------------------------------------------------
APAH_ECO24      VLGNHD----------------------------------------------------------------
APAH_ALHEH      ----------------------------------------------------------------------
APAH_VIBHB      ----------------------------------------------------------------------
APAH_SALPK      VRGNHD----------------------------------------------------------------
APAH_SALPA      VRGNHD----------------------------------------------------------------
APAH_SALAR      VLGNHD----------------------------------------------------------------
APAH_SACD2      VLGNHD----------------------------------------------------------------
APAH_BUCBP      ----------------------------------------------------------------------
PPZ_SCHPO       LRGNHECANITRVYGFYD----------ECKRRCNIKIWKTFINTFNCLPIASVV---AGKIFCVHGGLS
APAH_SHESA      VLGNHD----------------------------------------------------------------
APAH_HAES2      VLGNHDLHLIS-----------------------------------------------------------
APAH_HAES1      VLGNHDLHLIS-----------------------------------------------------------
APAH_AZOVD      MRGNHD----------------------------------------------------------------
APAH_ACTAC      ----------------------------------------------------------------------
APAH_XYLFA      VLGNHD----------------------------------------------------------------
APAH_CHRSD      ALGDSARVVLGNHDLHLLAAAW------------------------------------------------
APAH_SHESH      ----------------------------------------------------------------------
BSL1_ARATH      IRGNHEAADINALGFRLECIERMGENDGIWW------TR--FNQLFNYLPLAALIE---NKIICMHGGIG
APAH_VIBPA      ----------------------------------------------------------------------
APAH_THIDA      ----------------------------------------------------------------------
APAH_CITK8      VLGNHD----------------------------------------------------------------
APAH_PECCP      VLGNHD----------------------------------------------------------------
APAH_HAMD5      VLGNHD----------------------------------------------------------------
APAH_HAEDU      VLGNHD----------------------------------------------------------------
APAH_ERWCT      VLGNHD----------------------------------------------------------------
APAH_NITMU      ----------------------------------------------------------------------
APAH_LEGPH      ----------------------------------------------------------------------
APAH_LEGPC      ----------------------------------------------------------------------
APAH_LEGPA      ----------------------------------------------------------------------
PP15_ARATH      LRGNHECASINRIYGFYD----------ECKRRFNVKLWKVFTDTFNCLPVAAVIDE---KILCMHGGLS
PP14_ARATH      LRGNHECASIN-----------------------------------------------------------
APAH_LEGPL      ----------------------------------------------------------------------
APAH_DELAS      LLGNHDLHLLAA----------------------------------------------------------
APAH_ACIAC      ----------------------------------------------------------------------
PP18_ARATH      LRGNHEDAKINRIYGFYD----------ECKRRFNVRLWKVFTDCFNCLPVAALIDE---KILCMHGGLS
PP11_ARATH      LRGNHESASIN-----------------------------------------------------------
APAH_EDWI9      ARGNHD----------------------------------------------------------------
APAH_ACISJ      ----------------------------------------------------------------------
PPZ1_YEAST      LRGNHE----------------------------------------------------------------
PP1_BRAOL       LRGNHECASIN-----------------------------------------------------------
APAH_SHELP      ----------------------------------------------------------------------
APAH_NITOC      ITGNHDLHLLGLQPLHSKDTLAAILSAPDWLRHLPLLYRNSITLIHAGLPPQWDIATAESCARELEA-VL
PP12_ARATH      LRGNHECASINRIYGFYD----------ECKRRFSVRLWKVFTDSFNCLPVAAVID---DKILCMHGGLS
BSL1_ORYSJ      IRGNHEAADINALGFRLECIERMGESDGIWW------TR--FNQLFNYLPLAAMIEK---KIICMHGGIG
APAH_VIBVU      AKGNHD----------------------------------------------------------------
APAH_PSYIN      ----------------------------------------------------------------------
APAH_DIAST      ----------------------------------------------------------------------
PP1_BRANA       LRGNHEDAKINRIYGFYD----------ECKRRFNVRLWKIFTDCFNCLPVAALID---DKILCMHGGLS
APAH_NITEU      ----------------------------------------------------------------------
APAH_HAEPS      VLGNHDVHLLS-----------------------------------------------------------
PP1_ORYSJ       LRGNHECASIN-----------------------------------------------------------
APAH_VIBCM      ARGNHD----------------------------------------------------------------
APAH_VIBCH      ARGNHD----------------------------------------------------------------
APAH_VIBC3      ARGNHD----------------------------------------------------------------
APAH_PHOPR      ----------------------------------------------------------------------
APAH_XYLFT      ----------------------------------------------------------------------
APAH_XYLF2      ----------------------------------------------------------------------
APAH_SODGM      ----------------------------------------------------------------------
APAH_COLP3      ----------------------------------------------------------------------
PPZ2_YEAST      LRGNHE----------------------------------------------------------------
PP1B_DROME      LRGNHECASIN-----------------------------------------------------------
PP19_ARATH      LRGNHEDAKINRIYGFYD----------ECKRRFNVRLWKIFTDCFNCLPVAALIDE---KILCMHGGLS
PP12_SCHPO      LRGNHEFASIN-----------------------------------------------------------
PPY_DROME       LRGNHESASIN-----------------------------------------------------------
PP1_PHAVU       LRGNHEEAKIN-----------------------------------------------------------
PP1B_XENTR      LRGNHECASIN-----------------------------------------------------------
PP1B_XENLA      LRGNHECASIN-----------------------------------------------------------
PP1B_RAT        LRGNHECASIN-----------------------------------------------------------
PP1B_RABIT      LRGNHECASIN-----------------------------------------------------------
PP1B_PONAB      LRGNHECASIN-----------------------------------------------------------
PP1B_PIG        LRGNHECASIN-----------------------------------------------------------
PP1B_MOUSE      LRGNHECASIN-----------------------------------------------------------
PP1B_HUMAN      LRGNHECASIN-----------------------------------------------------------
PP1B_CHICK      LRGNHECASIN-----------------------------------------------------------
PP1B_CANFA      LRGNHECASIN-----------------------------------------------------------
PP1B_BOVIN      LRGNHECASIN-----------------------------------------------------------
PP13_TOBAC      LRGNHECASIN-----------------------------------------------------------
PP12_ACECL      LRGNHECASIN-----------------------------------------------------------
PP11_ACECL      LRGNHECASIN-----------------------------------------------------------
GLC7A_CAEEL     LRGNHECASIN-----------------------------------------------------------
GLC7A_CAEBR     LRGNHECASIN-----------------------------------------------------------
APAH_AERS4      VTGNHD----------------------------------------------------------------
PP1G_CANFA      LRGNHECVSIN-----------------------------------------------------------
PP17_ARATH      LRGNHESASIN-----------------------------------------------------------
PP12_YEAST      LRGNHECASINRIYGFYD----------ECKRRYNIKLWKTFTDCFNCLPIAAIIDE---KIFCMHGGLS
PP12_TOBAC      LRGNHECASIN-----------------------------------------------------------
PP11_TOBAC      LRGNHECASIN-----------------------------------------------------------
APAH_NEIG2      VLGNHDLYLL------------------------------------------------------------
APAH_NEIG1      VLGNHDLYLL------------------------------------------------------------
APAH_AERHH      VTGNHD----------------------------------------------------------------
PPIG_XENTR      LRGNHECASIN-----------------------------------------------------------
PP1_NEUCR       LRGNHECASINRIYGFYD----------ECKRRYNIKLWKTFTDCFNCLPIAAIIDE---KIFTMHGGLS
PP1_EMENI       LRGNHECASINRIYGFYD----------ECKRRYNIKLWKTFTDCFNCLPIAAIIDE---KIFTMHGGLS
PP1_DICDI       LRGNHECASIN-----------------------------------------------------------
PP1G_RAT        LRGNHECASIN-----------------------------------------------------------
PP1G_MOUSE      LRGNHECASIN-----------------------------------------------------------
PP1G_HUMAN      LRGNHECASIN-----------------------------------------------------------
PP1G_BOVIN      LRGNHECASIN-----------------------------------------------------------
PP1GB_XENLA     LRGNHECASIN-----------------------------------------------------------
PP1GA_XENLA     LRGNHECASIN-----------------------------------------------------------
PP1A_RAT        LRGNHECASIN-----------------------------------------------------------
PP1A_RABIT      LRGNHECASIN-----------------------------------------------------------
PP1A_HUMAN      LRGNHECASIN-----------------------------------------------------------
PP1A_CANFA      LRGNHECASIN-----------------------------------------------------------
PP1A_BOVIN      LRGNHECASIN-----------------------------------------------------------
APAH_VIBVY      VLGNHDLHLI------------------------------------------------------------
APAH_TOLAT      ----------------------------------------------------------------------
PP1A_MOUSE      LRGNHECASIN-----------------------------------------------------------
PP11_SCHPO      LRGNHECASIN-----------------------------------------------------------
GLC7B_CAEEL     LRGNHECASIN-----------------------------------------------------------
GLC7B_CAEBR     LRGNHECASIN-----------------------------------------------------------
APAH_NEIMA      ----------------------------------------------------------------------
APAH_BUCAT      ----------------------------------------------------------------------
PP1_MAIZE       LRGNHECASVN-----------------------------------------------------------
APAH_TERTT      ALGNHDLHLLSA----------------------------------------------------------
YY06_CAEEL      LRGNHEVRRVN-----------------------------------------------------------
APAH_BUCAI      ----------------------------------------------------------------------
APAH_BUCA5      ----------------------------------------------------------------------
APAH_WIGBR      ----------------------------------------------------------------------
PRPE_GEOSW      VPGNHCNKLYRGRNVQITHG---LETTVEEYRALPPSEQAMIRKKFMRLYEAAPLQLDNGRLIIAHAGLR
PP2B_ASPFU      LRGNHE----------------------------------------------------------------
PP12_TRYBB      LRGNHECSSIN-----------------------------------------------------------
PP12_DROME      LRGNHECASIN-----------------------------------------------------------
PP11_DROME      LRGNHECASIN-----------------------------------------------------------
BSL2_ORYSJ      IRGNHEAADINALGFRIECIERMGERDGIW-------TWHRMNRLFNWLPLAALIEK---KIICMHGGIG
PP2B_NEUCR      LRGNHE----------------------------------------------------------------
PP11_TRYBB      LRGNHECSSIN-----------------------------------------------------------
APAH_ALISL      ----------------------------------------------------------------------
PP2B_EMENI      LRGNHE----------------------------------------------------------------
PPP5_RAT        LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
PPP5_MOUSE      LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
PPP5_HUMAN      LRGNHETDNMN-QIYGFE---------GEVKAKYTAQMYELFSEVFEWLPLAQCI---NGKVLIMH----
PP1_MEDVA       LRGNHECASIN-----------------------------------------------------------
PP16_ARATH      LRGNHECASIN-----------------------------------------------------------
PRPE_GEOKA      VPGNHGRNVQIAHGLETTVAEYRTLPPSEQEM-----IRRKFIRLYEQAPLYAVL--DEGRLVIAHAGIR
PPQ1_YEAST      LRGNHESANVTKMYGFYD----------ECKRRLSSKVWKMFVDVFNTLPLAAII---QDKIFCVHGGIS
PPE2_MOUSE      NRGNHEDHLVN-----------------------------------------------------------
PP13_DROME      LRGNHECASIN-----------------------------------------------------------
PRPE_BACHD      ----------------------------------------------------------------------
PRPE_BACCR      ----------------------------------------------------------------------
PRPE_BACC4      ----------------------------------------------------------------------
PRPE_BACC2      ----------------------------------------------------------------------
PP13_ARATH      LRGNHECASIN-----------------------------------------------------------
APAH_VIBFM      ----------------------------------------------------------------------
APAH_VIBF1      ----------------------------------------------------------------------
PRPE_BACLD      ----------------------------------------------------------------------
PPE2_HUMAN      NRGNHEDHMVN-----------------------------------------------------------
PPE1_RAT        NRGNHEDFMMN-----------------------------------------------------------
PP2A_BRANA      LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVESE---IFCLHGGLS
PRPE_GEOTN      ----------------------------------------------------------------------
PP2B2_YEAST     LRGNHE----------------------------------------------------------------
PP2B1_YEAST     LRGNHE----------------------------------------------------------------
PP2A4_ARATH     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KIFTDLFDYFPLTALVESE------------
BSU1_ARATH      IRGNHESLAMN-----------------------------------------------------------
APAH_HERAR      ARGNHD----------------------------------------------------------------
YT91_CAEEL      LRGNHETPSVN-----------------------------------------------------------
PRPE_BACHK      ----------------------------------------------------------------------
PRPE_BACCZ      ----------------------------------------------------------------------
PRPE_BACCQ      ----------------------------------------------------------------------
PRPE_BACC7      ----------------------------------------------------------------------
PRPE_BACC3      ----------------------------------------------------------------------
PRPE_BACC1      ----------------------------------------------------------------------
PRPE_BACC0      ----------------------------------------------------------------------
PRPE_BACAN      ----------------------------------------------------------------------
PRPE_BACAH      ----------------------------------------------------------------------
PRPE_BACAC      ----------------------------------------------------------------------
PRPE_BACAA      ----------------------------------------------------------------------
PP2B1_CRYNV     LRGNHE----------------------------------------------------------------
BSL3_ARATH      IRGNHEAADINALGFRIECIERMGERDGIWW--------HRINRLFNWLPLAALIEK---KIICMHGGIG
PPE1_HUMAN      NRGNHEDFMMN-----------------------------------------------------------
PP2B_SCHPO      LRGNHE----------------------------------------------------------------
PP2A5_TOBAC     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KTFTDLFDYFPLTALVESE---IFCLHGGLS
PPE1_MOUSE      NRGNHEDFMMN-----------------------------------------------------------
PP2A_TOBAC      LRGNHESRQITQVYGFYDECLRKYGNANVW---------KTFTDLFDYFPLTALVESE---IFCLHGGLS
PP2AB_RAT       LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AB_RABIT     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AB_PIG       LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AB_MOUSE     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AB_HUMAN     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AB_BOVIN     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AA_CHICK     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2A3_ARATH     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KIFTDLFDYFPLTALVESE------------
PP2A1_EMENI     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALIE---NQIFCLHGGLS
PRPE_BACA2      ----------------------------------------------------------------------
PP2B1_DROME     LRGNHE----------------------------------------------------------------
PP2AA_DICDI     LRGNHESRQITQVYGFYDECLRKYGNPNVW---------KLFTDLFDYLPLTALIE---NQVFCLHGGLS
PP2BA_RAT       LRGNHE----------------------------------------------------------------
PP2BA_MOUSE     LRGNHE----------------------------------------------------------------
PP2BA_HUMAN     LRGNHE----------------------------------------------------------------
PP2BA_BOVIN     LRGNHE----------------------------------------------------------------
PP2A2_ORYSJ     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KTFTDLFDYFPLTALVESE------------
PP2A2_ORYSI     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KTFTDLFDYFPLTALVESE------------
PP2A1_SCHPO     LRGNHESRQITQVYGFYDECLRKYGNANVW---------QYFTDLFDYLPLTALIE---DRIFCLHGGLS
PRPE_ANOFW      VPGNHDKLYRFFLGRNVQVTHGLETTVAEWEQADEKTIRTQFMKLYENAPLYAIL--DDGKLVIAHAGIR
PPP5_ARATH      ARGNHESKSMNK----------IYGFEGEVRSKLSEKFVDLFAEVFCYLPLAHVI---NGKVFVVH----
PP2BC_HUMAN     LRGNHE----------------------------------------------------------------
PP2BA_DICDI     LRGNHE----------------------------------------------------------------
PP2A4_YEAST     LRGNHE----------------------------------------------------------------
ENV_FIVWO       CRWEHTDVQFQCQRTQSQPGSWIRANRWEWRPDFEKVKVSLQCNSTKNLTFAMRSSGDYGEV--------
PP2BC_MOUSE     LRGNHE----------------------------------------------------------------
PP2BB_RAT       LRGNHE----------------------------------------------------------------
PP2BB_MOUSE     LRGNHE----------------------------------------------------------------
PP2BB_HUMAN     LRGNHE----------------------------------------------------------------
PP2A_MEDSA      LRGNHE----------------------------------------------------------------
PP2A2_ERYGR     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTNLFDFLPLTALIE---NQIFCLHGGLS
APAH_JANMA      ----------------------------------------------------------------------
PPT1_SCHPO      -----DAVFINRGNHETDDMNKVYGFEGECRSKYNERTFNIFSETFSLLP--------------------
PPP6_RAT        LRGNHESRQITQVYGFYDECQTKYGNANAW---------RYCTKVFDMLTVAALIDE---QILCVHGGLS
PPP6_MOUSE      LRGNHESRQITQVYGFYDECQTKYGNANAW---------RYCTKVFDMLTVAALIDE---QILCVHGGLS
PPP6_HUMAN      LRGNHESRQITQVYGFYDECQTKYGNANAW---------RYCTKVFDMLTVAALIDE---QILCVHGGLS
PPP5_SOLLC      ARGNHESKSMNK----------IYGFEGEVRSKLSEIFVELFAEVFCCLPLAHVINE---KVFVVH----
PP2B2_DROME     LRGNHE----------------------------------------------------------------
YNV7_YEAST      VLGNHEILVMMAY-LNPDFSKWV-----------------------------------------------
YD44_SCHPO      LRGNHE----------------------------------------------------------------
PP2A_ACECL      LRGNHE----------------------------------------------------------------
PP2A1_NEUCR     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALID--------------
FYPP_PEA        LRGNHE----------------------------------------------------------------
FYPP3_ARATH     LRGNHE----------------------------------------------------------------
PPP6_DROME      LRGNHETRQITKVYGFFDECFSKYGNANGW----------------------------------------
PP2B3_DROME     LRGNHE----------------------------------------------------------------
PP2A_HELAN      LRGNHESRQITQVYGFFDECLRKYGNANVW---------KHFTDLFDYLPLTALIES---QIFCLHGGLS
PP2AA_RAT       LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AA_RABIT     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AA_PIG       LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AA_MOUSE     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AA_HUMAN     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2AA_BOVIN     LRGNHESRQITQVYGFYDECLRKYGNANVW---------KYFTDLFDYLPLTALVD---GQIFCLHGGLS
PP2A4_ORYSJ     LRGNHESRQITQVYGFYDECLRKYGSANVW---------KIFTDLFDYFPLTALVESE---IFCLHGGLS
PP2A4_ORYSI     LRGNHESRQITQVYGFYDECLRKYGSANVW---------KIFTDLFDYFPLTALVESE---IFCLHGGLS
PP1L_ENCCU      TRGNHELSDINRVYGFYDEV------KRKYPFSSDSVYRR-FQDAFRALPISIIVNE---KVFITHGGLP
PP11_YEAST      VRGNHE----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ANLNWTRFVAEIERGNPAIHKYALWSRSRATGKCTTPVEGIERVYCGHTVIKGGTLKIVGNVYFIDTGAA
PP_LAMBD        FD--------EYEFGKPVDHQQVIWNRERISNSIVKEIKGADTFIFGHTAVK--PLKFANQMY-IDTGAV
PRP1_SALTY      ASYQWQKKV--------DLHQ-VLWSRERLINK-RGGISGADHFWFGHTPLR--RRMDFANVHYIDTGAV
PRP1_ECOLI      DDVEWQKDV--------DLHQ-VLWSRSRGERQKGQGITGADHFWFGHTPLRHRV--DIGNLHYIDTGAV
PRP2_SALTY      DD--------SYDYGKQVDIDSVLWSRDRLLGSLIHPIRGADTFIFGHMIVDYTT--TFANQIYIDTGS-
PRP2_ECOLI      G--------SEYLFGKEIAESELLWPVDRVQKSLNQQINGADYFIFGHMMF--DNIQTFANQIYIDTGS-
APAH_PSEPW      ----------------------------------------------------------------------
APAH_DECAR      ----------------------------------------------------------------------
APAH_PSEFS      ----------------------------------------------------------------------
APAH_SERP5      ----------------------------------------------------------------------
APAH_PSEMY      ----------------------------------------------------------------------
APAH_PSEAE      ----------------------------------------------------------------------
APAH_PSEAB      ----------------------------------------------------------------------
APAH_PSEA8      ----------------------------------------------------------------------
APAH_PSEA7      ----------------------------------------------------------------------
APAH_METCA      ----------------------------------------------------------------------
APAH_PSEPK      ----------------------------------------------------------------------
APAH_PSEP1      ----------------------------------------------------------------------
APAH_YERPY      ----------------------------------------------------------------------
APAH_YERPS      ----------------------------------------------------------------------
APAH_YERPP      ----------------------------------------------------------------------
APAH_YERPN      ----------------------------------------------------------------------
APAH_YERPG      ----------------------------------------------------------------------
APAH_YERPE      ----------------------------------------------------------------------
APAH_YERPB      ----------------------------------------------------------------------
APAH_YERPA      ----------------------------------------------------------------------
APAH_YERP3      ----------------------------------------------------------------------
APAH_SHESW      ----------------------------------------------------------------------
APAH_SHEPC      ----------------------------------------------------------------------
APAH_PSEF5      ----------------------------------------------------------------------
APAH_PSEPG      ----------------------------------------------------------------------
APAH_AZOSE      ----------------------------------------------------------------------
APAH_THISH      ----------------------------------------------------------------------
APAH_PROMH      ----------------------------------------------------------------------
APAH_METFK      ----------------------------------------------------------------------
APAH_PSEPF      ----------------------------------------------------------------------
APAH_HAEI8      ----------------------------------------------------------------------
APAH_PSESM      ----------------------------------------------------------------------
APAH_YERE8      ----------------------------------------------------------------------
APAH_PSEU2      ----------------------------------------------------------------------
APAH_HAEIN      ----------------------------------------------------------------------
APAH_HAEIG      ----------------------------------------------------------------------
APAH_HAEIE      ----------------------------------------------------------------------
APAH_XANCP      ----------------------------------------------------------------------
APAH_SHEFN      ----------------------------------------------------------------------
APAH_PSEE4      ----------------------------------------------------------------------
APAH_COXBU      ----------------------------------------------------------------------
APAH_COXBR      ----------------------------------------------------------------------
APAH_COXBN      ----------------------------------------------------------------------
APAH_COXB2      ----------------------------------------------------------------------
APAH_COXB1      ----------------------------------------------------------------------
APAH_PASMU      ----------------------------------------------------------------------
APAH_ENT38      ----------------------------------------------------------------------
APAH_ACTSZ      ----------------------------------------------------------------------
APAH_ACTPJ      ----------------------------------------------------------------------
APAH_XANOR      ----------------------------------------------------------------------
APAH_XANOP      ----------------------------------------------------------------------
APAH_XANOM      ----------------------------------------------------------------------
APAH_XANC5      ----------------------------------------------------------------------
APAH_XANAC      ----------------------------------------------------------------------
APAH_PHOLL      ----------------------------------------------------------------------
APAH_MANSM      ----------------------------------------------------------------------
APAH_KLEP3      ----------------------------------------------------------------------
APAH_ERWT9      ----------------------------------------------------------------------
APAH_BAUCH      ----------------------------------------------------------------------
APAH_ACTP7      ----------------------------------------------------------------------
APAH_ACTP2      ----------------------------------------------------------------------
APAH_ENTS8      ----------------------------------------------------------------------
APAH_CHRVO      ----------------------------------------------------------------------
APAH_CELJU      ----------------------------------------------------------------------
APAH_SHEB9      ----------------------------------------------------------------------
APAH_SHEB8      ----------------------------------------------------------------------
APAH_SHEB5      ----------------------------------------------------------------------
APAH_SHEB2      ----------------------------------------------------------------------
APAH_SALTY      ----------------------------------------------------------------------
APAH_SALTI      ----------------------------------------------------------------------
APAH_SALSV      ----------------------------------------------------------------------
APAH_SALPC      ----------------------------------------------------------------------
APAH_SALPB      ----------------------------------------------------------------------
APAH_SALNS      ----------------------------------------------------------------------
APAH_SALHS      ----------------------------------------------------------------------
APAH_SALG2      ----------------------------------------------------------------------
APAH_SALEP      ----------------------------------------------------------------------
APAH_SALDC      ----------------------------------------------------------------------
APAH_SALA4      ----------------------------------------------------------------------
APAH_SHISS      ----------------------------------------------------------------------
APAH_SHIFL      ----------------------------------------------------------------------
APAH_SHIF8      ----------------------------------------------------------------------
APAH_SHIDS      ----------------------------------------------------------------------
APAH_SHIBS      ----------------------------------------------------------------------
APAH_SHIB3      ----------------------------------------------------------------------
APAH_SHESR      ----------------------------------------------------------------------
APAH_SHESM      ----------------------------------------------------------------------
APAH_SHEON      ----------------------------------------------------------------------
APAH_SALCH      ----------------------------------------------------------------------
APAH_PSEU5      ----------------------------------------------------------------------
APAH_PSE14      ----------------------------------------------------------------------
APAH_MARMS      ----------------------------------------------------------------------
APAH_KLEP7      ----------------------------------------------------------------------
APAH_ESCF3      ----------------------------------------------------------------------
APAH_ECOUT      ----------------------------------------------------------------------
APAH_ECOSM      ----------------------------------------------------------------------
APAH_ECOSE      ----------------------------------------------------------------------
APAH_ECOLU      ----------------------------------------------------------------------
APAH_ECOLI      ----------------------------------------------------------------------
APAH_ECOLC      ----------------------------------------------------------------------
APAH_ECOL6      ----------------------------------------------------------------------
APAH_ECOL5      ----------------------------------------------------------------------
APAH_ECOK1      ----------------------------------------------------------------------
APAH_ECOHS      ----------------------------------------------------------------------
APAH_ECODH      ----------------------------------------------------------------------
APAH_ECOBW      ----------------------------------------------------------------------
APAH_ECO8A      ----------------------------------------------------------------------
APAH_ECO81      ----------------------------------------------------------------------
APAH_ECO7I      ----------------------------------------------------------------------
APAH_ECO5E      ----------------------------------------------------------------------
APAH_ECO57      ----------------------------------------------------------------------
APAH_ECO55      ----------------------------------------------------------------------
APAH_ECO45      ----------------------------------------------------------------------
APAH_ECO27      ----------------------------------------------------------------------
APAH_ECO24      ----------------------------------------------------------------------
APAH_ALHEH      ----------------------------------------------------------------------
APAH_VIBHB      ----------------------------------------------------------------------
APAH_SALPK      ----------------------------------------------------------------------
APAH_SALPA      ----------------------------------------------------------------------
APAH_SALAR      ----------------------------------------------------------------------
APAH_SACD2      ----------------------------------------------------------------------
APAH_BUCBP      ----------------------------------------------------------------------
PPZ_SCHPO       PSLSHMDDIREIPR--------------------------------------------------------
APAH_SHESA      ----------------------------------------------------------------------
APAH_HAES2      ----------------------------------------------------------------------
APAH_HAES1      ----------------------------------------------------------------------
APAH_AZOVD      ----------------------------------------------------------------------
APAH_ACTAC      ----------------------------------------------------------------------
APAH_XYLFA      ----------------------------------------------------------------------
APAH_CHRSD      ----------------------------------------------------------------------
APAH_SHESH      ----------------------------------------------------------------------
BSL1_ARATH      RSISTVEQIEKIER--------------------------------------------------------
APAH_VIBPA      ----------------------------------------------------------------------
APAH_THIDA      ----------------------------------------------------------------------
APAH_CITK8      ----------------------------------------------------------------------
APAH_PECCP      ----------------------------------------------------------------------
APAH_HAMD5      ----------------------------------------------------------------------
APAH_HAEDU      ----------------------------------------------------------------------
APAH_ERWCT      ----------------------------------------------------------------------
APAH_NITMU      ----------------------------------------------------------------------
APAH_LEGPH      ----------------------------------------------------------------------
APAH_LEGPC      ----------------------------------------------------------------------
APAH_LEGPA      ----------------------------------------------------------------------
PP15_ARATH      PELINVEQIKNIER--------------------------------------------------------
PP14_ARATH      ----------------------------------------------------------------------
APAH_LEGPL      ----------------------------------------------------------------------
APAH_DELAS      ----------------------------------------------------------------------
APAH_ACIAC      ----------------------------------------------------------------------
PP18_ARATH      PDLDNLNQIREIQR--------------------------------------------------------
PP11_ARATH      ----------------------------------------------------------------------
APAH_EDWI9      ----------------------------------------------------------------------
APAH_ACISJ      ----------------------------------------------------------------------
PPZ1_YEAST      ----------------------------------------------------------------------
PP1_BRAOL       ----------------------------------------------------------------------
APAH_SHELP      ----------------------------------------------------------------------
APAH_NITOC      QGPNWRDFLAHMYGDKPVQWRDDLWERLRTISNCLT----------------------------------
PP12_ARATH      PDLTNVEQIKNIKR--------------------------------------------------------
BSL1_ORYSJ      RSINTIEQIEKLER--------------------------------------------------------
APAH_VIBVU      ----------------------------------------------------------------------
APAH_PSYIN      ----------------------------------------------------------------------
APAH_DIAST      ----------------------------------------------------------------------
PP1_BRANA       PELDNLNQIREIQR--------------------------------------------------------
APAH_NITEU      ----------------------------------------------------------------------
APAH_HAEPS      ----------------------------------------------------------------------
PP1_ORYSJ       ----------------------------------------------------------------------
APAH_VIBCM      ----------------------------------------------------------------------
APAH_VIBCH      ----------------------------------------------------------------------
APAH_VIBC3      ----------------------------------------------------------------------
APAH_PHOPR      ----------------------------------------------------------------------
APAH_XYLFT      ----------------------------------------------------------------------
APAH_XYLF2      ----------------------------------------------------------------------
APAH_SODGM      ----------------------------------------------------------------------
APAH_COLP3      ----------------------------------------------------------------------
PPZ2_YEAST      ----------------------------------------------------------------------
PP1B_DROME      ----------------------------------------------------------------------
PP19_ARATH      PELENLGQIREIQR--------------------------------------------------------
PP12_SCHPO      ----------------------------------------------------------------------
PPY_DROME       ----------------------------------------------------------------------
PP1_PHAVU       ----------------------------------------------------------------------
PP1B_XENTR      ----------------------------------------------------------------------
PP1B_XENLA      ----------------------------------------------------------------------
PP1B_RAT        ----------------------------------------------------------------------
PP1B_RABIT      ----------------------------------------------------------------------
PP1B_PONAB      ----------------------------------------------------------------------
PP1B_PIG        ----------------------------------------------------------------------
PP1B_MOUSE      ----------------------------------------------------------------------
PP1B_HUMAN      ----------------------------------------------------------------------
PP1B_CHICK      ----------------------------------------------------------------------
PP1B_CANFA      ----------------------------------------------------------------------
PP1B_BOVIN      ----------------------------------------------------------------------
PP13_TOBAC      ----------------------------------------------------------------------
PP12_ACECL      ----------------------------------------------------------------------
PP11_ACECL      ----------------------------------------------------------------------
GLC7A_CAEEL     ----------------------------------------------------------------------
GLC7A_CAEBR     ----------------------------------------------------------------------
APAH_AERS4      ----------------------------------------------------------------------
PP1G_CANFA      ----------------------------------------------------------------------
PP17_ARATH      ----------------------------------------------------------------------
PP12_YEAST      PDLNSMEQIRRVMR--------------------------------------------------------
PP12_TOBAC      ----------------------------------------------------------------------
PP11_TOBAC      ----------------------------------------------------------------------
APAH_NEIG2      ----------------------------------------------------------------------
APAH_NEIG1      ----------------------------------------------------------------------
APAH_AERHH      ----------------------------------------------------------------------
PPIG_XENTR      ----------------------------------------------------------------------
PP1_NEUCR       PDLNSMEQIRRVMR--------------------------------------------------------
PP1_EMENI       PDLNSMEQIRRVMR--------------------------------------------------------
PP1_DICDI       ----------------------------------------------------------------------
PP1G_RAT        ----------------------------------------------------------------------
PP1G_MOUSE      ----------------------------------------------------------------------
PP1G_HUMAN      ----------------------------------------------------------------------
PP1G_BOVIN      ----------------------------------------------------------------------
PP1GB_XENLA     ----------------------------------------------------------------------
PP1GA_XENLA     ----------------------------------------------------------------------
PP1A_RAT        ----------------------------------------------------------------------
PP1A_RABIT      ----------------------------------------------------------------------
PP1A_HUMAN      ----------------------------------------------------------------------
PP1A_CANFA      ----------------------------------------------------------------------
PP1A_BOVIN      ----------------------------------------------------------------------
APAH_VIBVY      ----------------------------------------------------------------------
APAH_TOLAT      ----------------------------------------------------------------------
PP1A_MOUSE      ----------------------------------------------------------------------
PP11_SCHPO      ----------------------------------------------------------------------
GLC7B_CAEEL     ----------------------------------------------------------------------
GLC7B_CAEBR     ----------------------------------------------------------------------
APAH_NEIMA      ----------------------------------------------------------------------
APAH_BUCAT      ----------------------------------------------------------------------
PP1_MAIZE       ----------------------------------------------------------------------
APAH_TERTT      ----------------------------------------------------------------------
YY06_CAEEL      ----------------------------------------------------------------------
APAH_BUCAI      ----------------------------------------------------------------------
APAH_BUCA5      ----------------------------------------------------------------------
APAH_WIGBR      ----------------------------------------------------------------------
PRPE_GEOSW      RDY--------IGRNDKKVQTFVLYGDTGETNPDGTPVKGSAWIVYGHTPVK--QPRIINRTINIDTGCV
PP2B_ASPFU      ----------------------------------------------------------------------
PP12_TRYBB      ----------------------------------------------------------------------
PP12_DROME      ----------------------------------------------------------------------
PP11_DROME      ----------------------------------------------------------------------
BSL2_ORYSJ      RSINHVEQIENLQR--------------------------------------------------------
PP2B_NEUCR      ----------------------------------------------------------------------
PP11_TRYBB      ----------------------------------------------------------------------
APAH_ALISL      ----------------------------------------------------------------------
PP2B_EMENI      ----------------------------------------------------------------------
PPP5_RAT        ----------------------------------------------------------------------
PPP5_MOUSE      ----------------------------------------------------------------------
PPP5_HUMAN      ----------------------------------------------------------------------
PP1_MEDVA       ----------------------------------------------------------------------
PP16_ARATH      ----------------------------------------------------------------------
PRPE_GEOKA      HDY--------IGRTDKKVKTFVLY--GDITGEMNTPVHGSAWVVYGHTPVE--KPRFVGRTVNIDTGCV
PPQ1_YEAST      PDLHDMKQIEKVAR--------------------------------------------------------
PPE2_MOUSE      ----------------------------------------------------------------------
PP13_DROME      ----------------------------------------------------------------------
PRPE_BACHD      ----------------------------------------------------------------------
PRPE_BACCR      ----------------------------------------------------------------------
PRPE_BACC4      ----------------------------------------------------------------------
PRPE_BACC2      ----------------------------------------------------------------------
PP13_ARATH      ----------------------------------------------------------------------
APAH_VIBFM      ----------------------------------------------------------------------
APAH_VIBF1      ----------------------------------------------------------------------
PRPE_BACLD      ----------------------------------------------------------------------
PPE2_HUMAN      ----------------------------------------------------------------------
PPE1_RAT        ----------------------------------------------------------------------
PP2A_BRANA      PSINFDR-VQEVPHGGPMCD--LLWS--------------------------------------------
PRPE_GEOTN      ----------------------------------------------------------------------
PP2B2_YEAST     ----------------------------------------------------------------------
PP2B1_YEAST     ----------------------------------------------------------------------
PP2A4_ARATH     ----------------------------------------------------------------------
BSU1_ARATH      ----------------------------------------------------------------------
APAH_HERAR      ----------------------------------------------------------------------
YT91_CAEEL      ----------------------------------------------------------------------
PRPE_BACHK      ----------------------------------------------------------------------
PRPE_BACCZ      ----------------------------------------------------------------------
PRPE_BACCQ      ----------------------------------------------------------------------
PRPE_BACC7      ----------------------------------------------------------------------
PRPE_BACC3      ----------------------------------------------------------------------
PRPE_BACC1      ----------------------------------------------------------------------
PRPE_BACC0      ----------------------------------------------------------------------
PRPE_BACAN      ----------------------------------------------------------------------
PRPE_BACAH      ----------------------------------------------------------------------
PRPE_BACAC      ----------------------------------------------------------------------
PRPE_BACAA      ----------------------------------------------------------------------
PP2B1_CRYNV     ----------------------------------------------------------------------
BSL3_ARATH      RSINHVEQIENIQR--------------------------------------------------------
PPE1_HUMAN      ----------------------------------------------------------------------
PP2B_SCHPO      ----------------------------------------------------------------------
PP2A5_TOBAC     PSIETLDNVRSFDRVQEVPHEGALWS--------------------------------------------
PPE1_MOUSE      ----------------------------------------------------------------------
PP2A_TOBAC      PSIETLDNIRNFDRVQEVPHEGALWS--------------------------------------------
PP2AB_RAT       PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AB_RABIT     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AB_PIG       PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AB_MOUSE     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AB_HUMAN     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AB_BOVIN     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AA_CHICK     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2A3_ARATH     ----------------------------------------------------------------------
PP2A1_EMENI     PSIDTLDNIRSLDRIQEVPHE-------------------------------------------------
PRPE_BACA2      ----------------------------------------------------------------------
PP2B1_DROME     ----------------------------------------------------------------------
PP2AA_DICDI     PSIDTLDHIENLDRVQEVPHEGALWS--------------------------------------------
PP2BA_RAT       ----------------------------------------------------------------------
PP2BA_MOUSE     ----------------------------------------------------------------------
PP2BA_HUMAN     ----------------------------------------------------------------------
PP2BA_BOVIN     ----------------------------------------------------------------------
PP2A2_ORYSJ     ----------------------------------------------------------------------
PP2A2_ORYSI     ----------------------------------------------------------------------
PP2A1_SCHPO     PSIDTLDHVRILDRVQEVPHE-------------------------------------------------
PRPE_ANOFW      GDY--------IGKSNQKVKKFVLYDGSPVRRDWAKHYRGDALIVYGHTPVK--EPRWLNNTVNIDTGCV
PPP5_ARATH      ----------------------------------------------------------------------
PP2BC_HUMAN     ----------------------------------------------------------------------
PP2BA_DICDI     ----------------------------------------------------------------------
PP2A4_YEAST     ----------------------------------------------------------------------
ENV_FIVWO       ----------------------------------------------------------------------
PP2BC_MOUSE     ----------------------------------------------------------------------
PP2BB_RAT       ----------------------------------------------------------------------
PP2BB_MOUSE     ----------------------------------------------------------------------
PP2BB_HUMAN     ----------------------------------------------------------------------
PP2A_MEDSA      ----------------------------------------------------------------------
PP2A2_ERYGR     PSIDTLDNIKSLDRIQEVPHE-------------------------------------------------
APAH_JANMA      ----------------------------------------------------------------------
PPT1_SCHPO      ----------------------------------------------------------------------
PPP6_RAT        PDIKTLDQIRTIERNQEIPHKGAVWS--------------------------------------------
PPP6_MOUSE      PDIKTLDQIRTIERNQEIPHKGAVWS--------------------------------------------
PPP6_HUMAN      PDIKTLDQIRTIERNQEIPHKGAVWS--------------------------------------------
PPP5_SOLLC      ----------------------------------------------------------------------
PP2B2_DROME     ----------------------------------------------------------------------
YNV7_YEAST      ----------------------------------------------------------------------
YD44_SCHPO      ----------------------------------------------------------------------
PP2A_ACECL      ----------------------------------------------------------------------
PP2A1_NEUCR     ----------------------------------------------------------------------
FYPP_PEA        ----------------------------------------------------------------------
FYPP3_ARATH     ----------------------------------------------------------------------
PPP6_DROME      ----------------------------------------------------------------------
PP2B3_DROME     ----------------------------------------------------------------------
PP2A_HELAN      PSLDTLDNIRALDRIQEVPHE-------------------------------------------------
PP2AA_RAT       PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AA_RABIT     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AA_PIG       PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AA_MOUSE     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AA_HUMAN     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2AA_BOVIN     PSIDTLDHIRALDRLQEVPHE-------------------------------------------------
PP2A4_ORYSJ     PSIDNLDSVRSLDRVQEVPHE-------------------------------------------------
PP2A4_ORYSI     PSIDNLDSVRSLDRVQEVPHE-------------------------------------------------
PP1L_ENCCU      ----------------------------------------------------------------------
PP11_YEAST      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YTFLGARLTLLPLxxxxx
PP_LAMBD        F-----------------
PRP1_SALTY      F---GGQLTL--------
PRP1_ECOLI      F---GGELTLVQL-----
PRP2_SALTY      ------------------
PRP2_ECOLI      ------------------
APAH_PSEPW      ------------------
APAH_DECAR      ------------------
APAH_PSEFS      ------------------
APAH_SERP5      ------------------
APAH_PSEMY      ------------------
APAH_PSEAE      ------------------
APAH_PSEAB      ------------------
APAH_PSEA8      ------------------
APAH_PSEA7      ------------------
APAH_METCA      ------------------
APAH_PSEPK      ------------------
APAH_PSEP1      ------------------
APAH_YERPY      ------------------
APAH_YERPS      ------------------
APAH_YERPP      ------------------
APAH_YERPN      ------------------
APAH_YERPG      ------------------
APAH_YERPE      ------------------
APAH_YERPB      ------------------
APAH_YERPA      ------------------
APAH_YERP3      ------------------
APAH_SHESW      ------------------
APAH_SHEPC      ------------------
APAH_PSEF5      ------------------
APAH_PSEPG      ------------------
APAH_AZOSE      ------------------
APAH_THISH      ------------------
APAH_PROMH      ------------------
APAH_METFK      ------------------
APAH_PSEPF      ------------------
APAH_HAEI8      ------------------
APAH_PSESM      ------------------
APAH_YERE8      ------------------
APAH_PSEU2      ------------------
APAH_HAEIN      ------------------
APAH_HAEIG      ------------------
APAH_HAEIE      ------------------
APAH_XANCP      ------------------
APAH_SHEFN      ------------------
APAH_PSEE4      ------------------
APAH_COXBU      ------------------
APAH_COXBR      ------------------
APAH_COXBN      ------------------
APAH_COXB2      ------------------
APAH_COXB1      ------------------
APAH_PASMU      ------------------
APAH_ENT38      ------------------
APAH_ACTSZ      ------------------
APAH_ACTPJ      ------------------
APAH_XANOR      ------------------
APAH_XANOP      ------------------
APAH_XANOM      ------------------
APAH_XANC5      ------------------
APAH_XANAC      ------------------
APAH_PHOLL      ------------------
APAH_MANSM      ------------------
APAH_KLEP3      ------------------
APAH_ERWT9      ------------------
APAH_BAUCH      ------------------
APAH_ACTP7      ------------------
APAH_ACTP2      ------------------
APAH_ENTS8      ------------------
APAH_CHRVO      ------------------
APAH_CELJU      ------------------
APAH_SHEB9      ------------------
APAH_SHEB8      ------------------
APAH_SHEB5      ------------------
APAH_SHEB2      ------------------
APAH_SALTY      ------------------
APAH_SALTI      ------------------
APAH_SALSV      ------------------
APAH_SALPC      ------------------
APAH_SALPB      ------------------
APAH_SALNS      ------------------
APAH_SALHS      ------------------
APAH_SALG2      ------------------
APAH_SALEP      ------------------
APAH_SALDC      ------------------
APAH_SALA4      ------------------
APAH_SHISS      ------------------
APAH_SHIFL      ------------------
APAH_SHIF8      ------------------
APAH_SHIDS      ------------------
APAH_SHIBS      ------------------
APAH_SHIB3      ------------------
APAH_SHESR      ------------------
APAH_SHESM      ------------------
APAH_SHEON      ------------------
APAH_SALCH      ------------------
APAH_PSEU5      ------------------
APAH_PSE14      ------------------
APAH_MARMS      ------------------
APAH_KLEP7      ------------------
APAH_ESCF3      ------------------
APAH_ECOUT      ------------------
APAH_ECOSM      ------------------
APAH_ECOSE      ------------------
APAH_ECOLU      ------------------
APAH_ECOLI      ------------------
APAH_ECOLC      ------------------
APAH_ECOL6      ------------------
APAH_ECOL5      ------------------
APAH_ECOK1      ------------------
APAH_ECOHS      ------------------
APAH_ECODH      ------------------
APAH_ECOBW      ------------------
APAH_ECO8A      ------------------
APAH_ECO81      ------------------
APAH_ECO7I      ------------------
APAH_ECO5E      ------------------
APAH_ECO57      ------------------
APAH_ECO55      ------------------
APAH_ECO45      ------------------
APAH_ECO27      ------------------
APAH_ECO24      ------------------
APAH_ALHEH      ------------------
APAH_VIBHB      ------------------
APAH_SALPK      ------------------
APAH_SALPA      ------------------
APAH_SALAR      ------------------
APAH_SACD2      ------------------
APAH_BUCBP      ------------------
PPZ_SCHPO       ------------------
APAH_SHESA      ------------------
APAH_HAES2      ------------------
APAH_HAES1      ------------------
APAH_AZOVD      ------------------
APAH_ACTAC      ------------------
APAH_XYLFA      ------------------
APAH_CHRSD      ------------------
APAH_SHESH      ------------------
BSL1_ARATH      ------------------
APAH_VIBPA      ------------------
APAH_THIDA      ------------------
APAH_CITK8      ------------------
APAH_PECCP      ------------------
APAH_HAMD5      ------------------
APAH_HAEDU      ------------------
APAH_ERWCT      ------------------
APAH_NITMU      ------------------
APAH_LEGPH      ------------------
APAH_LEGPC      ------------------
APAH_LEGPA      ------------------
PP15_ARATH      ------------------
PP14_ARATH      ------------------
APAH_LEGPL      ------------------
APAH_DELAS      ------------------
APAH_ACIAC      ------------------
PP18_ARATH      ------------------
PP11_ARATH      ------------------
APAH_EDWI9      ------------------
APAH_ACISJ      ------------------
PPZ1_YEAST      ------------------
PP1_BRAOL       ------------------
APAH_SHELP      ------------------
APAH_NITOC      ------------------
PP12_ARATH      ------------------
BSL1_ORYSJ      ------------------
APAH_VIBVU      ------------------
APAH_PSYIN      ------------------
APAH_DIAST      ------------------
PP1_BRANA       ------------------
APAH_NITEU      ------------------
APAH_HAEPS      ------------------
PP1_ORYSJ       ------------------
APAH_VIBCM      ------------------
APAH_VIBCH      ------------------
APAH_VIBC3      ------------------
APAH_PHOPR      ------------------
APAH_XYLFT      ------------------
APAH_XYLF2      ------------------
APAH_SODGM      ------------------
APAH_COLP3      ------------------
PPZ2_YEAST      ------------------
PP1B_DROME      ------------------
PP19_ARATH      ------------------
PP12_SCHPO      ------------------
PPY_DROME       ------------------
PP1_PHAVU       ------------------
PP1B_XENTR      ------------------
PP1B_XENLA      ------------------
PP1B_RAT        ------------------
PP1B_RABIT      ------------------
PP1B_PONAB      ------------------
PP1B_PIG        ------------------
PP1B_MOUSE      ------------------
PP1B_HUMAN      ------------------
PP1B_CHICK      ------------------
PP1B_CANFA      ------------------
PP1B_BOVIN      ------------------
PP13_TOBAC      ------------------
PP12_ACECL      ------------------
PP11_ACECL      ------------------
GLC7A_CAEEL     ------------------
GLC7A_CAEBR     ------------------
APAH_AERS4      ------------------
PP1G_CANFA      ------------------
PP17_ARATH      ------------------
PP12_YEAST      ------------------
PP12_TOBAC      ------------------
PP11_TOBAC      ------------------
APAH_NEIG2      ------------------
APAH_NEIG1      ------------------
APAH_AERHH      ------------------
PPIG_XENTR      ------------------
PP1_NEUCR       ------------------
PP1_EMENI       ------------------
PP1_DICDI       ------------------
PP1G_RAT        ------------------
PP1G_MOUSE      ------------------
PP1G_HUMAN      ------------------
PP1G_BOVIN      ------------------
PP1GB_XENLA     ------------------
PP1GA_XENLA     ------------------
PP1A_RAT        ------------------
PP1A_RABIT      ------------------
PP1A_HUMAN      ------------------
PP1A_CANFA      ------------------
PP1A_BOVIN      ------------------
APAH_VIBVY      ------------------
APAH_TOLAT      ------------------
PP1A_MOUSE      ------------------
PP11_SCHPO      ------------------
GLC7B_CAEEL     ------------------
GLC7B_CAEBR     ------------------
APAH_NEIMA      ------------------
APAH_BUCAT      ------------------
PP1_MAIZE       ------------------
APAH_TERTT      ------------------
YY06_CAEEL      ------------------
APAH_BUCAI      ------------------
APAH_BUCA5      ------------------
APAH_WIGBR      ------------------
PRPE_GEOSW      F-----------------
PP2B_ASPFU      ------------------
PP12_TRYBB      ------------------
PP12_DROME      ------------------
PP11_DROME      ------------------
BSL2_ORYSJ      ------------------
PP2B_NEUCR      ------------------
PP11_TRYBB      ------------------
APAH_ALISL      ------------------
PP2B_EMENI      ------------------
PPP5_RAT        ------------------
PPP5_MOUSE      ------------------
PPP5_HUMAN      ------------------
PP1_MEDVA       ------------------
PP16_ARATH      ------------------
PRPE_GEOKA      F---GGALTAL-------
PPQ1_YEAST      ------------------
PPE2_MOUSE      ------------------
PP13_DROME      ------------------
PRPE_BACHD      ------------------
PRPE_BACCR      ------------------
PRPE_BACC4      ------------------
PRPE_BACC2      ------------------
PP13_ARATH      ------------------
APAH_VIBFM      ------------------
APAH_VIBF1      ------------------
PRPE_BACLD      ------------------
PPE2_HUMAN      ------------------
PPE1_RAT        ------------------
PP2A_BRANA      ------------------
PRPE_GEOTN      ------------------
PP2B2_YEAST     ------------------
PP2B1_YEAST     ------------------
PP2A4_ARATH     ------------------
BSU1_ARATH      ------------------
APAH_HERAR      ------------------
YT91_CAEEL      ------------------
PRPE_BACHK      ------------------
PRPE_BACCZ      ------------------
PRPE_BACCQ      ------------------
PRPE_BACC7      ------------------
PRPE_BACC3      ------------------
PRPE_BACC1      ------------------
PRPE_BACC0      ------------------
PRPE_BACAN      ------------------
PRPE_BACAH      ------------------
PRPE_BACAC      ------------------
PRPE_BACAA      ------------------
PP2B1_CRYNV     ------------------
BSL3_ARATH      ------------------
PPE1_HUMAN      ------------------
PP2B_SCHPO      ------------------
PP2A5_TOBAC     ------------------
PPE1_MOUSE      ------------------
PP2A_TOBAC      ------------------
PP2AB_RAT       ------------------
PP2AB_RABIT     ------------------
PP2AB_PIG       ------------------
PP2AB_MOUSE     ------------------
PP2AB_HUMAN     ------------------
PP2AB_BOVIN     ------------------
PP2AA_CHICK     ------------------
PP2A3_ARATH     ------------------
PP2A1_EMENI     ------------------
PRPE_BACA2      ------------------
PP2B1_DROME     ------------------
PP2AA_DICDI     ------------------
PP2BA_RAT       ------------------
PP2BA_MOUSE     ------------------
PP2BA_HUMAN     ------------------
PP2BA_BOVIN     ------------------
PP2A2_ORYSJ     ------------------
PP2A2_ORYSI     ------------------
PP2A1_SCHPO     ------------------
PRPE_ANOFW      F---GGQLTAL-------
PPP5_ARATH      ------------------
PP2BC_HUMAN     ------------------
PP2BA_DICDI     ------------------
PP2A4_YEAST     ------------------
ENV_FIVWO       ------------------
PP2BC_MOUSE     ------------------
PP2BB_RAT       ------------------
PP2BB_MOUSE     ------------------
PP2BB_HUMAN     ------------------
PP2A_MEDSA      ------------------
PP2A2_ERYGR     ------------------
APAH_JANMA      ------------------
PPT1_SCHPO      ------------------
PPP6_RAT        ------------------
PPP6_MOUSE      ------------------
PPP6_HUMAN      ------------------
PPP5_SOLLC      ------------------
PP2B2_DROME     ------------------
YNV7_YEAST      ------------------
YD44_SCHPO      ------------------
PP2A_ACECL      ------------------
PP2A1_NEUCR     ------------------
FYPP_PEA        ------------------
FYPP3_ARATH     ------------------
PPP6_DROME      ------------------
PP2B3_DROME     ------------------
PP2A_HELAN      ------------------
PP2AA_RAT       ------------------
PP2AA_RABIT     ------------------
PP2AA_PIG       ------------------
PP2AA_MOUSE     ------------------
PP2AA_HUMAN     ------------------
PP2AA_BOVIN     ------------------
PP2A4_ORYSJ     ------------------
PP2A4_ORYSI     ------------------
PP1L_ENCCU      ------------------
PP11_YEAST      ------------------