[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57125.1

[Show Plain Result]


## Summary of Sequence Search
    1::257
   90::189     1e-04  30%  676 aa  VATI_ARCFU RecName: Full=V-type ATP synthase subunit I;AltName:
    1::257

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQVTTQ
VATI_ARCFU      -----------------------------------------------------------------QLKEK


                         .         .         *         .         .         .         .:140
query           LDSFRTYNRQLENLIRSQKEEFASLQQQLTDIEITQREIVPLMLRMVSSLKQFVALDIPFLPRERQTRIE
VATI_ARCFU      LDEYQQLIGERIEYLRSVDEKIASLQEQLNQIEPLKRLGIPARL-----LKGYKTLRV-FVGFVKENPTE


                         +         .         .         .         .         *         .:210
query           QLQILMDRADVSLSEKYRRLIEAYQVEVEYGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VATI_ARCFU      KFAQVTSDFEVFATEYEKELVVAVFVKAEYG---------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VATI_ARCFU      -----------------------------------------------