[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57138.1

[Show Plain Result]


## Summary of Sequence Search
    1::510
   68::209     2e-04  28%  312 aa  REPB_AGRRH RecName: Full=Putative replication protein B;
    1::510

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEYDRIKASIRAEGLDQPLVLSQEPGTSDYVLHSGGN
REPB_AGRRH      ----------------------------------DIDGLLTSIREQGQQVPILVRPHPSQPGRYQVAFGH


                         .         .         *         .         .         .         .:140
query           TRLKILKDLFEETGDDRFRWVNCVIKPWSQESNLLFAHLRENELRGALPFIDKALAVFDAKALLEKELAV
REPB_AGRRH      RRLRAVSELGLP--------VRAVVRELTDE-QVVVAQGQENNEREDLTFIEKARFAHRLNRQFSREIVI


                         +         .         .         .         .         *         .:210
query           ETLSQRQLEELFRERGFGLSHSMISKMGYAVDTLWPVMPKALAAGLGRPQVEKIRALxxxxxxxxxxxxx
REPB_AGRRH      AAMS--------------IDKSNLSKMLLLVDALPSELTDAIGAGVGRPSWQQLAEL-------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
REPB_AGRRH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
REPB_AGRRH      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
REPB_AGRRH      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
REPB_AGRRH      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxx
REPB_AGRRH      --------------------