[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57191.1

[Show Plain Result]


## Summary of Sequence Search
    1::442
   14::187     3e-54  55%  207 aa  YNF8_RHIME RecName: Full=Uncharacterized protein ORF8 in nfe
  222::323     3e-04  30%  390 aa  Y4RI_RHISN RecName: Full=Uncharacterized protein y4rI;
    1::442

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxFRHRLENLIDTRHELAKLAALIDWEFFDAQWGEAFCENGRPAIATRLIAGLHYLKH
YNF8_RHIME      --------------FRDRLDAIINPRQALVRLAGVIPWARFDEAFGGFYRPVGRPANATRLMVGLHYLKH
Y4RI_RHISN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TYGLSDEQVVQRWAENPYWQYFCGERYFQHELPLNPSSLTRWRQRLGDEGMESLLSATIDAAIASKAVKA
YNF8_RHIME      VHDLSDEEVVERWVENPYWQFFCGFEFFQHEAPIDASTMTPWRKRIGPQGLEELLKASVEAALQTGTARP
Y4RI_RHISN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RDLKCVTVDTTVQEKAIAFPTDSKLYNRARERLVRLAKAHGVPLRQSYxxxxxxxxxxxxxxxxxxxxxx
YNF8_RHIME      ESLERVNVDTTVQPKAIAHPTDSRLYLKALQMLVRHAKKHGIELRQSY----------------------
Y4RI_RHISN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLYALHAPEVECIAKGT
YNF8_RHIME      ----------------------------------------------------------------------
Y4RI_RHISN      -----------------------------------------------------KLASLFEPHVDIIVKGS


                         .         *         .         .         .         .         +:350
query           AHKRYEFGVKVSIATTNRSNLVVGAQSLPGSPYDGHTLKKALHQVERLTGQRPERCYVDLGYRGHDVDDV
YNF8_RHIME      ----------------------------------------------------------------------
Y4RI_RHISN      --RDVDYGHKLNL-TTGTSGLILDLVIEAGNPADSERLLPMLERHIAFYGEPPRQAAADGGYASR--ENL


                         .         .         .         .         *         .         .:420
query           DVFKARQKRGVTRTIRRELKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YNF8_RHIME      ----------------------------------------------------------------------
Y4RI_RHISN      SGAKARGIRDMAFHKKRGLK--------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxx
YNF8_RHIME      ----------------------
Y4RI_RHISN      ----------------------