[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57445.1

[Show Plain Result]


## Summary of Sequence Search
    1::325
    2::313     1e-31  32%  315 aa  Y209_BRUME RecName: Full=Putative peptide transport system permease
    1::312     1e-31  32%  314 aa  Y1050_BRUA2 RecName: Full=Putative peptide transport system
    1::312     1e-31  32%  314 aa  Y1031_BRUAB RecName: Full=Putative peptide transport system
    1::311     2e-31  32%  314 aa  Y1092_BRUSU RecName: Full=Putative peptide transport system
    1::336     1e-29  31%  339 aa  DPPB_ECOLI RecName: Full=Dipeptide transport system permease
    1::336     1e-29  31%  339 aa  DPPB_ECOL6 RecName: Full=Dipeptide transport system permease
    1::336     1e-29  31%  339 aa  DPPB_ECO57 RecName: Full=Dipeptide transport system permease
    1::312     1e-28  31%  313 aa  Y4TP_RHISN RecName: Full=Probable peptide ABC transporter permease
    1::314     5e-28  27%  316 aa  APPB_BACSU RecName: Full=Oligopeptide transport system permease
   40::305     3e-27  30%  308 aa  DPPB_BACSU RecName: Full=Dipeptide transport system permease
    1::332     8e-27  29%  333 aa  DPPB_HAEIN RecName: Full=Dipeptide transport system permease
    1::304     3e-24  27%  306 aa  GSIC_SALTI RecName: Full=Glutathione transport system permease
    1::304     3e-24  27%  306 aa  GSIC_SALCH RecName: Full=Glutathione transport system permease
    1::304     4e-24  27%  306 aa  GSIC_SALTY RecName: Full=Glutathione transport system permease
    1::304     5e-24  27%  306 aa  GSIC_SALPA RecName: Full=Glutathione transport system permease
    1::305     2e-23  25%  311 aa  OPPB_BACSU RecName: Full=Oligopeptide transport system permease
   13::332     2e-23  29%  333 aa  DPPB_BACPF RecName: Full=Dipeptide transport system permease
    1::305     6e-22  27%  306 aa  OPPB_SHIFL RecName: Full=Oligopeptide transport system permease
    1::305     6e-22  27%  306 aa  OPPB_ECOLI RecName: Full=Oligopeptide transport system permease
    1::305     6e-22  27%  306 aa  OPPB_ECOL6 RecName: Full=Oligopeptide transport system permease
    1::305     6e-22  27%  306 aa  OPPB_ECO57 RecName: Full=Oligopeptide transport system permease
  127::318     1e-21  35%  319 aa  Y3408_BRUSU RecName: Full=Putative peptide permease protein
    1::305     1e-21  28%  306 aa  OPPB_SALTY RecName: Full=Oligopeptide transport system permease
  203::318     2e-21  37%  319 aa  Y3860_BRUME RecName: Full=Putative peptide permease protein
  203::318     2e-21  37%  319 aa  Y2551_BRUO2 RecName: Full=Putative peptide permease protein
    1::304     8e-21  25%  306 aa  GSIC_SHIFL RecName: Full=Glutathione transport system permease
    1::304     8e-21  25%  306 aa  GSIC_SHIF8 RecName: Full=Glutathione transport system permease
    1::304     1e-20  26%  306 aa  GSIC_SHISS RecName: Full=Glutathione transport system permease
    1::304     1e-20  26%  306 aa  GSIC_SHIDS RecName: Full=Glutathione transport system permease
    1::304     1e-20  26%  306 aa  GSIC_SHIBS RecName: Full=Glutathione transport system permease
    1::304     1e-20  26%  306 aa  GSIC_ECOUT RecName: Full=Glutathione transport system permease
    1::304     1e-20  26%  306 aa  GSIC_ECOLI RecName: Full=Glutathione transport system permease
    1::304     1e-20  26%  306 aa  GSIC_ECOL5 RecName: Full=Glutathione transport system permease
    1::304     1e-20  26%  306 aa  GSIC_ECOK1 RecName: Full=Glutathione transport system permease
   85::304     1e-20  25%  306 aa  GSIC_ERWCT RecName: Full=Glutathione transport system permease
    1::304     1e-20  24%  306 aa  GSIC_ECOL6 RecName: Full=Glutathione transport system permease
    1::304     2e-20  26%  306 aa  GSIC_ECO57 RecName: Full=Glutathione transport system permease
  251::359     2e-20  41%  364 aa  YEJB_ECOLI RecName: Full=Inner membrane ABC transporter permease
  251::359     2e-20  41%  364 aa  YEJB_ECO57 RecName: Full=Inner membrane ABC transporter permease
  208::325     5e-20  42%  325 aa  Y1314_MYCBO RecName: Full=Putative peptide transport permease
  208::325     5e-20  42%  325 aa  Y1283_MYCTU RecName: Full=Putative peptide transport permease
   38::305     5e-20  27%  306 aa  OPPB_HAEIN RecName: Full=Oligopeptide transport system permease
  276::492     5e-20  30%  498 aa  AMIC_STRR6 RecName: Full=Oligopeptide transport system permease
  276::492     5e-20  30%  498 aa  AMIC_STRPN RecName: Full=Oligopeptide transport system permease
    1::307     3e-19  23%  314 aa  NIKB_ECOLI RecName: Full=Nickel transport system permease protein
  204::318     5e-18  36%  319 aa  OPPB_LACLS RecName: Full=Oligopeptide transport system permease
  204::318     5e-18  36%  319 aa  OPPB_LACLA RecName: Full=Oligopeptide transport system permease
  200::311     2e-14  34%  321 aa  SAPB_ECOLI RecName: Full=Peptide transport system permease protein
  200::311     2e-14  34%  321 aa  SAPB_ECO57 RecName: Full=Peptide transport system permease protein
  200::311     6e-14  34%  321 aa  SAPB_SALTY RecName: Full=Peptide transport system permease protein
  200::311     6e-14  34%  321 aa  SAPB_SALTI RecName: Full=Peptide transport system permease protein
  185::297     2e-13  30%  389 aa  OPPB_MYCPN RecName: Full=Oligopeptide transport system permease
    1::315     6e-13  24%  407 aa  OPPB_MYCGE RecName: Full=Oligopeptide transport system permease
  220::334     1e-12  31%  340 aa  DDPB_ECOLI RecName: Full=Probable D,D-dipeptide transport system
   10::306     6e-09  25%  328 aa  OPPB2_STAAW RecName: Full=Putative oligopeptide transport system
   10::306     6e-09  25%  328 aa  OPPB2_STAAS RecName: Full=Putative oligopeptide transport system
   10::306     6e-09  25%  328 aa  OPPB2_STAAN RecName: Full=Putative oligopeptide transport system
   10::306     6e-09  25%  328 aa  OPPB2_STAAM RecName: Full=Putative oligopeptide transport system
   10::306     6e-09  25%  328 aa  OPPB2_STAAC RecName: Full=Putative oligopeptide transport system
   10::306     6e-09  25%  328 aa  OPPB2_STAA8 RecName: Full=Putative oligopeptide transport system
   10::306     6e-09  25%  328 aa  OPPB2_STAA3 RecName: Full=Putative oligopeptide transport system
   10::306     7e-09  26%  328 aa  OPPB2_STAAB RecName: Full=Putative oligopeptide transport system
    7::306     1e-08  26%  328 aa  OPPB2_STAAR RecName: Full=Putative oligopeptide transport system
   88::265     4e-08  35%  303 aa  APPC_BACSU RecName: Full=Oligopeptide transport system permease
   72::234     1e-07  26%  294 aa  OPPC_LACLA RecName: Full=Oligopeptide transport system permease
   72::234     4e-07  26%  294 aa  OPPC_LACLS RecName: Full=Oligopeptide transport system permease
  185::294     2e-06  32%  296 aa  Y207_BRUME RecName: Full=Putative peptide transport system permease
  185::294     2e-06  32%  296 aa  Y1051_BRUA2 RecName: Full=Putative peptide transport system
  185::294     2e-06  32%  296 aa  Y1032_BRUAB RecName: Full=Putative peptide transport system
  185::294     3e-06  32%  296 aa  Y1093_BRUSU RecName: Full=Putative peptide transport system
   87::245     3e-06  31%  301 aa  GSID_ERWCT RecName: Full=Glutathione transport system permease
  211::282     1e-05  30%  321 aa  SAPB_HAEIN RecName: Full=Peptide transport system permease protein
  157::373     1e-05  21%  376 aa  OPPC_MYCPN RecName: Full=Oligopeptide transport system permease
  171::263     4e-05  32%  278 aa  CMPB_SYNP6 RecName: Full=Bicarbonate transport system permease
  171::263     4e-05  32%  278 aa  CMPB_SYNE7 RecName: Full=Bicarbonate transport system permease
  182::248     1e-04  34%  305 aa  OPPC_BACSU RecName: Full=Oligopeptide transport system permease
  223::269     2e-04  38%  341 aa  YEJE_ECOLI RecName: Full=Inner membrane ABC transporter permease
   84::245     0.001  31%  303 aa  GSID_SALTY RecName: Full=Glutathione transport system permease
   84::245     0.001  31%  303 aa  GSID_SALTI RecName: Full=Glutathione transport system permease
   84::245     0.001  31%  303 aa  GSID_SALPA RecName: Full=Glutathione transport system permease
   84::245     0.001  31%  303 aa  GSID_SALCH RecName: Full=Glutathione transport system permease
  178::291     0.001  30%  300 aa  DPPC_ECOLI RecName: Full=Dipeptide transport system permease
  178::291     0.001  30%  300 aa  DPPC_ECOL6 RecName: Full=Dipeptide transport system permease
  178::291     0.001  30%  300 aa  DPPC_ECO57 RecName: Full=Dipeptide transport system permease
    1::325

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLAYIVRRILYAIPILVGVNILTFALFFGINSPDDMARMHLGTKRVTQEAIDAWKRERGYDKPLFWNSDA
Y209_BRUME      MTALILKRVAQAIPVMLIVAILTFLLMKLL--PGDPAILIAGDG-ASPETVERIRVELGLDQPT------
Y1050_BRUA2     MTALILKRVAQAIPVMLIVAILTFLLMKLL--PGDPAILIAGDG-ASPETVERIRVELGLDQPT------
Y1031_BRUAB     MTALILKRVAQAIPVMLIVAILTFLLMKLL--PGDPAILIAGDG-ASPETVERIRVELGLDQPT------
Y1092_BRUSU     MTALILKRVAQAIPVMLIVAILTFLLMKLL--PGDPAILIAGDG-ASPETVERIRVELGLDQPT------
DPPB_ECOLI      MLQFILRRLGLVIPTFIGITLLTFAFVHMI--PGDPVMIMAGERGISPERHAQLLAELGLDKPMW-----
DPPB_ECOL6      MLQFILRRLGLVIPTFIGITLLTFAFVHMI--PGDPVMIMAGERGISPERHAQLLAELGLDKPMW-----
DPPB_ECO57      MLQFILRRLGLVIPTFIGITLLTFAFVHMI--PGDPVMIMAGERGISPERHAQLLAELGLDKPMW-----
Y4TP_RHISN      MGVYILRRLVSTIAVMAMVGIFIFLLLR--LAPGDPAAVIAGPT-ATEQMVANIREELGLNEPLHWASDV
APPB_BACSU      MAAYIIRRTLMSIPILLGITILSFVIMKA--APGDPMTLMMDPK-ISQADREQFIEKYGLNDP-------
DPPB_BACSU      -----------------------------------------GTNEAVQKNLEAYYH---LDDPLIF----
DPPB_HAEIN      MFKFVFKRILMVIPTFIAITLITFALVHFI--PGDPVEIMMGERGLTAEVHQQMMHQLGLDLPLYQQ---
GSIC_SALTI      MLNYVLKRLLGLIP--TXXXXXXXXXXXXXXXPGDPARLIAGPEADAQ-VIALVRQQLGLDQPLFWHYIT
GSIC_SALCH      MLNYVLKRLLGLIP--TXXXXXXXXXXXXXXXPGDPARLIAGPEADAQ-VIALVRQQLGLDQPLFWHYIT
GSIC_SALTY      MLNYVLKRLLGLIP--TXXXXXXXXXXXXXXXPGDPARLIAGPEADAQ-VIALVRQQLGLDQPLFWHYIT
GSIC_SALPA      MLNYVLKRLLGLIP--TXXXXXXXXXXXXXXXPGDPARLIAGPEADAQ-VIALVRQQLGLDQPLFWRYIT
OPPB_BACSU      MLKYIGRRLVYMIITLFVIVTVTFFLMQAAPGGP-----FSGEKKLPPEIEANLNAHYGLDKPLF-----
DPPB_BACPF      ------------IPVLIGMTIVTFSIIHLI--PGNPAQTILG-EQASPQAIADLEERLGLNEP-YW----
OPPB_SHIFL      MLKFILRRCLEAIPTLILITISFFMMRLAPGSP------FTGERTLPPEVMANIEAKYHLNDPIM-----
OPPB_ECOLI      MLKFILRRCLEAIPTLILITISFFMMRLAPGSP------FTGERTLPPEVMANIEAKYHLNDPIM-----
OPPB_ECOL6      MLKFILRRCLEAIPTLILITISFFMMRLAPGSP------FTGERTLPPEVMANIEAKYHLNDPIM-----
OPPB_ECO57      MLKFILRRCLEAIPTLILITISFFMMRLAPGSP------FTGERTLPPEVMANIEAKYHLNDPIM-----
Y3408_BRUSU     ----------------------------------------------------------------------
OPPB_SALTY      MLKFILRRCLEAIPTLILITISFFMMRLAPGSP------FTGERALPPEVLANIEAKYHLNDPIM-----
Y3860_BRUME     ----------------------------------------------------------------------
Y2551_BRUO2     ----------------------------------------------------------------------
GSIC_SHIFL      MLYYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_SHIF8      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_SHISS      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGLEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_SHIDS      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_SHIBS      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_ECOUT      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_ECOLI      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_ECOL5      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_ECOK1      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
GSIC_ERWCT      ----------------------------------------------------------------------
GSIC_ECOL6      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLY-----
GSIC_ECO57      MLNYVIKRLLGLIPTXXXXXXXXXXXXHML--PGDPARLIAGPEADAQ-VIELVRQQLGLDQPLFWHSNA
YEJB_ECOLI      ----------------------------------------------------------------------
YEJB_ECO57      ----------------------------------------------------------------------
Y1314_MYCBO     ----------------------------------------------------------------------
Y1283_MYCTU     ----------------------------------------------------------------------
OPPB_HAEIN      --------------------------------------------------------ERAYPPEVMANIEA
AMIC_STRR6      ----------------------------------------------------------------------
AMIC_STRPN      ----------------------------------------------------------------------
NIKB_ECOLI      MLRYVLRRFLLLIPMVLAASVIIFLMLLGTGDPA-LDYLRLSNLPPTPEMLASTRTMLGLDQPLY-----
OPPB_LACLS      ----------------------------------------------------------------------
OPPB_LACLA      ----------------------------------------------------------------------
SAPB_ECOLI      ----------------------------------------------------------------------
SAPB_ECO57      ----------------------------------------------------------------------
SAPB_SALTY      ----------------------------------------------------------------------
SAPB_SALTI      ----------------------------------------------------------------------
OPPB_MYCPN      ----------------------------------------------------------------------
OPPB_MYCGE      MFKYILKRLGLAV---VAMFIVMSIVFFLVNATGNVPLSATSARDIA--AVQAQLQEFGFNDPIIVR---
DDPB_ECOLI      ----------------------------------------------------------------------
OPPB2_STAAW     -------RLMQMIVVLFVISTLTFILMLSPGNPVDKI-LHLDVAQVSTEQINATKDKLGLNDSLWWHKSF
OPPB2_STAAS     -------RLMQMIVVLFVISTLTFILMLSPGNPVDKI-LHLDVAQVSTEQINATKDKLGLNDSLWWHKSF
OPPB2_STAAN     -------RLMQMIVVLFVISTLTFILMLSPGNPVDKI-LHLDVAQVSTEQINATKDKLGLNDSLWWHKSF
OPPB2_STAAM     -------RLMQMIVVLFVISTLTFILMLSPGNPVDKI-LHLDVAQVSTEQINATKDKLGLNDSLWWHKSF
OPPB2_STAAC     -------RLMQMIVVLFVISTLTFILMLSPGNPVDKI-LHLDVAQVSTEQINATKDKLGLNDSLWWHKSF
OPPB2_STAA8     -------RLMQMIVVLFVISTLTFILMLSPGNPVDKI-LHLDVAQVSTEQINATKDKLGLNDSLWWHKSF
OPPB2_STAA3     -------RLMQMIVVLFVISTLTFILMLSPGNPVDKI-LHLDVAQVSTEQINATKDKLGLNDSLWWHKSF
OPPB2_STAAB     -------RLMQMIVVLFVISTLTFILMLSPGNPVDKI-LHLDVAQVSMEQINATKDKLGLNDSLWWHKSF
OPPB2_STAAR     ----ILYRLIQMIVVLFVISTLAFILMLSPGNPVDKI-LHLDVAQVSTEQINATKDKLGLNDSLWWHKSF
APPC_BACSU      ----------------------------------------------------------------------
OPPC_LACLA      ----------------------------------------------------------------------
OPPC_LACLS      ----------------------------------------------------------------------
Y207_BRUME      ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
GSID_ERWCT      ----------------------------------------------------------------------
SAPB_HAEIN      ----------------------------------------------------------------------
OPPC_MYCPN      ----------------------------------------------------------------------
CMPB_SYNP6      ----------------------------------------------------------------------
CMPB_SYNE7      ----------------------------------------------------------------------
OPPC_BACSU      ----------------------------------------------------------------------
YEJE_ECOLI      ----------------------------------------------------------------------
GSID_SALTY      ----------------------------------------------------------------------
GSID_SALTI      ----------------------------------------------------------------------
GSID_SALPA      ----------------------------------------------------------------------
GSID_SALCH      ----------------------------------------------------------------------
DPPC_ECOLI      ----------------------------------------------------------------------
DPPC_ECOL6      ----------------------------------------------------------------------
DPPC_ECO57      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KGEDKFTETIFFTKSISLFLFQFGHADDGRDIGHDLRTRMWPSLAIAAPIFIGGLLVNTTFALLMVFFRG
Y209_BRUME      ------------VVQLGQWLWNLFHFDLGRSVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRD
Y1050_BRUA2     ------------VVQLGQWLWNLFHFDLGRSVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRD
Y1031_BRUAB     ------------VVQLGQWLWNLFHFDLGRSVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRD
Y1092_BRUSU     ------------VVQLGQWLWNLFHFDLGRSVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRD
DPPB_ECOLI      -------------QQYLHYIWGVMHGDLGISVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRG
DPPB_ECOL6      -------------QQYLHYIWGVMHGDLGISVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRG
DPPB_ECO57      -------------QQYLHYIWGVMHGDLGISVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRG
Y4TP_RHISN      L-RGNFGASVFTGVPVLQLLSQ----------------RLEPTISLSVLTMILSVTVGVSFGVLAAWRSG
APPB_BACSU      ----QYVQYLKWLGNMVQGDFGTSIVRKGTPVSELIMARLPNTLLLMLVSTILALMISIPFGVLSAKRPY
DPPB_BACSU      -------QYIFYLKSI--ITFDFGPSKKPSDSVNDMLERGFPSFELGMTAIVIAVISGLVLGVIAALRRN
DPPB_HAEIN      ------------------YFHYIGNVIQG-DFGASFRTQLFPATAELAFFLLGGIILGTIAAVKKISHTV
GSIC_SALTI      H----VLQGDFGTSMVSR-----------RPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRN
GSIC_SALCH      H----VLQGDFGTSMVSR-----------RPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRN
GSIC_SALTY      H----VLQGDFGTSMVSR-----------RPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRN
GSIC_SALPA      H----VLQGDFGTSMVSR-----------RPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRN
OPPB_BACSU      ------VQYVSYLKSVAMWDFGPSFKYKGQSVNDLISSGFPVSFTXXXXXXXXXXXXXXXXXXXXXXYHN
DPPB_BACPF      ------VQYGLYMKDLAT-----------GDLGTSLRTNIWPYLAIELTIFIFAIIIGVNAGIVSAWKQN
OPPB_SHIFL      --------TQYFS-----YLKQLAHGDFGPSFKYDLVASSFPSAKLGAAAFFLAVILGVSAGVIAALKQN
OPPB_ECOLI      --------TQYFS-----YLKQLAHGDFGPSFKYDLVASSFPSAKLGAAAFFLAVILGVSAGVIAALKQN
OPPB_ECOL6      --------TQYFS-----YLKQLAHGDFGPSFKYDLVASSFPSAKLGAAAFFLAVILGVSAGVIAALKQN
OPPB_ECO57      --------TQYFS-----YLKQLAHGDFGPSFKYDLVASSFPSAKLGAAAFFLAVILGVSAGVIAALKQN
Y3408_BRUSU     --------------------------------------------------------------------RN
OPPB_SALTY      --------TQYFS-----YLKQLAHGDFGPSFKYDLVAASFPSAKLGAAAFLLAVIIGVSAGVIAALKQN
Y3860_BRUME     ----------------------------------------------------------------------
Y2551_BRUO2     ----------------------------------------------------------------------
GSIC_SHIFL      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_SHIF8      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_SHISS      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_SHIDS      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_SHIBS      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_ECOUT      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_ECOLI      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_ECOL5      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_ECOK1      VQGD------FGLSMVSR-----------RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_ERWCT      -----------------------------RPVTQEIALRFMPTFWLTVCSMAWAVIFGMAIGIVSAVWRN
GSIC_ECOL6      ---HQFWHYISNAVQGDLGLSMVSR----RPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
GSIC_ECO57      VQGD------FGLSMVSR-----------RPVADEIARRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRN
YEJB_ECOLI      ----------------------------------------------------------------------
YEJB_ECO57      ----------------------------------------------------------------------
Y1314_MYCBO     ----------------------------------------------------------------------
Y1283_MYCTU     ----------------------------------------------------------------------
OPPB_HAEIN      KYH--LNEPLY--KQYFLYLENLSKGDFGPSFKYKDQS-VNDLIASAFPVSIKLGMVAFAFAVVLGVTAG
AMIC_STRR6      ----------------------------------------YPSMIVSSAITLIGLVLAYALAVAMARFKN
AMIC_STRPN      ----------------------------------------YPSMIVSSAITLIGLVLAYALAVAMARFKN
NIKB_ECOLI      -------------VQYGTWLWKALHLDFGRPVLDDMLNFLPATLELAGAALVLILLTSVPLGIWAARHRD
OPPB_LACLS      ----------------------------------------------------------------------
OPPB_LACLA      ----------------------------------------------------------------------
SAPB_ECOLI      ----------------------------------------------------------------------
SAPB_ECO57      ----------------------------------------------------------------------
SAPB_SALTY      ----------------------------------------------------------------------
SAPB_SALTI      ----------------------------------------------------------------------
OPPB_MYCPN      ----------------------------------------------------------------------
OPPB_MYCGE      ----------YFRYWAKLFSFQADYANPNQTIGEIVFARVPNTLYVVXXXXXXXXXXXXXXXMVSGLNRG
DDPB_ECOLI      ----------------------------------------------------------------------
OPPB2_STAAW     ESKEPVTQILFNYAPITL-LISFSTLVVSLCISIPLRFHKWTDKVIR--------VISTLSISLPAFFIG
OPPB2_STAAS     ESKEPVTQILFNYAPITL-LISFSTLVVSLCISIPLRFHKWTDKVIR--------VISTLSISLPAFFIG
OPPB2_STAAN     ESKEPVTQILFNYAPITL-LISFSTLVVSLCISIPLRFHKWTDKVIR--------VISTLSISLPAFFIG
OPPB2_STAAM     ESKEPVTQILFNYAPITL-LISFSTLVVSLCISIPLRFHKWTDKVIR--------VISTLSISLPAFFIG
OPPB2_STAAC     ESKEPVTQILFNYAPITL-LISFSTLVVSLCISIPLRFHKWTDKVIR--------VISTLSISLPAFFIG
OPPB2_STAA8     ESKEPVTQILFNYAPITL-LISFSTLVVSLCISIPLRFHKWTDKVIR--------VISTLSISLPAFFIG
OPPB2_STAA3     ESKEPVTQILFNYAPITL-LISFSTLVVSLCISIPLRFHKWTDKVIR--------VISTLSISLPAFFIG
OPPB2_STAAB     ESKEPVTQILFNYAPITL-LISF--------------STLVLSLCISIPLGIIAAVISTLSISLPAFFIG
OPPB2_STAAR     ESKEPVTQILFNYAPITL-LISF--------------STLVVSLCISIPLGIIAAVISTLSISLPAFFIG
APPC_BACSU      ----------------------------GRDIFSRILYGARVSLLVGFASVVGSILIGTVLGALAGYFRG
OPPC_LACLA      -----------------------GTDNGGRDIIMMLMISARNSFNIAFAVTLITLVVGNILGVITGYFGG
OPPC_LACLS      -----------------------GTDNGGRDIIMMLMISARNSFNIAFAVTLITLVVGNILGVITGYFGG
Y207_BRUME      ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
GSID_ERWCT      -------------------------------LGRDIFSRMGTRISLAAGIFLVGMMIGTTLGLLAGYYEG
SAPB_HAEIN      ----------------------------------------------------------------------
OPPC_MYCPN      -------------------------------LGVDIWTLLWASMAKSLWIAIVVALVSMVFGTIYGAIAG
CMPB_SYNP6      ----------------------------------------------------------------------
CMPB_SYNE7      ----------------------------------------------------------------------
OPPC_BACSU      ----------------------------------------------------------------------
YEJE_ECOLI      ----------------------------------------------------------------------
GSID_SALTY      ----------------------FGVDSLGRDIFS--RVLVGAQISLAAGVFAVGAIIGTVLGLLAGYYEG
GSID_SALTI      ----------------------FGVDSLGRDIFS--RVLVGAQISLAAGVFAVGAIIGTVLGLLAGYYEG
GSID_SALPA      ----------------------FGVDSLGRDIFS--RVLVGAQISLAAGVFAVGAIIGTVLGLLAGYYEG
GSID_SALCH      ----------------------FGVDSLGRDIFS--RVLVGAQISLAAGVFAVGAIIGTVLGLLAGYYEG
DPPC_ECOLI      ----------------------------------------------------------------------
DPPC_ECOL6      ----------------------------------------------------------------------
DPPC_ECO57      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TYLDLGGVVLCVALMSISTLFYVIMGQYLVGKLMHLVPVSGYVGGLDAFKFXXXXXXXXXXXXXXXXARW
Y209_BRUME      SWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSLRSLILPASILALFQIGYLARM
Y1050_BRUA2     SWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSLRSLILPASILALFQIGYLARM
Y1031_BRUAB     SWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSLRSLILPASILALFQIGYLARM
Y1092_BRUSU     SWFDMGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSLRSLILPASILALFQIGYLARM
DPPB_ECOLI      SIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMDAVAHMILPAIVLGTIPLAVIVRM
DPPB_ECOL6      SIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMDAVAHMILPAIVLGTIPLAVIVRM
DPPB_ECO57      SIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMDAVAHMILPAIVLGTIPLAVIVRM
Y4TP_RHISN      GFVDRALATFSAIGYSVPVFVIGYILIYFFAIQTRWLPVQGYTGVAPWFLHLILPTVTLSVPYIAFIARI
APPB_BACSU      SKIDYGITFTSFIGLAIPNFWFGLILIMVLSVNLGWFPTGGVFNIFDRIHHLILPAFVLATADMAGLTRY
DPPB_BACSU      GFLDYAAMSLAVLGISIPNLATLLIQQFAVN--LKLFPAATWTSPIHMV----LPTAALAVGPMAIIARL
DPPB_HAEIN      TAASLTGYSMPIFWWGLILILYVLDNEFWIDTPTGFMLIDSWLSGVNAVKSLILPAIVLGTVPLAIITRM
GSIC_SALTI      RWPDRVGMTLAVTGISFPAFALGMLLMQIFSVDLGWLPTVG----ADSWQHYILPSLTLGAAVASVMARF
GSIC_SALCH      RWPDRVGMTLAVTGISFPAFALGMLLMQIFSVDLGWLPTVG----ADSWQHYILPSLTLGAAVASVMARF
GSIC_SALTY      RWPDRLGMTLAVTGISFPAFALGMLLMQIFSVDLGWLPTVG----ADSWQHYILPSLTLGAAVASVMARF
GSIC_SALPA      RWPDRLGMTLAVTGISFPAFALGMLLMQIFSVDLGWLPTVG----ADSWQHYILPSLTLGAAVASVMARF
OPPB_BACSU      KWQDYTVAILTIFGISVPSFIMAAVLQYVFSMKLGLFPVAGW----DSWAYTFLPSIALASMPMAFIARL
DPPB_BACPF      SWFDYLSMFIALVGVSMPIFWLALMEQWIFAQELGWLPAFGYVGQFDSIKHLILPGIALGTIPMAIIARM
OPPB_SHIFL      TKWDYTVMGLAMTGVVIPSFVVAPLLVMIFAIILHWLPGGGWNGG--ALKFMILPMVALSLAYIASIARI
OPPB_ECOLI      TKWDYTVMGLAMTGVVIPSFVVAPLLVMIFAIILHWLPGGGWNGG--ALKFMILPMVALSLAYIASIARI
OPPB_ECOL6      TKWDYTVMGLAMTGVVIPSFVVAPLLVMIFAIILHWLPGGGWNGG--ALKFMILPMVALSLAYIASIARI
OPPB_ECO57      TKWDYTVMGLAMTGVVIPSFVVAPLLVMIFAIILHWLPGGGWNGG--ALKFMILPMVALSLAYIASIARI
Y3408_BRUSU     SFLDYSFSVLALLGISSPAFLTALLGLYVFSVRLKWAPSGGMLTPATDFSIPDXXXXXXXXXXXXSIGRY
OPPB_SALTY      TYTVMGFAMTGVVIPSFVVAPLLVM---VFAITLQWLPGGGWNGG--ALKFMILPMVALSLAYIASIARI
Y3860_BRUME     --------------------------------------------------------------------RY
Y2551_BRUO2     --------------------------------------------------------------------RY
GSIC_SHIFL      RWPDRLSMTIAVSGISFPAF---ALGMFLIQVFSVELGWLPTVGA-DSWQHYILPSLTLGAAVAAVMARF
GSIC_SHIF8      RWPDRLSMTIAVSGISFPAF---ALGMFLIQVFSVELGWLPTVGA-DSWQHYILPSLTLGAAVAAVMARF
GSIC_SHISS      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILPSLTLGAAVAAVMARF
GSIC_SHIDS      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILPSLTLGAAVAAVMARF
GSIC_SHIBS      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILSSLTLGAAVAAVMARF
GSIC_ECOUT      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILPSLTLGAAVAAVMARF
GSIC_ECOLI      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILPSLTLGAAVAAVMARF
GSIC_ECOL5      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILPSLTLGAAVAAVMARF
GSIC_ECOK1      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILPSLTLGAAVAAVMARF
GSIC_ERWCT      GWPDRIGMTLAVSGLSFPAFALGMLLMQIFSVELGWLPTVG----ADTWLHYILPSLTLGAAVAAVMARF
GSIC_ECOL6      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILPSLTLGAAVAAVMARF
GSIC_ECO57      RWPDRLSMTIAVSGISFPAFALMLLIQVFSVELGWLPTV-----GADSWQHYILPSLTLGAAVAAVMARF
YEJB_ECOLI      ----------------------------------------------------------------------
YEJB_ECO57      ----------------------------------------------------------------------
Y1314_MYCBO     -------------------------------------------------------------------SRY
Y1283_MYCTU     -------------------------------------------------------------------SRY
OPPB_HAEIN      TLAALNQNSRWDYILMSFSMLGVIMPSFVFAPVLVLIPAGGWNGGTAMYMILPVASLTIAYVAGI--ARI
AMIC_STRR6      TWIDTGALTFLLALPTIALVYIV----RLIGSSIAL-PDSFPILGAGDWRSYVLPAVILGLLGAPGTAIW
AMIC_STRPN      TWIDTGALTFLLALPTIALVYIV----RLIGSSIAL-PDSFPILGAGDWRSYVLPAVILGLLGAPGTAIW
NIKB_ECOLI      RLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSVYLQWLPAMGYGG----WQHIILPAVSIAFMSLAINARL
OPPB_LACLS      ---------------------------------------------------------------------Y
OPPB_LACLA      ---------------------------------------------------------------------Y
SAPB_ECOLI      --------------------------------------------------------------------RL
SAPB_ECO57      --------------------------------------------------------------------RL
SAPB_SALTY      --------------------------------------------------------------------RL
SAPB_SALTI      --------------------------------------------------------------------RL
OPPB_MYCPN      ----------------------------------------------------------------------
OPPB_MYCGE      KFLDAAINVLVVLFVSIPS--FVVXXXXXXXXXXXXXPPR-FINFDDAFRFLLASIIPILSLVFYSSAAF
DDPB_ECOLI      -------------------------------------------------------------------ARQ
OPPB2_STAAW     -------IILLFIVTNLMNIDSVILSQFILPVITLSLGMCAYI------------------------IRL
OPPB2_STAAS     -------IILLFIVTNLMNIDSVILSQFILPVITLSLGMCAYI------------------------IRL
OPPB2_STAAN     -------IILLFIVTNLMNIDSVILSQFILPVITLSLGMCAYI------------------------IRL
OPPB2_STAAM     -------IILLFIVTNLMNIDSVILSQFILPVITLSLGMCAYI------------------------IRL
OPPB2_STAAC     -------IILLFIVTNLMNIDSVILSQFILPVITLSLGMCAYI------------------------IRL
OPPB2_STAA8     -------IILLFIVTNLMNIDSVILSQFILPVITLSLGMCAYI------------------------IRL
OPPB2_STAA3     -------IILLFIVTNLMNIDSVILSQFILPVITLSLGMCAYI------------------------IRL
OPPB2_STAAB     -------IILLFIVTNLMNIDSVILSQFILPVITLSLGMCAYI------------------------IRL
OPPB2_STAAR     -------IILLFIVTNLMNIDSVILSQFILPVLTLSLGMCAYI------------------------IRL
APPC_BACSU      I---VDAVIMRVVVLSIPDIFLLITLVTIVDKLILIFCLTGWT----------------------TTARL
OPPC_LACLA      RFMRFTDFVMILPSMMIIIVFVTIIPRFNSWSLIGIISIFSWIG----------------------TTRL
OPPC_LACLS      RFMRFTDFVMILPSMMIIIVFVTIIPRFNSWSLIGIISIFSWIG----------------------TTRL
Y207_BRUME      ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
GSID_ERWCT      -WADRIIMRICDVLFAFPGILLAIAVVAIMGSGMANVVVAVAIFSIPAF------------------ARL
SAPB_HAEIN      ----------------------------------------------------------------------
OPPC_MYCPN      SFVGRAADNIMSRIIEIIDLVPSILWIIVLGATFRFGGVKQFDDSVVIFTLIFVFWTWP--------AAT
CMPB_SYNP6      ----------------------------------------------------------------------
CMPB_SYNE7      ----------------------------------------------------------------------
OPPC_BACSU      -------------------------------------------------------------------ARI
YEJE_ECOLI      ----------------------------------------------------------------------
GSID_SALTY      WW-DRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAF------------------ARL
GSID_SALTI      WW-DRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAF------------------ARL
GSID_SALPA      WW-DRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAF------------------ARL
GSID_SALCH      WW-DRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAF------------------ARL
DPPC_ECOLI      --------------------------------------------------------------------RL
DPPC_ECOL6      --------------------------------------------------------------------RL
DPPC_ECO57      --------------------------------------------------------------------RL


                         .         .         .         +         .         .         .:280
query           YRTLFLEEVGKDYVRTARAKGLSEFKVLFKHILKNALIPILTGAVVILPTLFLGSLILESFFGIPGLGSY
Y209_BRUME      TRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRL
Y1050_BRUA2     TRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRL
Y1031_BRUAB     TRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRL
Y1092_BRUSU     TRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRL
DPPB_ECOLI      TRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRW
DPPB_ECOL6      TRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRW
DPPB_ECO57      TRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRW
Y4TP_RHISN      TRGSMLEVLSEDYMRTAAAKGASPFAMLFHHALKNAGVPILTVIGISFAYMIGGVVLTETVFNVPGIGRL
APPB_BACSU      TRSNMLDVLNQDYIRTARAKGFKENRVLFKHGLRNALLPVITIFGLMIPSFIGGSVVVEQIFTWPGLGKL
DPPB_BACSU      TRSSMVEVLTQDYIRTAKAKGLSPFKIIVKHALRNALMPVITVLGTLVASILTGSFVIEKIFAIPGMGKY
DPPB_HAEIN      TRSAMLEVLGEDYIRTAKAKGLSYTRIVIVHALRNALIPVVTVVGLIVAQLLSGAVLTETIFSWPGIGKW
GSIC_SALTI      TRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_SALCH      TRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_SALTY      TRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_SALPA      TRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
OPPB_BACSU      SRSSMIEVLNSDYIRTAKAKGLSRPAVTVRHAIRNALLPVVTYMGPMAAQVLTGSFIIETIFGIPGLGAH
DPPB_BACPF      TRSSMLEVLRSDYIRTVNAKGSGQGVVIYKHALKNALIPVLTVVGLQTGNLLGGAILTETIFSWPGIGRY
OPPB_SHIFL      TRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQL
OPPB_ECOLI      TRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQL
OPPB_ECOL6      TRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQL
OPPB_ECO57      TRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQL
Y3408_BRUSU     MRSSMLETLNQDYVRTARAKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLL
OPPB_SALTY      TRGSMIEVLHSNFIRTARAKGLPMRRIIFRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQL
Y3860_BRUME     MRSSMLETLNQDYVRTARAKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLL
Y2551_BRUO2     MRSSMLETLNQDYVRTARAKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLL
GSIC_SHIFL      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_SHIF8      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_SHISS      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_SHIDS      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_SHIBS      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_ECOUT      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_ECOLI      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_ECOL5      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_ECOK1      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_ERWCT      TRASFVDVLQEDYMRTARAKGVRESLVVLKHGLRNALIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_ECOL6      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
GSIC_ECO57      TRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRL
YEJB_ECOLI      ----FLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGPATFISMFFTGSLLIEVMFSLNGLGLL
YEJB_ECO57      ----FLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGPATFISMFFTGSLLIEVMFSLNGLGLL
Y1314_MYCBO     QRNAMLDVLGQDFIRTARAKGLTRRRALLKHGLRTALIPMATLFAYGVAGLVTGAVFVEKIFGWHGMGEW
Y1283_MYCTU     QRNAMLDVLGQDFIRTARAKGLTRRRALLKHGLRTALIPMATLFAYGVAGLVTGAVFVEKIFGWHGMGEW
OPPB_HAEIN      MRGSMIEVLHSNFIRTAKAKGLSMSRIILKHALRPALLPVITYLGPAFVGIITGSMVIESVFGLPGMGLL
AMIC_STRR6      IRRYMIDLQSQDFVRFARAKGLSEKEISNKHIFKNAMVPLVSXXXXXXXXXXXXXTLTETVFAFPGMGKM
AMIC_STRPN      IRRYMIDLQSQDFVRFARAKGLSEKEISNKHIFKNAMVPLVSXXXXXXXXXXXXXTLTETVFAFPGMGKM
NIKB_ECOLI      LRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVGMHIGELIGGTMIIENIFAWPGVGRY
OPPB_LACLS      FRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNASLPIASNFGFVITGLLGGAIFAETIFGYPGLGQL
OPPB_LACLA      FRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNASLPIASNFGFVITGLLGGAIFAETIFGYPGLGQL
SAPB_ECOLI      MRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPPVIPRLGLQFSTMLTLAMITEMVFSWPGLGRW
SAPB_ECO57      MRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPPVIPRLGLQFSTMLTLAMITEMVFSWPGLGRW
SAPB_SALTY      MRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPPVIPRLGLQFSTMLTLAMITEMVFSWPGLGRW
SAPB_SALTI      MRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPPVIPRLGLQFSTMLTLAMITEMVFSWPGLGRW
OPPB_MYCPN      -RNEVVEVMNQDYIKTARSKGLSTFAVALYHIFRNSIIPSVPLFVXXXXXXXXXXXXXXXLFGVQGVSRI
OPPB_MYCGE      IRNEVVEVMNQDYIKTAKSKGLGMFAVARYHIFRNSIIPSIPLFVXXXXXXXXXXXXXXXLFGVQGVSRI
DDPB_ECOLI      IRSAMLEQLSEDYIRTARASGLPGWYIVLCYALPNALIPSITXXXXXXXXXXXXXXXTETVFAWPGMGAW
OPPB2_STAAW     VRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
OPPB2_STAAS     VRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
OPPB2_STAAN     VRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
OPPB2_STAAM     VRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
OPPB2_STAAC     VRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
OPPB2_STAA8     VRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
OPPB2_STAA3     VRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
OPPB2_STAAB     VRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
OPPB2_STAAR     VRSNLLILLKSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYL
APPC_BACSU      VRGEFLSLRSREYVLAAKTIGTKTHKIIFSHILPNALGPIIVSA-----TLKVGSVILAESFGIPPIASW
OPPC_LACLA      IRARTMTEVNRDYVRASKTSGTSDFKIMFREIWPNLSTLVIAEATLV----FAGNIGLETGLSFLGFG--
OPPC_LACLS      IRARTMTEVNRDYVQASKTSGTSDFKIMFREIWPNLSTLVIAEATLV----FAGNIGLETGLSFLGFG--
Y207_BRUME      -----------DYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATL-SFLGIPPHASW
Y1051_BRUA2     -----------DYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATL-SFLGIPPHASW
Y1032_BRUAB     -----------DYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATL-SFLGIPPHASW
Y1093_BRUSU     -----------DYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATL-SFLGIPPHASW
GSID_ERWCT      VRTLVLKQL--TYIESARSMGANDWTILFRHIL-----PGSVSSIVVFFSMRIGSIITAASLSFLGLGA-
SAPB_HAEIN      --------LNQNFSKVATTRGWSKWKILHQYVFRNTF-PLLVPQVPRVFTLVLTQMLVETALGWPGIGRW
OPPC_MYCPN      TRIYILKNKDTEYIQAARTLGAKQIRIIFVHML-----PVVTGRLAVVFVSLIPAVIGYEFLGLKGLGAL
CMPB_SYNP6      -----VRQIPQDYNNVARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMGIVGIGFF
CMPB_SYNE7      -----VRQIPQDYNNVARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMGIVGIGFF
OPPC_BACSU      VRGQVLQLKNQEYVLASQTLGAKTSRLLFKHIVPNAMGSILVTMTLTVPT----AIFTEAFLSYLGLG--
YEJE_ECOLI      -RAEFLRTRNFDYIRAAQALGVSDRSIILRHMLPNAMVATLTFLPFIL----------------------
GSID_SALTY      VRTLVLKQ--QTFIESARSIGASDTTILFSHIL-----PGTVSSIVVFFTMRIGTSIISSFLGL------
GSID_SALTI      VRTLVLKQ--QTFIESARSIGASDTTILFSHIL-----PGTVSSIVVFFTMRIGTSIISSFLGL------
GSID_SALPA      VRTLVLKQ--QTFIESARSIGASDTTILFSHIL-----PGTVSSIVVFFTMRIGTSIISSFLGL------
GSID_SALCH      VRTLVLKQ--QTFIESARSIGASDTTILFSHIL-----PGTVSSIVVFFTMRIGTSIISSFLGL------
DPPC_ECOLI      TRAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLILDMAALGFLGMGAQPPTPEWGTM
DPPC_ECOL6      TRAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLILDMAALGFLGMGAQPPTPEWGTM
DPPC_ECO57      TRAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLILDMAALGFLGMGAQPPTPEWGTM


                         .         *         .         .         .         .         +:350
query           TIDAIQAQDFAIVRAMVFLGSVLYILGLILTDISYTLVDPRVRLN
Y209_BRUME      LVQAILARDLPVVQTMLFLG-FLFVAINVLVDILYTIADPRVR--
Y1050_BRUA2     LVQAILARDLPVVQTMLFLG-FLFVAINVLVDILYTIADPRVR--
Y1031_BRUAB     LVQAILARDLPVVQTMLFLG-FLFVAINVLVDILYTIADPRVR--
Y1092_BRUSU     LVQAILARDLPVVQTMLFLG-FLFVAINVLVDILYTIADPRV---
DPPB_ECOLI      LIDALQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIR--
DPPB_ECOL6      LIDALQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIR--
DPPB_ECO57      LIDALQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIR--
Y4TP_RHISN      VVDAIKNRDYPIIQTVLVLISGLYVLINLLVDLAYTLIDPRIR--
APPB_BACSU      FVDSAFQRDYPVIMAMTVISAVLVVVGNLIADILYAIVDPRI---
DPPB_BACSU      FVESINQRDYPVIMGTTVFYSVILIIMLFLVDLAYGLLDPRIKLH
DPPB_HAEIN      IIDAIQARDYPVLQGSVLIIATIIIVVNLTVDLLYGVVNPRIR--
GSIC_SALTI      LVDSVDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAINPAIR--
GSIC_SALCH      LVDSVDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAINPAIR--
GSIC_SALTY      LVDSVDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAINPAIR--
GSIC_SALPA      LVDSVDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAINPAIR--
OPPB_BACSU      FVNSITNRDYTVIMGVTXXXXXXXXXXXXXXXXXYGIIDPRIKLS
DPPB_BACPF      IFEAINYRDYPVIQSGILVVATIFVLINLFVDLLYSYIDPRIK--
OPPB_SHIFL      FVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
OPPB_ECOLI      FVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
OPPB_ECOL6      FVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
OPPB_ECO57      FVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
Y3408_BRUSU     LINAVETRDYPVIMGATLVIGACVIIVNILTDLAYAVIDPRIKV-
OPPB_SALTY      FVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
Y3860_BRUME     LINAVETRDYPVIMGATLVIGACVIIVNILTDLAYAVIDPRIKV-
Y2551_BRUO2     LINAVETRDYPVIMGATLVIGACVIIVNILTDLAYAVIDPRIKV-
GSIC_SHIFL      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHIF8      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHISS      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHIDS      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHIBS      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECOUT      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECOLI      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECOL5      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECOK1      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ERWCT      LVDSVEMRDYPVIQAEVLLFSLEFILINLLVDMLYAAINPAIR--
GSIC_ECOL6      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECO57      LVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
YEJB_ECOLI      GYEATVSRDYPVMFGTLYIFTLIGLLLNIVSDISYTLVDPRI---
YEJB_ECO57      GYEATVSRDYPVMFGTLYIFTLIGLLLNIVSDISYTLVDPRI---
Y1314_MYCBO     MVRGISTQDTNIVAAIVFSGAVVLLAGL-LSDVIYAALDPRVRVS
Y1283_MYCTU     MVRGISTQDTNIVAAIVFSGAVVLLAGL-LSDVIYAALDPRVRVS
OPPB_HAEIN      FVNGALNRDYSLVLSLTILVGTLTILFNAIVDILYAIIDPKIR--
AMIC_STRR6      LIDSVKASNNSMVVGLVFIFTCISIFSRLLGDIWMTIIDPRIKL-
AMIC_STRPN      LIDSVKASNNSMVVGLVFIFTCISIFSRLLGDIWMTIIDPRIKL-
NIKB_ECOLI      AVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNAALDPRIR--
OPPB_LACLS      FITSISGRDYSMITAXXXXXXXXXXXXXXXSDIIMAMVDPRIRI-
OPPB_LACLA      FITSISGRDYSMITAXXXXXXXXXXXXXXXSDIIMAMVDPRIRI-
SAPB_ECOLI      LINAIRQQDYAAISAGVMVCGSLVIIVNVISDILGAMANP-----
SAPB_ECO57      LINAIRQQDYAAISAGVMVCGSLVIIVNVISDILGAMANP-----
SAPB_SALTY      LIHAIRQQDYAAISAGVMVIGSLVIVVNVISDILGAMANP-----
SAPB_SALTI      LIHAIRQQDYAAISAGVMVIGSLVIVVNVISDILGAMANP-----
OPPB_MYCPN      LIDSVQSNETNLVMFNIMFIQGIPLLASVFIELIYVLVDPRIRI-
OPPB_MYCGE      LIDSVQVNETNMVMFNILFIQGIPLLASVFIEFIYVLVDPRIRI-
DDPB_ECOLI      VVTSIQALDFPAVMGFAVVVSFAXXXXXXXXXXXXXWIDPRI---
OPPB2_STAAW     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
OPPB2_STAAS     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
OPPB2_STAAN     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
OPPB2_STAAM     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
OPPB2_STAAC     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
OPPB2_STAA8     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
OPPB2_STAA3     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
OPPB2_STAAB     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
OPPB2_STAAR     LMDSIKSRDYPVIQGCVFIGFFVVIINTI-ADLLTLLLDPKQRL-
APPC_BACSU      GNMLQDAQNFTVM--------------------------------
OPPC_LACLA      ---------------------------------------------
OPPC_LACLS      ---------------------------------------------
Y207_BRUME      GSIVAQGRDYSVDAIMLFPGIAITISALLIGDGLRDVLDPRLKM-
Y1051_BRUA2     GSIVAQGRDYSVDAIMLFPGIAITISALLIGDGLRDVLDPRLKM-
Y1032_BRUAB     GSIVAQGRDYSVDAIMLFPGIAITISALLIGDGLRDVLDPRLKM-
Y1093_BRUSU     GSIVAQGRDYSVDAIMLFPGIAITISALLIGDGLRDVLDPRLKV-
GSID_ERWCT      ---------------------------------------------
SAPB_HAEIN      LINAVNEQDY-----------------------------------
OPPC_MYCPN      LNQVTSSGNIALITSSIVSFAILTVSTRVFANALNDAIDPRV---
CMPB_SYNP6      IWDAYQ-QNYVIILAVIYIGAVGLLL-------------------
CMPB_SYNE7      IWDAYQ-QNYVIILAVIYIGAVGLLL-------------------
OPPC_BACSU      ---------------------------------------------
YEJE_ECOLI      ---------------------------------------------
GSID_SALTY      ---------------------------------------------
GSID_SALTI      ---------------------------------------------
GSID_SALPA      ---------------------------------------------
GSID_SALCH      ---------------------------------------------
DPPC_ECOLI      LSDVLQFAQSA-WWVVTFPG-----LAILLTVLAFNLMGDGLR--
DPPC_ECOL6      LSDVLQFAQSA-WWVVTFPG-----LAILLTVLAFNLMGDGLR--
DPPC_ECO57      LSDVLQFAQSA-WWVVTFPG-----LAILLTVLAFNLMGDGLR--