[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57498.1

[Show Plain Result]


## Summary of Sequence Search
    1::193
   31::152     7e-10  32%  174 aa  RESA_GEOTN RecName: Full=Thiol-disulfide oxidoreductase resA;
   31::149     6e-09  31%  174 aa  RESA_GEOKA RecName: Full=Thiol-disulfide oxidoreductase resA;
   30::152     5e-08  26%  173 aa  RESA_BACHK RecName: Full=Thiol-disulfide oxidoreductase resA;
   35::152     1e-07  26%  173 aa  RESA_BACC1 RecName: Full=Thiol-disulfide oxidoreductase resA;
   41::167     1e-07  27%  192 aa  RESA_OCEIH RecName: Full=Thiol-disulfide oxidoreductase resA;
   35::152     2e-07  27%  173 aa  RESA_BACCR RecName: Full=Thiol-disulfide oxidoreductase resA;
   35::152     3e-07  27%  173 aa  RESA_BACAN RecName: Full=Thiol-disulfide oxidoreductase resA;
   35::152     3e-07  27%  173 aa  RESA_BACAH RecName: Full=Thiol-disulfide oxidoreductase resA;
    4::103     2e-06  32%  155 aa  BCP_HAEIN RecName: Full=Putative peroxiredoxin bcp;       
   39::147     4e-06  27%  179 aa  RESA_BACSU RecName: Full=Thiol-disulfide oxidoreductase resA;
   39::153     4e-06  26%  176 aa  RESA_BACHD RecName: Full=Thiol-disulfide oxidoreductase resA;
   35::152     4e-06  25%  173 aa  RESA_BACCZ RecName: Full=Thiol-disulfide oxidoreductase resA;
    1::173     1e-05  28%  201 aa  TDXH2_PICTO RecName: Full=Probable peroxiredoxin 2;       
   32::152     2e-05  30%  177 aa  RESA_BACLD RecName: Full=Thiol-disulfide oxidoreductase resA;
   72::204     6e-05  30%  216 aa  PRXQ_ARATH RecName: Full=Peroxiredoxin Q, chloroplastic;       
   61::98      8e-05  47%  181 aa  TRBB_ECOLI RecName: Full=Protein trbB;Flags: Precursor;
    4::89      1e-04  27%  229 aa  REHY_MAIZE RecName: Full=1-Cys peroxiredoxin PER1;       
   73::169     2e-04  29%  217 aa  PRXQ_WHEAT RecName: Full=Peroxiredoxin Q, chloroplastic;       
   55::135     2e-04  29%  209 aa  GPX8B_XENLA RecName: Full=Probable glutathione peroxidase 8-B;     
   73::217     2e-04  28%  217 aa  PRXQ_GENTR RecName: Full=Peroxiredoxin Q, chloroplastic;       
   73::146     4e-04  27%  217 aa  PRXQ_ORYSJ RecName: Full=Peroxiredoxin Q, chloroplastic;       
   73::146     4e-04  27%  217 aa  PRXQ_ORYSI RecName: Full=Putative peroxiredoxin Q, chloroplastic;  
   41::173     4e-04  29%  186 aa  PERQ_SEDLI RecName: Full=Peroxiredoxin Q, chloroplastic;       
    4::143     4e-04  30%  156 aa  BCP_SHIFL RecName: Full=Putative peroxiredoxin bcp;       
    4::143     4e-04  30%  156 aa  BCP_ECOLI RecName: Full=Putative peroxiredoxin bcp;       
    4::143     4e-04  30%  156 aa  BCP_ECOL6 RecName: Full=Putative peroxiredoxin bcp;       
    4::143     4e-04  30%  156 aa  BCP_ECO57 RecName: Full=Putative peroxiredoxin bcp;       
   70::201     5e-04  27%  213 aa  PRXQ_POPJC RecName: Full=Peroxiredoxin Q, chloroplastic;       
   70::202     5e-04  28%  214 aa  PERQ_SUASA RecName: Full=Peroxiredoxin Q, chloroplastic;       
    1::193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALSQFAREYQPKG
RESA_GEOTN      ---TEKTAVAVGSTAPDF-VLSDLEGREHRLTDYRGKG-VFLNFWGTWCKPCEREMPYMNELYPIYQKQG
RESA_GEOKA      ---TEKTAVAVGSTAPDFVLTD-LKGHEHRLSDYRGKG-VFLNFWGTWCKPCEREMPYMNELYPIYKKQG
RESA_BACHK      ---TKEEKMEIGKEAPNFVVTD-LEGKKIELKDFKGKG-VFLNFWGTWCKPCEKEMPYMNELYPKYKEKG
RESA_BACC1      --------MEIGKEAPNFVVTD-LEGKKIELKDFKGKG-VFLNFWGTWCKPCEKEMPYMNELYPKYKEKG
RESA_OCEIH      --KDDNKIYRVGDAAPDFQLKEEVDQSTVQLSDLEGKG-VMLNFWATWCDPCKAEMPYMQDLYAEYKEKG
RESA_BACCR      --------MQIGKEAPNF-IVTDLEGKKIELKDLKGKG-VFLNFWGTWCKPCEKEMPYMNELYPKYKEKG
RESA_BACAN      --------MQIGKEAPNFVVTD-LEGKKIELKDLKGKG-VFLNFWGTWCKPCEKEMPYMNELYPKYKEKG
RESA_BACAH      --------MQIGKEAPNFVVTD-LEGKKIELKDLKGKG-VFLNFWGTWCKPCEKEMPYMNELYPKYKEKG
BCP_HAEIN       --------LSVGNQAPAFTLLNQQE-KFVSLSDFRGKKVLIYFYPKALTPGCTTQACGLRDSKSELDVLG
RESA_BACSU      -----------GSDAPNF-VLEDTNGKRIELSDLKGK-GVFLNFWGTWCEPCKKEFPYMANQYKHFKSQG
RESA_BACHD      -----------GEQAVNF-VLEDLEGESIELRELEGKG-VFLNFWGTYCPPCEREMPHMEKLYGEYKEQG
RESA_BACCZ      --------MQIGKEAPNFVVTD-LEGKKIELKDLKGKG-VFLNFWGTWCKPCEKEMPYMNELYPKYKEKG
TDXH2_PICTO     ------MPVYLGKRAPDFTA--NTTRGVISLSDYKNKWVLLFSHPADFTPICTTEFIEFSRRYNDFKELN
RESA_BACLD      ---TESVAV--GEKAPIFSL-EDVDGNRLKLDELKGKG-VFLNFWGTWCEPCKREFPYMANQYKVFKDKG
PRXQ_ARATH      -----------GQAAPDFTLKDQ-NGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAG
TRBB_ECOLI      -----------------------SNGRQVNLADWK-----VVLFMQGHCPYCHQFDPVLKQLAQQY----
REHY_MAIZE      --------LTIGDTVPNLEL--DSTHGKIRIHDYVGDGYAIIFHPADFTPVCTTEMAAMAGYAKEFEKRG
PRXQ_WHEAT      -----------GSVPPNFTLKDQ-DGKTVSLSKFKGKPVVLYFYPADETPGCTKQACAFRDSYEKYKKAG
GPX8B_XENLA     -----------------------AKGRTVALSKYRGKASL-VVNVASGCPHTEANYRSLQELHREFGPSH
PRXQ_GENTR      -----------GSVPPQFTLKDQ-DGKNVSLTEFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAG
PRXQ_ORYSJ      -----------GSAAPNFTLRDQ-DGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAG
PRXQ_ORYSI      -----------GSAAPNFTLRDQ-DGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAG
PERQ_SEDLI      -----------GSTPPPFTLKDQE-GRPVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAG
BCP_SHIFL       --------LKAGDIAPKFSLPDQ-DGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAG
BCP_ECOLI       --------LKAGDIAPKFSLPDQ-DGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAG
BCP_ECOL6       --------LKAGDIAPKFSLPDQ-DGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAG
BCP_ECO57       --------LKAGDIAPKFSLPDQ-DGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAG
PRXQ_POPJC      -------------QAPPSFTLKDQDGKTLSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAG
PERQ_SUASA      -----------GSMPPAFTLKDQ-DGKNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAG


                         .         .         *         .         .         .         .:140
query           LAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRGQF
RESA_GEOTN      VEILAVNVGE----PKLNVEKFAERF---GLTFPIVIDRQDQVLNAYGVGPLPTTFLIDKNGKV------
RESA_GEOKA      VEILAVNVGE----PKLSVEKFAERF---GLTFPIVIDRQDQVLNAYNVGPLPTTFLIDKN---------
RESA_BACHK      VEIIALDADET----DIAVKNFVKQYDLK---FPVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVI-----
RESA_BACC1      VEIIALDADET----DIAVKNFVKQYDLK---FPVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVI-----
RESA_OCEIH      VEIVAVSLDGTELVVD-------QFIDEYDLTFPVPHDKNGEVKDLYKIGPMPTTYFIKPNGEI------
RESA_BACCR      VEIIALDA-------DETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVV-----
RESA_BACAN      VEIIALDA-------DETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVV-----
RESA_BACAH      VEIIALDA-------DETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVV-----
BCP_HAEIN       LVVLGIS--------PDAPKKLAQFIEKKELNFTLLSDPDHQVAEQF-----------------------
RESA_BACSU      VEIVAVNVG-------ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLIN-----------
RESA_BACHD      VEIIAVNANE--------PELTVQRVDRYGLSFPIVIDKGLNVIDAYGIRPLPTTILINEHGEIV-----
RESA_BACCZ      VEIIALDADETEI-------AVKNFVKQYDLKFPVAIDKGTKIIGTYSVGPLPTSFLIDKDGKVV-----
TDXH2_PICTO     VELIGLSVDSLQSHIEDIYEKFGIEIQ-----FPVIADINKEIAREYN--------LIDENAGNTVRGVF
RESA_BACLD      VEIVAVNVGEVRNFMKD-----------HGVNFPVVLDKDRQVLNAYDVTPLPTTFLINPDGEIV-----
PRXQ_ARATH      AEVIGISGDD----------SASHKAFASKYKLPYLSDEGNKVRKLFGALPGRQTYVLDKNGQLIYNNQF
TRBB_ECOLI      ----------------------------------------------------------------------
REHY_MAIZE      VKLLGISCDDVESH-----RQWTKDVEAYG----------------------------------------
PRXQ_WHEAT      AEVIGISGDDAASH----------KAFAKKYRLPFLSDEGNKVRKEW-----------------------
GPX8B_XENLA     FTVLAFPCNQFESEPGTNKEIEAMAKRNYGVTFP------------------------------------
PRXQ_GENTR      AEVIGISGDDPSSH----------KAFAKKYRLPYLSDEGNKIRREWGVPADRQTYVLDKNGQLIYNNQF
PRXQ_ORYSJ      AEVIGISGDDAASHKE------------------------------------------------------
PRXQ_ORYSI      AEVIGISGDDAASHKE------------------------------------------------------
PERQ_SEDLI      AEVVGISGDSSESH----------KAFAKKYKLPFLSDEGNKVRKEWGVPSDRETYVLDKNGQLVYNNQF
BCP_SHIFL       VDVLGIST--------DKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFFLIDADGKIEH--VF
BCP_ECOLI       VDVLGIST--------DKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFFLIDADGKIEH--VF
BCP_ECOL6       VDVLGIST--------DKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFFLIDADGKIEH--VF
BCP_ECO57       VDVLGIST--------DKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFFLIDADGKIEH--VF
PRXQ_POPJC      AEVVGISGDDPSSH----------KAFAKKYRLPFLSDEGNKIRKEWGVPADRQTYVLDKKGQLIYNNQF
PERQ_SUASA      AEVIGISGDDSSSH----------KAFKQKYKLPYLSDEGNKVRKLFGALPGRQTYVLDRNGRLVYNNQF


                         +         .         .         .         .         *         .:210
query           DDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCNIKWKPGNExxxxx
RESA_GEOTN      -----------------------------------------------------
RESA_GEOKA      -----------------------------------------------------
RESA_BACHK      -----------------------------------------------------
RESA_BACC1      -----------------------------------------------------
RESA_OCEIH      -----------------------------------------------------
RESA_BACCR      -----------------------------------------------------
RESA_BACAN      -----------------------------------------------------
RESA_BACAH      -----------------------------------------------------
BCP_HAEIN       -----------------------------------------------------
RESA_BACSU      -----------------------------------------------------
RESA_BACHD      -----------------------------------------------------
RESA_BACCZ      -----------------------------------------------------
TDXH2_PICTO     DPNQTVRWMAETGRNIDEILRSVKALQ--ANWSR-KIATPVNWRPGDK-----
RESA_BACLD      -----------------------------------------------------
PRXQ_ARATH      QPEK-------------------------------------------------
TRBB_ECOLI      -----------------------------------------------------
REHY_MAIZE      -----------------------------------------------------
PRXQ_WHEAT      -----------------------------------------------------
GPX8B_XENLA     -----------------------------------------------------
PRXQ_GENTR      ---QPEKHIDETLKFLQSA----------------------------------
PRXQ_ORYSJ      -----------------------------------------------------
PRXQ_ORYSI      -----------------------------------------------------
PERQ_SEDLI      QPEK-------------------------------------------------
BCP_SHIFL       DDFKTSN----------------------------------------------
BCP_ECOLI       DDFKTSN----------------------------------------------
BCP_ECOL6       DDFKTSN----------------------------------------------
BCP_ECO57       DDFKTSN----------------------------------------------
PRXQ_POPJC      QPEK-------------------------------------------------
PERQ_SUASA      QPEK-------------------------------------------------