[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57708.1

[Show Plain Result]


## Summary of Sequence Search
    1::392
  369::736     4e-08  23%  825 aa  ODFP2_RAT RecName: Full=Outer dense fiber protein 2;AltName:
  374::741     2e-07  22%  830 aa  ODFP2_MOUSE RecName: Full=Outer dense fiber protein 2;AltName:
  374::741     4e-07  21%  829 aa  ODFP2_HUMAN RecName: Full=Outer dense fiber protein 2;AltName:
  104::286     2e-06  34%  665 aa  LMNA_XENLA RecName: Full=Lamin-A;
  389::724     9e-06  20%  822 aa  ODFP2_CHICK RecName: Full=Outer dense fiber protein 2;AltName:
  733::1015    1e-05  23% 1084 aa  MYSS_RABIT RecName: Full=Myosin heavy chain, skeletal muscle;Flags:
  335::729     2e-05  22% 1186 aa  SMC_BACSU RecName: Full=Chromosome partition protein smc;
 1614::1873    2e-05  23% 1942 aa  MYH1_MOUSE RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
 1609::1868    2e-05  23% 1937 aa  MYH2_HORSE RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1611::1870    3e-05  21% 1939 aa  MYH1_PIG RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
 1613::1872    3e-05  22% 1941 aa  MYH2_HUMAN RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1612::1871    3e-05  22% 1940 aa  MYH2_CANFA RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1643::1869    5e-05  23% 1937 aa  MYH8_MOUSE RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1643::1869    5e-05  23% 1937 aa  MYH8_HUMAN RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1611::1870    5e-05  21% 1939 aa  MYH2_PIG RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1098::1276    6e-05  23% 2022 aa  ANT1_ONCVO RecName: Full=Major antigen;AltName: Full=Myosin-like
  234::378     8e-05  24% 1215 aa  SUDA_EMENI RecName: Full=Chromosome segregation protein
 1638::1874    1e-04  26% 1940 aa  MYH3_HUMAN RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
 1612::1871    1e-04  21% 1940 aa  MYH2_BOVIN RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1645::1871    1e-04  26% 1939 aa  MYH8_CANFA RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1638::1874    1e-04  26% 1940 aa  MYH3_RAT RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
 1611::1870    1e-04  21% 1939 aa  MYH1_CANFA RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
  948::1136    2e-04  28% 1853 aa  MYO5A_MOUSE RecName: Full=Myosin-Va;AltName: Full=Dilute myosin heavy
 1611::1870    2e-04  21% 1939 aa  MYH1_HUMAN RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
 1610::1869    2e-04  22% 1938 aa  MYH1_HORSE RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
    3::189     2e-04  24%  257 aa  MYH8_RAT RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1610::1869    2e-04  21% 1938 aa  MYH1_BOVIN RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
  513::704     3e-04  28% 1050 aa  Y4862_ARATH RecName: Full=Uncharacterized protein At4g38062;
  221::353     3e-04  25%  837 aa  NOP14_KLULA RecName: Full=Probable nucleolar complex protein 14;
  948::1136    3e-04  28% 1828 aa  MYO5A_RAT RecName: Full=Myosin-Va;AltName: Full=Dilute myosin heavy
 1638::1874    3e-04  26% 1940 aa  MYH3_MOUSE RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain 3;
 1659::1876    4e-04  27% 1940 aa  MYH3_CHICK RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
   90::271     5e-04  25%  470 aa  TRAIP_MOUSE RecName: Full=TRAF-interacting protein;
  339::436     5e-04  29%  624 aa  MOEH_ANOGA RecName: Full=Moesin/ezrin/radixin homolog 1;
  514::609     5e-04  37% 1375 aa  BNR1_YEAST RecName: Full=BNI1-related protein 1;
  342::514     7e-04  25%  729 aa  PURL_STAES RecName: Full=Phosphoribosylformylglycinamidine synthase
  342::514     7e-04  25%  729 aa  PURL_STAEQ RecName: Full=Phosphoribosylformylglycinamidine synthase
  346::469     7e-04  29%  760 aa  GOGA5_DANRE RecName: Full=Golgin subfamily A member 5;AltName:
 3286::3361    7e-04  36% 4490 aa  DYH8_HUMAN RecName: Full=Dynein heavy chain 8, axonemal;AltName:
  255::466     7e-04  22% 1110 aa  CC150_MOUSE RecName: Full=Coiled-coil domain-containing protein
  342::514     9e-04  26%  729 aa  PURL_STACT RecName: Full=Phosphoribosylformylglycinamidine synthase
  612::740     9e-04  29%  864 aa  MYSP_MYTGA RecName: Full=Paramyosin;
    1::392

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxATPMQYLDKAMNQLHDLGLLSEGERQEAPIIALLNQISDLDQARVTAIARTLNQASLFNEVVREQV
ODFP2_RAT       --------------------------GNQHKAEVEAIMEQLKELKQ-KGDRDKETLKKA------IRAQK
ODFP2_MOUSE     --------------------------GNQHKAEVEAIMEQLKELKQ-KGDRDKETLKKA------IRAQK
ODFP2_HUMAN     --------------------------GNQHKAEVEAIMEQLKELKQ-------KGDRDKESLKKAIRAQK
LMNA_XENLA      ----------------------------------------------------------------------
ODFP2_CHICK     -------------------------------------LRQKADRDKDALKRALRAQKERAERSEECAGQL
MYSS_RABIT      ----------------------------------------------------------------------
SMC_BACSU       ----------------------LKEELSKQEAVFETLQAEVKQL-RAQVKEKQQAL---SLHNENVEEKI
MYH1_MOUSE      ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MYH1_PIG        ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
ANT1_ONCVO      --------------------------------------------------------NVANLESELDTTRE
SUDA_EMENI      ----------------------------------------------------------------------
MYH3_HUMAN      ----AETLKHLRSVQGQLKDTQLHLDGQEDLKEQLAIVERRANLLQAEVEELRATLEQTERARKLAEQEL
MYH2_BOVIN      ----------------------------------------------------------------------
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_RAT        ----AETIKHLRSVQGQLKDTQLHLDGQEDLKEQLAIVERRANLLQAEVEELRATLEQTERARKLAEQEL
MYH1_CANFA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH1_HORSE      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
MYH1_BOVIN      ----------------------------------------------------------------------
Y4862_ARATH     ----------------------------------------------------------------------
NOP14_KLULA     ----------------------------------------------------ARKKTKAEVMQEVIKSKF
MYO5A_RAT       ----------------------------------------------------------------------
MYH3_MOUSE      ----AETIKHLRSVQGQLKDTQLHLDGQEDLKEQLAIVERRANLLQAEVEELRATLEQTERARKLAEQEL
MYH3_CHICK      ----------------QIHDDALRSQEDLKEQ--VAMVERRANLLQAEIEELRAALEQTERSRKVAEQEL
TRAIP_MOUSE     -----------------------LSQKDREKRDSQAIIDTLRDTLEERVESLQNALNKAEMLCSTLKKQM
MOEH_ANOGA      ----------------------------------------------------------------------
BNR1_YEAST      ----------------------------------------------------------------------
PURL_STAES      ----------------------------------------------------------------------
PURL_STAEQ      ----------------------------------------------------------------------
GOGA5_DANRE     ----------------------------------------------------------------------
DYH8_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------KVQEMGSVVEAERQQVHAL----------QEKCTALHSSMKTTQ--DLLAQEQR
PURL_STACT      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QAMEIGERYEEITHAFNSIRDDAKSMVEQAEDGKIDTFERLGNIWMKVSRGDIATRFDKIKETYLEVTAS
ODFP2_RAT       ERAEKSEEYAEQLHVQLADKDEALSTLESWRSRYNQVVKDKGDLELEIRVTDLVNQQQSLEEKMREDRDS
ODFP2_MOUSE     ERAEKSEEYAEQLHVQLADKDEALSTLESWRSRYNQVVKDKGDLELEIRVTDLVNQQQSLEEKMREDRDS
ODFP2_HUMAN     ERAEKSEEYAEQLHVQLADKDEALSTLESWRSRYNQVVKEKGDLELEIRVTDLVNQQQTLEEKMREDRDS
LMNA_XENLA      ----------------------------------------------------------------------
ODFP2_CHICK     -AVQLAEKDSYVAEALSTL-ESWRSRYNKVVKDKSDLELEMVTVNSRIA--DLLEQQATLEDKMREDRDA
MYSS_RABIT      ---------------------------------------------------------DQLKRNHLRVVES
SMC_BACSU       EQLK--SDYFELLNSQASIRNELQLLDDQMSQSAV-TLQRLADNNEKQERHDISARKAACETEFARIEQE
MYH1_MOUSE      ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
MYH2_HORSE      ------------------------------------------------SRNDAIRIKKKMEGDLNEMEIQ
MYH1_PIG        ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
MYH2_HUMAN      ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
MYH2_CANFA      ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
MYH8_MOUSE      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH2_PIG        ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
ANT1_ONCVO      RIHLLGEQNASLQTELNKIKGDIDSLFDMLKTAKESNEAEIDRLKQKLQRSKYSDALDKLRPEYDRLQNL
SUDA_EMENI      ---------------------------------------------------EIASFLDSLEETGVEDTDI
MYH3_HUMAN      --LDSNERVQSLIHTKKKLETDLMQLQSEVEDASRDA--RNAEEKAKKAITDAAMMAEELKK---EQDTS
MYH2_BOVIN      ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_RAT        --LDSNERVQSLIHTKKKLETDLTQLQSEVEDASRDA--RNAEEKAKKAITDAAMMAEELKK---EQDTS
MYH1_CANFA      ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
MYO5A_MOUSE     ------EKLTNLEGVYNSETEKLRNDVERLQ---------LSEEEAKVATGRVLSLQEEIAKLRLEQTRS
MYH1_HUMAN      ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
MYH1_HORSE      ------------------------------------------------SRNDAIRIKKKMEGDLNEMEIQ
MYH8_RAT        ----------------------------------------------------------------------
MYH1_BOVIN      ------------------------------------------------SRNDAIRLKKKMEGDLNEMEIQ
Y4862_ARATH     ----------------------------------------------------------------------
NOP14_KLULA     YKHERQKAQEKLVQDIEGLDDDFESIMSE-----LRTLPKTKPSQTEISTSDIAPDYDKVKELVLEKRAA
MYO5A_RAT       ------EKLTNLEGVYNSETEKLRNDVERLQ---------LSEEEAKVATGRVLSLQEEIAKLRLEQTRS
MYH3_MOUSE      --LDSNERVQSLIHTKKKLETDLTQLQSEVEDACRDA--RNAEEKAKKAITDAAMMAEELKK---EQDTS
MYH3_CHICK      --LDASERVQ-LLHTQNTSLINTKKKLEQIQSEMEDTIQXXXXXXXXXXXXDAAMMAEELKK---EQDTS
TRAIP_MOUSE     KFLE--QRQDETKQA----REEAHRL-----KCKMKTMEQI-ELLLQSQRSEVEERDMGVGQSAVEQLAV
MOEH_ANOGA      -------------------------------------------------------------QEYEDRLRS
BNR1_YEAST      ----------------------------------------------------------------------
PURL_STAES      ----------------------------------------------------------------------
PURL_STAEQ      ----------------------------------------------------------------------
GOGA5_DANRE     ----------------------------------------------------------------LKARSS
DYH8_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     KNEDLGMTISQLKSDLNSRDNLICKLVEENKATQISLKEHEENIYLKLSLQDVSGKADQLSKKCSELTSM
PURL_STACT      ----------------------------------------------------------------------
MYSP_MYTGA      --------------------EDARSLLEHAERARKNAENELGEVTVRLT------------EVQLQVTAL


                         +         .         .         .         .         *         .:210
query           THDQIQREQKILQAYQDFRGALKQSEVLALEVLKTAEGKLDAAKADVKGAMKMIETYQGEEVAERAKLEL
ODFP2_RAT       LVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVM----KTRL
ODFP2_MOUSE     LVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVM----KTRL
ODFP2_HUMAN     LVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVM----KTRL
LMNA_XENLA      ---KIREEHKELKA----RNAKKESDLLTAQALKDLEALLDAALTTALGEKRNLENEIRELKAHIAKLEA
ODFP2_CHICK     LMDKLHQQTTETTSFRMENERLKASVVPMEEKLNQAHVEVQQLKSSVRNYEDLIETYKSQVLKTRAKLEK
MYSS_RABIT      MQSEIRSRNDALRIKKKMEGDLNEMEIQAIKNLRNTQGILKDTQLHLDDAVRGQDDHKEQMVERRANLMQ
SMC_BACSU       IHSQVGAYRDMQTKYEQKKRQYEKNESXXXDMLETMQGDFSGFYQGVKEVLKVLELISTEQKYETAEIAL
MYH1_MOUSE      LNHSNRMAAEALRNYRNTQGILKDTQLHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
MYH2_HORSE      LNHANRMAAEALRNYRNTQGILKDTQLHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
MYH1_PIG        LNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQE--------DLKEQLAMVE--------RRANLLQ
MYH2_HUMAN      LNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQE--------DLKEQLAMVE--------RRANLLQ
MYH2_CANFA      LNHANRMAAEALRNYRNTQGILKDTQIHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
MYH8_MOUSE      -----------LRNYRNTQGILKDTQLHLDDALRGQE--------DLKEQLAIVE--------RRANLLQ
MYH8_HUMAN      -----------LRNYRNTQGILKETQLHLDDALRIVERRANLLQAEIEELWATLETERSRKIAEQELLDA
MYH2_PIG        LNHANRMAAEALRNYRNTQGILKDTQIHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
ANT1_ONCVO      YREKIKQAENLTQAVQDLESRLNQSR----RELRDATDKLIASEGDRNALRSEVEKLQHEVQFMREQLLR
SUDA_EMENI      NRDRIQGEKEMAQVDAEIAECKQQIEFLKVDKAQLEDERREASKALAQVELQAKSLSDNQAAAQESKAR-
MYH3_HUMAN      AH--LERMKKNLQTVKDLQHRLDEAEQLALKGGKKQIQKLETRIRELEFELEGEQKKNTESVKGLRKYE-
MYH2_BOVIN      LNHANRMAAEALKNYRNTQAILKDTQIHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
MYH8_CANFA      -----------LRNYRNTQGILKDTQLHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
MYH3_RAT        AH--LERMKKNLQTVKDLQHRLDEAEQLALKGGKKQIQKLETRIRELEFELEGEQKRNTESVKGLRKYE-
MYH1_CANFA      LNHANRMAAEALRNYRNTQGILKDTQIHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
MYO5A_MOUSE     EKKSIERADKYKQETDQLVSNLKEENTLLKQEKETLNHRI------VEQAKEMTETMERKLVEETKQLEL
MYH1_HUMAN      LNHANRMAAEALRNYRNTQAILKDTQLHLDDALRSQE--------DLKEQLAMVE--------RRANLLQ
MYH1_HORSE      LNHANRMAAEALRNYRNTQGILKDTQLHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
MYH8_RAT        -----------------------------------------ALQAEIEELRATLETERSRKIAEQELLDA
MYH1_BOVIN      LNHANRMAAEALKNYRSTQAILKDTQIHLDDALRGQE--------DLKEQLAMVE--------RRANLLQ
Y4862_ARATH     ---------------------------------------------------KEVERFK-EMVEESSRFQT
NOP14_KLULA     PADRTKTDEEIKKEYEDKQKELEQKRLDRMNGIFNIEDQKDAGVEDL-----------------------
MYO5A_RAT       EKKSIERADKYKQETEQLVSNLKEENTLLKQEKETLNHLM------VEQAKEMTETMERKLVEETKQLEL
MYH3_MOUSE      AH--LERMKKNLQTVKDLQHRLDEAEQLALKGGKKQIQKLETRIRELEFELEGEQKRNTESVKGLRKYE-
MYH3_CHICK      AH--LERMKKNLQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVDAEQKRSAEAVKGVRKYE-
TRAIP_MOUSE     YCVSLKKEYENLKEARKATGELKKDLVSSRSKLKTLNTELDQAKLELRSAQKDLQSADQEITSLRKKL--
MOEH_ANOGA      MQEEMERKQANLSEAQDTIRRLQEQ----LNQVQAAKEELEQRQNELHEMMQRLEETKNMEATERAKLE-
BNR1_YEAST      ---------------------------------------------------KLLDSLQSDEIARRAVTEI
PURL_STAES      --------------------------------------ELDSAVGEVTDTDRFVLTYDDEVYADIPVQPL
PURL_STAEQ      --------------------------------------ELDSAVGEVTDTDRFVLTYDDEVYADIPVQPL
GOGA5_DANRE     ALEEAQNERRILQDHSE-------GSSLHSQAVQTLQDRLRDAEAAVKREQESYRQIQSEFAARLAKVEA
DYH8_HUMAN      -------------------------EVLPLKALAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDA
CC150_MOUSE     LQVVKMENSRIIAEHQ---AILKVEQKMITETFQEQNLLLDAAHASITGELQAVQNEKAQLQIHLDHLIL
PURL_STACT      --------------------------------------ELDSAVGEVTDTNRFVLTYEDEVYADIPVEPL
MYSP_MYTGA      TNDKRRMEADIAAMQSDLDDALNGQ--------RAAEERADRLQAEVNRLADELRQEQAESLRKQLEIEI


                         .         .         .         +         .         .         .:280
query           ARDEKVRLLQNEEKRYQIAKDLSDNLTISYNTSEVVMARLIQTTNAKERVYAQAVSFFSTNEVVLTALTA
ODFP2_RAT       EADEVAAQLERCDKENKMLKDMNKEIEAARRQFQSQLADLLKITEAKLAECQDQLQGYERKNIDLTAIIS
ODFP2_MOUSE     EADEVAAQLERCDKENKMLKDMNKEIEAARRQFQSQLADLLKITEAKLAECQDQLQGYERKNIDLTAIIS
ODFP2_HUMAN     EADEVAAQLERCDKENKILKDMNKEIEAARRQFQSQLADLLKITEAKLAECQDQLQGYERKNIDLTAIIS
LMNA_XENLA      SQDEMLRRVDTENRNQTLKEELEFQKSI-YNTKRRHETRLVEVDNGRQR------EFESKLADALHELRA
ODFP2_CHICK     CDNEKKALKDEMNKELELAKQFQSQLAELEKLPEILRITETQLAECQDQLQS-----YEKKNMDLSVMIA
MYSS_RABIT      AEIEELRLEQTERSRRVADQDLLDQLLHTQNTSLINTKKKLETDISQEDIVQXXXXXXXXXXXXITDAAM
SMC_BACSU       GASAQHVVTDDEQSARKAIQYLKQNSRATFLPLSVIRDRQLQSRDAETA--ARHSSFLGVASELVTFDPA
MYH1_MOUSE      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDISQIQGEMEDIVQXXXXXXXXXXXXITDAAM
MYH2_HORSE      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDISQLQGEMEDILQXXXXXXXXXXXXITDAAM
MYH1_PIG        AEIEELRALEQTERSRKVAEDASERVQLLHNTKKKLETDISQIQGEMEDIIQXXXXXXXXXXXXITDAAM
MYH2_HUMAN      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDISQMQGEMEDILQXXXXXXXXXXXXITDAAM
MYH2_CANFA      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDISQIQGEMEDIIQXXXXXXXXXXXXITDAAM
MYH8_MOUSE      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAM
MYH8_HUMAN      S--ERVQLLHTQNTSLINTKKKLEN-DVSQLQSEVEEV-IQESRNAEEKA-----------KKAITDAAM
MYH2_PIG        AEIEELRALEQTERSRKVAEDASERVQLLHNTKKKLETDISQMQGEMEDILQXXXXXXXXXXXXITDAAM
ANT1_ONCVO      KTDEYQAALSDLVNAHRTAED-------------------------------------------------
SUDA_EMENI      -HDESLKAVQSAEERQTELKELVPRFISAKDAEDAARAKLTEAETARQRLYAK-----------------
MYH3_HUMAN      -RRVKELTYQSEEDRKNVLRDLVDKLQV------------------------------------------
MYH2_BOVIN      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDITQIQGEMEDILQXXXXXXXXXXXXITDAAM
MYH8_CANFA      AEIEELRLEQTERSRKTAEQELLDQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNEKAKKAITD
MYH3_RAT        -RRVKELTYQSEEDRKNVLRDLVDKLQV------------------------------------------
MYH1_CANFA      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDISQIQGEMEDIIQXXXXXXXXXXXXITDAAM
MYO5A_MOUSE     LNDERLRYLLNEEERYD---DLKEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDI-------
MYH1_HUMAN      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDISQIQGEMEDIIQXXXXXXXXXXXXITDAAM
MYH1_HORSE      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDISQLQGEMEDIVQXXXXXXXXXXXXITDAAM
MYH8_RAT        S--ERVQLLHTQNASLINAKKKLEN-DVSQLQSEV------------EEVIQRARNXXXXXXXXITDAAM
MYH1_BOVIN      AEIEELRALEQTERSRKIAEDASERVQLLHNTKKKLETDITQIQGEMEDIIQXXXXXXXXXXXXITDAAM
Y4862_ARATH     QMQEKMKEAENEEKLLQVCDALD-------NTNIDLVAEREKVVSLTRQI--ESLGTVKEKNLVMEKETQ
NOP14_KLULA     ----------------------------------------------------------------------
MYO5A_RAT       LNDERLRYLLNEEERYD---DLKEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDI-------
MYH3_MOUSE      -RRVKELTYQSEEDRKNVLRDLVDKLQV------------------------------------------
MYH3_CHICK      -RRVKELTYQSEEDRKNVLRDLVDKL--------------------------------------------
TRAIP_MOUSE     ----------------------------------------------------------------------
MOEH_ANOGA      ---EEIRVKQLEMQKIQEEVTLKDSET-------------------------------------------
BNR1_YEAST      DDNEKLNLVENHDKDHLIAKDESESL-ISLKTKEIENLKLLDQITTHQRLYDQPPSLASSN---------
PURL_STAES      ADEAPVYILEGEEKEYNTSKNDYSNIDV-----HDTFIKLLQTIASKHHLYEQYDQQVGANTIIKPGLQA
PURL_STAEQ      ADEAPVYILEGEEKEYNTSKNDYSNIDV-----HDTFIKLLQTIASKHHLYEQYDQQVGANTIIKPGLQA
GOGA5_DANRE     ERQTLAESLTNAERRLQRAEDLQQQAKSSRSAAEYTKQELQDYKNKASRI--------------------
DYH8_HUMAN      AMNEKMDLLNDADKKMQAASTLIDGLS-------------------------------------------
CC150_MOUSE     EHNQCLQKSQEAEKRTVVQKELLES---------------------------------------------
PURL_STACT      ADEAPVYILEGEEKAHNTSKNDYSNVDV----NDVFKKLLAHPTIASKRLYEQYDQQVGANTVVKPGLQA
MYSP_MYTGA      VRLEEAEAFAQREGKRQIAK--------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SFTGMFGLHESTRTVEAMKEGVSQSLEVLADIGGKVQEAAVKAGYGPTVRADAVKKLVDSVVNWQSRSHE
ODFP2_RAT       DLRSRIE-HQGDK-LELAREKHQASQKENKQLSQKVDELERKLEATSTQNVEVIAKREEAIHQAQLR---
ODFP2_MOUSE     DLRSRIE-HQGDK-LEMAREKHQASQKENKQLSQKVDELERKLEATSAQNVEVIAKREEAIHQAQLR---
ODFP2_HUMAN     DLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIELQVIAKREEAIHQSQLR---
LMNA_XENLA      QHEGQIGLYELGKTYNAKLENAKQSAERNSSLVGEAQE--------------------------------
ODFP2_CHICK     DLRQRIELQGDK--MEMTRERYQSAQEEKKQLTLKAEELERKLETTSTQNIEVIAKREESIHQCQLR---
MYSS_RABIT      MAEELKKEQDTSAHLERMKKNMEQTVKDLQQRLDEAEQLALKGGKKQIQKLEAVKELENEVESEQKRNVE
SMC_BACSU       YRSVIQNLLGTVLITEDLK-GANELAKLLGHRYRIVTLEGDVVNPGGSMTGGAVKKKNNSLLGRSRELED
MYH1_MOUSE      MAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVENEQKRNVE
MYH2_HORSE      MAEELKKEQDTSAHLERMKKNLEQTVKDLQQRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKRSAE
MYH1_PIG        MAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKRNVE
MYH2_HUMAN      MAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKRNAE
MYH2_CANFA      MAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKRNAE
MYH8_MOUSE      MAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVENEQKRNAE
MYH8_HUMAN      MAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVENEQKRNAE
MYH2_PIG        MAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKRNAE
ANT1_ONCVO      ----------------------------------------------------------------------
SUDA_EMENI      ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MYH2_BOVIN      MAEELKKEQDTSAHLERMKKNMEQTVKDLQNRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKRNVE
MYH8_CANFA      AAMMAEELKKEQDTLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVHELEGEVESEQKRNAE
MYH3_RAT        ----------------------------------------------------------------------
MYH1_CANFA      MAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKHNIE
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH1_HUMAN      MAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKRNVE
MYH1_HORSE      MAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRDLEGEVESEQKRNVE
MYH8_RAT        MAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVENEQKRNAE
MYH1_BOVIN      MAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEAVRELEGEVESEQKRNVE
Y4862_ARATH     EYKEM--LEESEKCRVLLEEQISQSNENIRELCSKVDIAYAKLAEEVEKTASLVRKSESIDLNEEHRQRE
NOP14_KLULA     ----------------------------------------------------------------------
MYO5A_RAT       ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
TRAIP_MOUSE     ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
BNR1_YEAST      ----------------------------------------------------------------------
PURL_STAES      SVVRVEGTQKANQPYEGGKMVVAEAYRNLIAVGATPLAMTDCLNYGSPEKKEIYQQLIDS----------
PURL_STAEQ      SVVRVEGTQKANQPYEGGKMVVAEAYRNLIAVGATPLAMTDCLNYGSPEKKEIYQQLIDS----------
GOGA5_DANRE     ----------------------------------------------------------------------
DYH8_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
PURL_STACT      SVVRVEGTNKANQPYEGGKMVVAEAYRNLIAVGATPLAMTDCLNYGSPEKKEIYQQLIDS----------
MYSP_MYTGA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IIEEMRRQSTANAREIRNAVEESKRKLARLAEAGKGVAVAAQ
ODFP2_RAT       -LEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQ
ODFP2_MOUSE     -LEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQ
ODFP2_HUMAN     -LEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQ
LMNA_XENLA      ------------------------------------------
ODFP2_CHICK     -LEEKTRECSSLARQLEMAIEDAKREV---------------
MYSS_RABIT      AVKGLRKHE-RRVKELTYQTEEDRKNVLRLQD----------
SMC_BACSU       VTKRLAEMEEKTAKTLKHSIQDMEKKLADLRETGEGLRLKQQ
MYH1_MOUSE      AIKGLRKHE-RRVKELTYQTEEDRKNVLRLQD----------
MYH2_HORSE      AIKGLRKHER-RVKELTYQTEEDRKNILRLQD----------
MYH1_PIG        TVKGLRKHER-RVKELTYQTEEDRKNILRLQD----------
MYH2_HUMAN      AVKGLRKHER-RVKELTYQTEEDRKNILRLQD----------
MYH2_CANFA      AVKGLRKHER-RVKELTYQTEEDRKNILRLQD----------
MYH8_MOUSE      AVKGLRKHE-RRVKELTYQTEEDRKNVLRLQD----------
MYH8_HUMAN      AVKGLRKHE-RRVKELTYQTEEDRKNVLRLQD----------
MYH2_PIG        AVKGLRKHER-RVKELTYQTEEDRKNILRLQD----------
ANT1_ONCVO      ------------------------------------------
SUDA_EMENI      ------------------------------------------
MYH3_HUMAN      ------------------------------------------
MYH2_BOVIN      AVKGLRKHER-RVKELTYQTEEDRKNILRLQD----------
MYH8_CANFA      AVKGLRKHE-RRVKELTYQTEEDRKNVLRLQD----------
MYH3_RAT        ------------------------------------------
MYH1_CANFA      TVKSLRKHE-RRVKELTYQTEEDRKNVLRLQD----------
MYO5A_MOUSE     ------------------------------------------
MYH1_HUMAN      AVKGLRKHER-KVKELTYQTEEDRKNILRLQD----------
MYH1_HORSE      AVKGLRKHER-RVKELTYQTEEDRKNILRLQD----------
MYH8_RAT        AVKGLRKHE-RRVKELTYQTEEDRKNVLRLQD----------
MYH1_BOVIN      AVKGLRKHER-RVKELTYQTEEDRKNILRLQD----------
Y4862_ARATH     LYKEMLEESTKTQLLLQEKVNDSKRKLADVSEA---------
NOP14_KLULA     ------------------------------------------
MYO5A_RAT       ------------------------------------------
MYH3_MOUSE      ------------------------------------------
MYH3_CHICK      ------------------------------------------
TRAIP_MOUSE     ------------------------------------------
MOEH_ANOGA      ------------------------------------------
BNR1_YEAST      ------------------------------------------
PURL_STAES      ------------------------------------------
PURL_STAEQ      ------------------------------------------
GOGA5_DANRE     ------------------------------------------
DYH8_HUMAN      ------------------------------------------
CC150_MOUSE     ------------------------------------------
PURL_STACT      ------------------------------------------
MYSP_MYTGA      ------------------------------------------