[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57747.1

[Show Plain Result]


## Summary of Sequence Search
    1::214
   14::199     3e-15  29%  204 aa  QOX3_BACSU RecName: Full=Quinol oxidase subunit 3;       
   26::204     1e-13  29%  205 aa  COX3_CORGL RecName: Full=Cytochrome c oxidase subunit 3;       
  623::815     7e-13  30%  815 aa  AOX1_AERPE RecName: Full=Heme-copper oxidase subunit I+III;        
   26::202     1e-12  27%  203 aa  COX3_MYCPA RecName: Full=Probable cytochrome c oxidase subunit 3;  
   26::202     2e-12  27%  203 aa  COX3_NOCFA RecName: Full=Probable cytochrome c oxidase subunit 3;  
   26::204     2e-12  28%  205 aa  COX3_COREF RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     4e-12  32%  261 aa  COX3_GADMO RecName: Full=Cytochrome c oxidase subunit 3;       
   33::206     5e-12  26%  209 aa  CYOC_PSEAE RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; 
   82::257     5e-12  36%  261 aa  COX3_ONCMY RecName: Full=Cytochrome c oxidase subunit 3;       
   26::201     5e-12  28%  202 aa  COX3_MYCLE RecName: Full=Probable cytochrome c oxidase subunit 3;  
   82::257     5e-12  31%  261 aa  COX3_LATCH RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     6e-12  33%  261 aa  COX3_TETNG RecName: Full=Cytochrome c oxidase subunit 3;       
   68::257     6e-12  30%  261 aa  COX3_BALMU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     1e-11  37%  261 aa  COX3_SALSA RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     1e-11  31%  261 aa  COX3_PIG RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     1e-11  35%  261 aa  COX3_ONCNE RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     1e-11  35%  261 aa  COX3_ONCMA RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     1e-11  35%  261 aa  COX3_ONCCL RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     1e-11  29%  261 aa  COX3_HORSE RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     1e-11  29%  261 aa  COX3_EQUAS RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     1e-11  31%  261 aa  COX3_BOVIN RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     1e-11  31%  261 aa  COX3_BOSIN RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     2e-11  30%  261 aa  COX3_MADGU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     2e-11  30%  261 aa  COX3_OUROU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     2e-11  30%  261 aa  COX3_MAMPR RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     2e-11  29%  261 aa  COX3_MACRO RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     2e-11  30%  261 aa  COX3_LOXAF RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     2e-11  30%  261 aa  COX3_CEPNA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     2e-11  30%  261 aa  COX3_AEPME RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   30::204     3e-11  27%  207 aa  CYOC_PSEPU RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; 
   82::257     3e-11  30%  261 aa  COX3_TRAST RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_TRASR RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_TRAOR RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_RHIUN RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     3e-11  30%  261 aa  COX3_RAPME RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     3e-11  30%  261 aa  COX3_RAPCA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_PELCP RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     3e-11  30%  261 aa  COX3_NEOMO RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   26::202     3e-11  29%  203 aa  COX3_MYCTU RecName: Full=Probable cytochrome c oxidase subunit 3;  
   26::202     3e-11  29%  203 aa  COX3_MYCBO RecName: Full=Probable cytochrome c oxidase subunit 3;  
   82::257     3e-11  30%  261 aa  COX3_LITWA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZTH RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZSP RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZSO RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZSA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZRU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZGR RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZGA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZDO RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZDA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZCU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_GAZBE RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_ELEMA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_DAMLU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  29%  261 aa  COX3_CERSI RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     3e-11  30%  261 aa  COX3_BALPH RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_ANTMR RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-11  30%  261 aa  COX3_ANTCE RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     4e-11  30%  261 aa  COX3_TRASP RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   68::257     4e-11  30%  261 aa  COX3_TRAIM RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     4e-11  29%  281 aa  COX3_DIDMA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     4e-11  32%  261 aa  COX3_CYPCA RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     4e-11  32%  261 aa  COX3_CARAU RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     5e-11  30%  261 aa  COX3_SHEEP RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     5e-11  32%  261 aa  COX3_CROLA RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     5e-11  30%  260 aa  COX3_BOSMU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     7e-11  32%  261 aa  COX3_SQUAC RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     7e-11  29%  261 aa  COX3_ORNAN RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     1e-10  32%  261 aa  COX3_PELSU RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     1e-10  31%  261 aa  COX3_DANRE RecName: Full=Cytochrome c oxidase subunit 3;       
   28::201     2e-10  25%  204 aa  CYOC_SHIFL RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; 
   28::201     2e-10  25%  204 aa  CYOC_ECOLI RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; 
   28::201     2e-10  25%  204 aa  CYOC_ECOL6 RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; 
   82::257     2e-10  28%  261 aa  COX3_TACAC RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-10  29%  261 aa  COX3_DINSE RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     4e-10  30%  261 aa  COX3_SCYCA RecName: Full=Cytochrome c oxidase subunit 3;       
   82::257     4e-10  29%  261 aa  COX3_HIPAM RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     7e-10  29%  261 aa  COX3_SYNCA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     7e-10  29%  261 aa  COX3_GAZSU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     7e-10  29%  261 aa  COX3_GAZLE RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::256     1e-09  30%  260 aa  COX3_XENLA RecName: Full=Cytochrome c oxidase subunit 3;       
  132::257     1e-09  29%  261 aa  COX3_DUGDU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  132::257     4e-09  28%  261 aa  COX3_FELCA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     5e-09  29%  261 aa  COX3_POLOR RecName: Full=Cytochrome c oxidase subunit 3;       
  132::257     5e-09  28%  261 aa  COX3_COTJA RecName: Full=Cytochrome c oxidase subunit 3;       
  133::258     6e-09  28%  262 aa  COX3_METSE RecName: Full=Cytochrome c oxidase subunit 3;       
  132::257     8e-09  28%  261 aa  COX3_PHOVI RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  132::257     8e-09  28%  261 aa  COX3_HALGR RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  134::257     8e-09  29%  261 aa  COX3_DASNO RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   10::200     1e-08  31%  201 aa  COX3_THEVL RecName: Full=Cytochrome c oxidase subunit 3;       
  132::257     1e-08  28%  261 aa  COX3_CANLU RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  132::257     1e-08  28%  261 aa  COX3_CANFA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
    5::195     2e-08  21%  201 aa  QOX3_STAS1 RecName: Full=Probable quinol oxidase subunit 3;        
  132::257     2e-08  27%  261 aa  COX3_CHICK RecName: Full=Cytochrome c oxidase subunit 3;       
  135::260     2e-08  27%  265 aa  COX3_SOYBN RecName: Full=Cytochrome c oxidase subunit 3;       
   26::205     3e-08  25%  206 aa  COX3_STRCO RecName: Full=Probable cytochrome c oxidase subunit 3;  
   26::205     3e-08  24%  206 aa  COX3_STRAW RecName: Full=Probable cytochrome c oxidase subunit 3;  
   89::265     3e-08  27%  269 aa  COX3_SACKL RecName: Full=Cytochrome c oxidase subunit 3;       
   89::265     3e-08  29%  269 aa  COX3_CANGA RecName: Full=Cytochrome c oxidase subunit 3;       
  135::260     5e-08  36%  265 aa  COX3_WHEAT RecName: Full=Cytochrome c oxidase subunit 3;       
   89::265     5e-08  26%  269 aa  COX3_KLULA RecName: Full=Cytochrome c oxidase subunit 3;       
   89::265     7e-08  27%  269 aa  COX3_YEAST RecName: Full=Cytochrome c oxidase subunit 3;       
  134::257     7e-08  28%  261 aa  COX3_RABIT RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     7e-08  28%  261 aa  COX3_PETMA RecName: Full=Cytochrome c oxidase subunit 3;       
  133::258     7e-08  27%  262 aa  COX3_BRALA RecName: Full=Cytochrome c oxidase subunit 3;       
  133::258     7e-08  27%  262 aa  COX3_BRAFL RecName: Full=Cytochrome c oxidase subunit 3;       
  135::260     7e-08  36%  265 aa  COX3_ARATH RecName: Full=Cytochrome c oxidase subunit 3;       
    9::195     9e-08  25%  201 aa  QOX3_STAHJ RecName: Full=Probable quinol oxidase subunit 3;        
  197::257     9e-08  34%  261 aa  COX3_RAT RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  134::257     1e-07  27%  261 aa  COX3_STRCA RecName: Full=Cytochrome c oxidase subunit 3;       
  197::257     1e-07  33%  261 aa  COX3_MOUSE RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   89::265     1e-07  30%  269 aa  COX3_MAGGR RecName: Full=Cytochrome c oxidase subunit 3;       
  195::258     1e-07  31%  259 aa  COX3_APILI RecName: Full=Cytochrome c oxidase subunit 3;       
    9::195     2e-07  20%  201 aa  QOX3_STAAW RecName: Full=Probable quinol oxidase subunit 3;        
    9::195     2e-07  20%  201 aa  QOX3_STAAS RecName: Full=Probable quinol oxidase subunit 3;        
    9::195     2e-07  20%  201 aa  QOX3_STAAR RecName: Full=Probable quinol oxidase subunit 3;        
    9::195     2e-07  20%  201 aa  QOX3_STAAN RecName: Full=Probable quinol oxidase subunit 3;        
    9::195     2e-07  20%  201 aa  QOX3_STAAM RecName: Full=Probable quinol oxidase subunit 3;        
    9::195     2e-07  20%  201 aa  QOX3_STAAC RecName: Full=Probable quinol oxidase subunit 3;        
    9::195     2e-07  20%  201 aa  QOX3_STAAB RecName: Full=Probable quinol oxidase subunit 3;        
    9::195     2e-07  20%  201 aa  QOX3_STAA8 RecName: Full=Probable quinol oxidase subunit 3;        
    9::195     2e-07  20%  201 aa  QOX3_STAA3 RecName: Full=Probable quinol oxidase subunit 3;        
   90::266     2e-07  25%  270 aa  COX3_VANPO RecName: Full=Cytochrome c oxidase subunit 3;       
  136::277     2e-07  28%  281 aa  COX3_RHIST RecName: Full=Cytochrome c oxidase subunit 3;       
  132::257     2e-07  26%  274 aa  COX3_LEMCA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  111::195     2e-07  28%  201 aa  QOX3_STAES RecName: Full=Probable quinol oxidase subunit 3;        
  111::195     2e-07  28%  201 aa  QOX3_STAEQ RecName: Full=Probable quinol oxidase subunit 3;        
  132::257     2e-07  27%  261 aa  COX3_GORGO RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  151::233     3e-07  39%  233 aa  COX3_SYNY3 RecName: Full=Cytochrome c oxidase subunit 3;       
  197::257     3e-07  34%  261 aa  COX3_PONPY RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  197::257     3e-07  34%  261 aa  COX3_PONAB RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  197::257     3e-07  34%  261 aa  COX3_PANPA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
   82::257     3e-07  27%  261 aa  COX3_MYXGL RecName: Full=Cytochrome c oxidase subunit 3;       
  197::257     3e-07  34%  261 aa  COX3_HUMAN RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  199::259     3e-07  33%  263 aa  COX3_LOCMI RecName: Full=Cytochrome c oxidase subunit 3;       
  197::257     3e-07  34%  261 aa  COX3_HYLLA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  198::258     3e-07  31%  262 aa  COX3_DROME RecName: Full=Cytochrome c oxidase subunit 3;       
  132::257     4e-07  33%  261 aa  COX3_PAPHA RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  125::203     4e-07  25%  207 aa  COX3_BACP3 RecName: Full=Cytochrome c oxidase subunit 3;       
   89::265     4e-07  26%  269 aa  COX3_ASHGO RecName: Full=Cytochrome c oxidase subunit 3;       
  197::257     6e-07  33%  261 aa  COX3_PANTR RecName: Full=Cytochrome c oxidase subunit 3;AltName:
  198::258     6e-07  31%  262 aa  COX3_DROYA RecName: Full=Cytochrome c oxidase subunit 3;       
   94::280     8e-07  28%  283 aa  COX3_RICCN RecName: Full=Probable cytochrome c oxidase subunit 3;  
  190::255     8e-07  29%  257 aa  COX3_RHISA RecName: Full=Cytochrome c oxidase subunit 3;       
  205::265     8e-07  31%  270 aa  COX3_CYACA RecName: Full=Cytochrome c oxidase subunit 3;       
  198::258     8e-07  33%  262 aa  COX3_AEDAE RecName: Full=Cytochrome c oxidase subunit 3;       
  131::256     1e-06  26%  260 aa  COX3_STRPU RecName: Full=Cytochrome c oxidase subunit 3;       
   89::275     1e-06  28%  278 aa  COX3_RICFE RecName: Full=Probable cytochrome c oxidase subunit 3;  
   84::274     1e-06  27%  277 aa  COX3_RICBR RecName: Full=Probable cytochrome c oxidase subunit 3;  
  135::260     1e-06  26%  265 aa  COX3_OENBE RecName: Full=Cytochrome c oxidase subunit 3;       
  137::265     1e-06  28%  269 aa  COX3_NEUCR RecName: Full=Cytochrome c oxidase subunit 3;       
  200::260     1e-06  51%  265 aa  COX3_MARPO RecName: Full=Cytochrome c oxidase subunit 3;       
  137::265     1e-06  26%  269 aa  COX3_EMENI RecName: Full=Cytochrome c oxidase subunit 3;       
   88::268     1e-06  29%  274 aa  COX3_ALLMA RecName: Full=Cytochrome c oxidase subunit 3;       
  137::265     2e-06  29%  269 aa  COX3_PODAN RecName: Full=Cytochrome c oxidase subunit 3;       
  198::260     2e-06  32%  265 aa  COX3_MYTED RecName: Full=Cytochrome c oxidase subunit 3;       
  198::258     2e-06  30%  262 aa  COX3_ANOGA RecName: Full=Cytochrome c oxidase subunit 3;       
   13::185     4e-06  28%  189 aa  CYOC_BUCAP RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; 
  195::255     4e-06  30%  259 aa  COX3_LOLBL RecName: Full=Cytochrome c oxidase subunit 3;       
  141::203     4e-06  25%  207 aa  COX3_BACSU RecName: Full=Cytochrome c oxidase subunit 3;       
  196::252     4e-06  32%  260 aa  COX3_ASTPE RecName: Full=Cytochrome c oxidase subunit 3;       
  194::253     4e-06  33%  257 aa  COX3_ARTSF RecName: Full=Cytochrome c oxidase subunit 3;       
  198::258     4e-06  30%  262 aa  COX3_ANOQU RecName: Full=Cytochrome c oxidase subunit 3;       
  135::260     5e-06  25%  265 aa  COX3_VICFA RecName: Full=Cytochrome c oxidase subunit 3;       
  231::318     6e-06  27%  329 aa  COX3_ACACA RecName: Full=Cytochrome c oxidase subunit 3;       
  212::276     8e-06  32%  278 aa  COX3_RICPR RecName: Full=Probable cytochrome c oxidase subunit 3;  
   88::264     8e-06  24%  272 aa  COX3_PYLLI RecName: Full=Cytochrome c oxidase subunit 3;       
   90::265     8e-06  27%  269 aa  COX3_CANPA RecName: Full=Cytochrome c oxidase subunit 3;       
  195::255     8e-06  30%  259 aa  COX3_ALBCO RecName: Full=Cytochrome c oxidase subunit 3;       
  207::267     1e-05  28%  272 aa  COX3_CHOCR RecName: Full=Cytochrome c oxidase subunit 3;       
  205::266     1e-05  26%  269 aa  COX3_SCHPO RecName: Full=Cytochrome c oxidase subunit 3;       
  141::202     1e-05  26%  206 aa  COX3_BACPF RecName: Full=Cytochrome c oxidase subunit 3;       
  197::257     2e-05  28%  262 aa  COX3_PROWI RecName: Full=Cytochrome c oxidase subunit 3;       
   90::265     2e-05  24%  269 aa  COX3_PICCA RecName: Full=Cytochrome c oxidase subunit 3;       
  205::265     2e-05  30%  269 aa  COX3_TRIRU RecName: Full=Cytochrome c oxidase subunit 3;       
  125::190     3e-05  26%  194 aa  CYOC_BUCBP RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; 
  197::257     4e-05  31%  261 aa  COX3_PARLI RecName: Full=Cytochrome c oxidase subunit 3;       
   85::260     4e-05  24%  265 aa  COX3_HELAN RecName: Full=Cytochrome c oxidase subunit 3;       
   29::201     5e-05  35%  205 aa  CYOC_BUCAI RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; 
  196::256     5e-05  30%  260 aa  COX3_PISOC RecName: Full=Cytochrome c oxidase subunit 3;       
   83::143     7e-05  30%  147 aa  COX3_SPOFR RecName: Full=Cytochrome c oxidase subunit 3;       
  135::260     9e-05  33%  265 aa  COX3_ORYSI RecName: Full=Cytochrome c oxidase subunit 3;       
  135::260     9e-05  24%  265 aa  COX3_AEGCO RecName: Full=Cytochrome c oxidase subunit 3;       
  233::264     3e-04  44%  268 aa  COX3_YARLI RecName: Full=Cytochrome c oxidase subunit 3;       
  135::260     5e-04  32%  265 aa  COX3_MAIZE RecName: Full=Cytochrome c oxidase subunit 3;       
  242::271     8e-04  43%  275 aa  COX3_USTMA RecName: Full=Cytochrome c oxidase subunit 3;       
  411::430     8e-04  70%  435 aa  COX3_DICDI RecName: Full=Cytochrome c oxidase subunit 3;       
  407::426     8e-04  70%  431 aa  COX3_DICCI RecName: Full=Cytochrome c oxidase subunit 3;       
    1::214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxTAVAEQFDDPEQEYHAATLGMWVFLATEVLFFGVLFASYAVSRFNYPEAFAEASRHTDIVLGTIS
QOX3_BACSU      -----------------EYQSETLGFWIFLGAEIVLFSTLFATFFVLK-NRTAGGVLPDELFEVNLVMIM
COX3_CORGL      ----------------------SVGTIVFLSQELMFFAGLFAMYFVSRANANGSWGEQTDHLNVPYALLI
AOX1_AERPE      ---------EHWPFPKDKIRSA---MWVFIASEVATFGSIFSAYFFIRFNLTEAWPPGYLVHDVNVGLIN
COX3_MYCPA      ----------------------SVGTIVWLSSELMFFAGLFAMYFTARAQSGGKWPPPPTELNLYQAVPV
COX3_NOCFA      ----------------------SVGTIIWLSSELMFFAGLFAMYFVARAQANGNWPPEPTELNLKLAVPV
COX3_COREF      ----------------------SVGTIVFLSQELMFFAGLFAMYFVSRANANGSWAEQTDYLNVPYALAI
COX3_GADMO      ------------------------GMILFITSEVFFFGFFWAFYHASLAPTPELGGGITTLDPFEVPLLN
CYOC_PSEAE      ------------------------GFWLYLMTDCVLFASVFATYAVL-VHHTAGGPSGKDIFELPYVLVE
COX3_ONCMY      ------------------------GMILFITSEVFFFGFFWAFYHASLAPTPELGAGITTLDPFEVPLLN
COX3_MYCLE      ----------------------SVGTVVWLSSELMFFAGLFAMYFTARAQAGGKWPP-STELNLYQAVPV
COX3_LATCH      ------------------------GMILFITSEVFFFGFFWAFYHSSLAPTPELGGGITPLDPFEVPLLN
COX3_TETNG      ------------------------GMILFITSEVFFFGFFWAFYHSSLAPTPE-LGGCWPPTGIVVPLLN
COX3_BALMU      ----------------QGHHTPTVGMILFIVSEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_SALSA      ------------------------GMILFITSEVFFFGFFWAFYHSSLSPTPE-LGGCWPPTGIIVPLLN
COX3_PIG        ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_ONCNE      ------------------------GMILFITSEVFFFGFFWAFYHASLAPTPELGGGITTLDPFEVPLLN
COX3_ONCMA      ------------------------GMILFITSEVFFFGFFWAFYHASLAPTPELGGGITTLDPFEVPLLN
COX3_ONCCL      ------------------------GMILFITSEVFFFGFFWAFYHASLAPTPELGGGITTLDPFEVPLLN
COX3_HORSE      ------------------------GMILFIISEVFFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_EQUAS      ------------------------GMILFIISEVFFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_BOVIN      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_BOSIN      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_MADGU      ----------------QGHHTPTVGMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_OUROU      ----------------QGHHTPTVGMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_MAMPR      ------------------------GMILFITSEVLFFGFFWAFYHSSLAPTPELGSYVYPLNPLEVPLLN
COX3_MACRO      ------------------------GMVLFIVSEVFFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_LOXAF      ------------------------GMILFITSEVLFFGFFWAFYHSSLAPTPELGSYVYPLNPLEVPLLN
COX3_CEPNA      ----------------QGHHTPTVGMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_AEPME      ----------------QGHHTPTVGMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
CYOC_PSEPU      -----------------------LGFWLYLMTDCILFASLFATYAV----LSGSFAGGPSGHDIFFVAVE
COX3_TRAST      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_TRASR      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_TRAOR      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_RHIUN      ------------------------GMILFIISEVFFFGFFWAFYHSSLAPTPECWPPTGIHNPMEVPLLN
COX3_RAPME      ----------------QGHHTPTVGMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_RAPCA      ----------------QGHHTPTVGMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_PELCP      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_NEOMO      ----------------QGHHTPTVGMILFIISEVLFFGFFWAFYHSSLAPTPELGGGISPLNPLEVPLLN
COX3_MYCTU      ----------------------SVGTIVWLSSELMFFAGLFAFYFSARANWPPPPTELNLYQAVPV----
COX3_MYCBO      ----------------------SVGTIVWLSSELMFFAGLFAFYFSARANWPPPPTELNLYQAVPV----
COX3_LITWA      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZTH      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZSP      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZSO      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZSA      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZRU      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZGR      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZGA      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZDO      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZDA      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZCU      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_GAZBE      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_ELEMA      ------------------------GMILFITSEVLFFGFFWAFYHSSLAPTPELGSYVYPLNPLEVPLLN
COX3_DAMLU      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_CERSI      ------------------------GMILFIISEVFFFGFFWAFYHSSLAPTPECWPPTGIHNPMEVPLLN
COX3_BALPH      ----------------QGHHTPTVGMILFIVSEVLFFGFFWAFYHSSLAPTPELGGGIRPLNPLEVPLLN
COX3_ANTMR      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_ANTCE      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_TRASP      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHPPLEVPLLN
COX3_TRAIM      ----------------QGHHTPTVGMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_DIDMA      ------------------------GMILFILSEVFFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_CYPCA      ------------------------GMILFITSEVFFFGFFWAFYHSSLAPTPE-LGGCWPPTGITVPLLN
COX3_CARAU      ------------------------GMILFITSEVFFFGFFWAFYHSSLAPTPE-LGGCWPPTGITVPLLN
COX3_SHEEP      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_CROLA      ------------------------GMILFITSEVFFFGFFWAFYHSSLAPTPE-LGGCWPPTGITVPLLN
COX3_BOSMU      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPECWPPTGIHNPLEVPLLN
COX3_SQUAC      ------------------------GMILFITSEVFFFGFFWAFYHSSLAPTPE-LGGCWPPTGIYVPLLN
COX3_ORNAN      ------------------------GMILFIISEVFFFGFFWAFYHSSLAPTPELGGGISPLNPLEVPLLN
COX3_PELSU      ------------------------GMILFITSEILFFTGFFWAFYHSSLSPTAELGNIWPPTGITVPLLN
COX3_DANRE      ------------------------GMILFITSEVFFFGFFWAFYHSSLAPTPELGGGLTTLDPFEVPLLN
CYOC_SHIFL      ------------------------GFWIYLMSDCILFSILFATYAVL-VNGTAGGPTGKDIFELPFVLVE
CYOC_ECOLI      ------------------------GFWIYLMSDCILFSILFATYAVL-VNGTAGGPTGKDIFELPFVLVE
CYOC_ECOL6      ------------------------GFWIYLMSDCILFSILFATYAVL-VNGTAGGPTGKDIFELPFVLVE
COX3_TACAC      ------------------------GMVLFIISEVFFFGFFWAFYHSSLAPTPELGGGISPLNPLEVPLLN
COX3_DINSE      ------------------------GMILFITSEVFFFGFFWALYHVSLVPTPELGAEITPLNPMEVPLLN
COX3_SCYCA      ------------------------GMILFIVSEVFFFGFFWAFYHSSLAPTPELGGGINPLDPFEVPLLN
COX3_HIPAM      ------------------------GMVLFIISEVLFFGFFWAFYHSSLAPTPELGGGIXXXXXXXXXXXX
COX3_SYNCA      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPELGGGIXXXXXXXXXXXX
COX3_GAZSU      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPELGGGIXXXXXXXXXXXX
COX3_GAZLE      ------------------------GMILFIISEVLFFGFFWAFYHSSLAPTPELGGGIXXXXXXXXXXXX
COX3_XENLA      ------------------------GMILFITSEVFFFIGFFWAFYNSSLAPTYELGECWPPTGITVPLLN
COX3_DUGDU      --------------------------------------------------------------------LN
COX3_FELCA      --------------------------------------------------------------------LN
COX3_POLOR      ------------------------GMILFITSEVFFFGFFWAFYHSSLAPTPELGGGITPLDPFEVPLLN
COX3_COTJA      --------------------------------------------------------------------LN
COX3_METSE      --------------------------------------------------------------------LN
COX3_PHOVI      --------------------------------------------------------------------LN
COX3_HALGR      --------------------------------------------------------------------LN
COX3_DASNO      ----------------------------------------------------------------------
COX3_THEVL      -----TAIA--VDHAHEHPDFRVLGLLVFLISESLMFGGLFAAYLLLRGMH-EQWPPEGTEVELFVPTIN
COX3_CANLU      --------------------------------------------------------------------LN
COX3_CANFA      --------------------------------------------------------------------LN
QOX3_STAS1      --------ANTIDQRSHEGNLNKLGFWVFLTAEXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
COX3_CHICK      --------------------------------------------------------------------LN
COX3_SOYBN      --------------------------------------------------------------------LN
COX3_STRCO      ----------------------SVGTIIWLSSEXXXXXXXXXXYFTLRVTGPDFWSEKADALNIPFSATN
COX3_STRAW      ----------------------SVGTIIWLSSEXXXXXXXXXXYFTLRVTGPEHWKEMASHLNFPFSATN
COX3_SACKL      -----------------------LGFLLFVVSEVLIFAGLFWAYFHSAMSWPPVGIEAVQPTELPL--LN
COX3_CANGA      -----------------------LGFLLFVLSEVLIFAGLFWAYFHSAMSWPPVGIQAVQPTELPL--LN
COX3_WHEAT      --------------------------------------------------------------------LN
COX3_KLULA      -----------------------LGFLLFVVSEILIFAALFWAYFHSAMSWPPVGIQAVQPTELPL--LN
COX3_YEAST      -----------------------LGFLMFVLSEVLIFAGLFWAYFHSAMSWPPVGIEAVQPTELPL--LN
COX3_RABIT      ----------------------------------------------------------------------
COX3_PETMA      ------------------------GMILFIISEVCFFGFFWAFYHASLAPTPELGLTINPLNPFEVPLLN
COX3_BRALA      --------------------------------------------------------------------LN
COX3_BRAFL      --------------------------------------------------------------------LN
COX3_ARATH      --------------------------------------------------------------------LN
QOX3_STAHJ      ------------DSRTHEGQLNKLGFWIFLTAEXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
COX3_RAT        ----------------------------------------------------------------------
COX3_STRCA      ----------------------------------------------------------------------
COX3_MOUSE      ----------------------------------------------------------------------
COX3_MAGGR      -----------------------LGVILFIVSEALFFMAIFWAFFHSALTWPPIGIEPINPFELPL--LN
COX3_APILI      ----------------------------------------------------------------------
QOX3_STAAW      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
QOX3_STAAS      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
QOX3_STAAR      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
QOX3_STAAN      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
QOX3_STAAM      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
QOX3_STAAC      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
QOX3_STAAB      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
QOX3_STAA8      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
QOX3_STAA3      ------------DSRTHEGELNKLGFWIFIXXXXXXXXXXXXXXXXXQHGGDYAGKMTTELFELPLVLIM
COX3_VANPO      -----------------------IGFLLFVLSEVLIFSALFWSYFHSAMSWPPVGITAVQPTELPL--LN
COX3_RHIST      -------------------------------------------------HWPPAGIETLNPWEVPL--LN
COX3_LEMCA      --------------------------------------------------------------------LN
QOX3_STAES      ----------------------------------------------------------------------
QOX3_STAEQ      ----------------------------------------------------------------------
COX3_GORGO      --------------------------------------------------------------------LN
COX3_SYNY3      ----------------------------------------------------------------------
COX3_PONPY      ----------------------------------------------------------------------
COX3_PONAB      ----------------------------------------------------------------------
COX3_PANPA      ----------------------------------------------------------------------
COX3_MYXGL      ------------------------GMILFIVSEVFFFGFFWTFYHSSLSPSPDLGMMWPPKGVIPLDPLN
COX3_HUMAN      ----------------------------------------------------------------------
COX3_LOCMI      ----------------------------------------------------------------------
COX3_HYLLA      ----------------------------------------------------------------------
COX3_DROME      ----------------------------------------------------------------------
COX3_PAPHA      --------------------------------------------------------------------LN
COX3_BACP3      ----------------------------------------------------------------------
COX3_ASHGO      -----------------------LGFTLFVVSEVLIFASLFWAYFHSAMSWPPVGIEAVQPTELPL--LN
COX3_PANTR      ----------------------------------------------------------------------
COX3_DROYA      ----------------------------------------------------------------------
COX3_RICCN      -----------------------IGMALFILTEIVXXGLLDGVWVVKQGIWPPPTIKTFEPFDIPF--IN
COX3_RHISA      ----------------------------------------------------------------------
COX3_CYACA      ----------------------------------------------------------------------
COX3_AEDAE      ----------------------------------------------------------------------
COX3_STRPU      --------------------------------------------------------------------LN
COX3_RICFE      -----------------------IGMALFILTEIVXXGLLDGVWVVKQGIWPPPTIKTFDPFDIPF--IN
COX3_RICBR      -------------------HGLRIGMALFILTEIMXXGLLDGVWVIKQGVWPPPNIKVFDPFDIPF--IN
COX3_OENBE      --------------------------------------------------------------------LN
COX3_NEUCR      -----------------------------------------------------------------LPLLN
COX3_MARPO      ----------------------------------------------------------------------
COX3_EMENI      -----------------------------------------------------------------LPLLN
COX3_ALLMA      -------------------YGITLGVVLFIVSEILLFFSLFWAFFHSSLTWPPVGIEPLNPFEVPL--LN
COX3_PODAN      -----------------------------------------------------------------LPLLN
COX3_MYTED      ----------------------------------------------------------------------
COX3_ANOGA      ----------------------------------------------------------------------
CYOC_BUCAP      ------------------------GLWIYLMSDCIIFAVLFAVYAIISSNFSTNLIN-HKIFNLSYVFLE
COX3_LOLBL      ----------------------------------------------------------------------
COX3_BACSU      ----------------------------------------------------------------------
COX3_ASTPE      ----------------------------------------------------------------------
COX3_ARTSF      ----------------------------------------------------------------------
COX3_ANOQU      ----------------------------------------------------------------------
COX3_VICFA      --------------------------------------------------------------------LN
COX3_ACACA      ----------------------------------------------------------------------
COX3_RICPR      ----------------------------------------------------------------------
COX3_PYLLI      -----------------------MGMILFIVSEIMXXXXXXXXXXTSSISPVFNIGGVWPPTDVVLPFLN
COX3_CANPA      ------------------------GFLLFVVSEILIFASLFWAYLHSAVNWPPVGIDVISPAELPL--LN
COX3_ALBCO      ----------------------------------------------------------------------
COX3_CHOCR      ----------------------------------------------------------------------
COX3_SCHPO      ----------------------------------------------------------------------
COX3_BACPF      ----------------------------------------------------------------------
COX3_PROWI      ----------------------------------------------------------------------
COX3_PICCA      ------------------------GFLLFVVSEILIFAGIFWAYFHSAMSWPPVGITAIGATELPL--LN
COX3_TRIRU      ----------------------------------------------------------------------
CYOC_BUCBP      ----------------------------------------------------------------------
COX3_PARLI      ----------------------------------------------------------------------
COX3_HELAN      ------------------------GFILFIVSEVMFLFALFRASSHSSLAPPKGIAVLDPRE---IPFLN
CYOC_BUCAI      ------------------------GLWIYLMSDCIMFAVLFAVYAXXXXXXXXXXXXXXXXXXXXXXXXX
COX3_PISOC      ----------------------------------------------------------------------
COX3_SPOFR      ----------------------------------------------------------------------
COX3_ORYSI      --------------------------------------------------------------------LN
COX3_AEGCO      --------------------------------------------------------------------LN
COX3_YARLI      ----------------------------------------------------------------------
COX3_MAIZE      --------------------------------------------------------------------LN
COX3_USTMA      ----------------------------------------------------------------------
COX3_DICDI      ----------------------------------------------------------------------
COX3_DICCI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TGVLLTSGFTMALAVRSAKLGRDKAIIGXXXXXXXXXXXXXXXEGTEYYQAYGEQLIPAFNFMYEGAHEK
QOX3_BACSU      TFLLLISSFTCGIAVHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFV-----------HYVHEGA-AL
COX3_CORGL      TVILVSSSVTCQFGVFAAERGDVYGLRKWFLVTIILGSIFVIGQGYEYITLVGHGLTIQSS-VYGSA---
AOX1_AERPE      TIILFTGTMLFTLAYLGVK--RDNYLITLSGLLGTLFMAIYFL--TVKYFEWKELLIAGLGL--------
COX3_MYCPA      TLVLIASSFTCQMGVFAAERGDVFGLRRWYVITFLMGLFFVLGQGYEYYHLMGH------------GTTI
COX3_NOCFA      TAVLVASSFTCQMGVFAAEKGDVFGLRRWYFITLLMGAFFVAGQGYEYY-----------HLVHEGTSIS
COX3_COREF      TVILVSSSVTCQFGVFAAERGDVYGLRKWFLITIILGSIFVIGQAYEYFTLVGHGL-SIQSSVYGSA---
COX3_GADMO      TAVLLASGVTVTWAHHSIMEGERKQAIHSLTLTILLGFYFTFLQGLEYYDA-------PFTIA-DGVYGS
CYOC_PSEAE      TAILLVSSCTYGLAMLSAHKGAKGQAIAWLGVTFLLGAAFIGMEINEFHHLIAEGFGPSRS---------
COX3_ONCMY      TAVLLASGVTVTWAHHSIMEGERKXXXXXXXXXXXXGFYFTFLQGMEYYEA-------PFTIA-DGVYGS
COX3_MYCLE      TLVLIASSFTCQMGVFSAERGDVFGLRRWYVITLLMGLFFVLGQGYEYYHTHGTTI--------------
COX3_LATCH      TAVLLASGITVTWAHHSLMEGQRKEAIQSLFITVLLGLYFTALQATEYYES-------PFTIA-DGAYGS
COX3_TETNG      TAVLLASGVTVTWAHHSIMEGERKQAIHSLTLTILLGFYFTFLQAMEYYEA-------PFTIA-DGVYGS
COX3_BALMU      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITIALGLYFTLLQASEYYEA---------PFTISDG---
COX3_SALSA      TAVLLASGVTVTWAHHSIMEGERKXXXXXXXXXXXXGFYFTFLQGMEYYEA-------PFTIA-DGVYGS
COX3_PIG        TSILLASGVSITWAHHSLMEGDRKHMIQALSITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_ONCNE      TAVLLASGVTVTWAHHSIMEGERKXXXXXXXXXXXXGFYFTFLQGMEYYEA-------PFTIA-DGVYGS
COX3_ONCMA      TAVLLASGVTVTWAHHSIMEGERKXXXXXXXXXXXXGFYFTFLQGMEYYEA-------PFTIA-DGVYGS
COX3_ONCCL      TAVLLASGVTVTWAHHSIMEGERKXXXXXXXXXXXXGFYFTFLQGMEYYEA-------PFTIA-DGVYGS
COX3_HORSE      TSVLLASGVSITWAHHSLMEGNRKNMLQGLFITISLGVYFTLLQASEYYEA---------SFTISDG---
COX3_EQUAS      TSVLLASGVSITWAHHSLMEGNRKNMLQGLFITISLGVYFTLLQASEYYEA---------SFTISDG---
COX3_BOVIN      TSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_BOSIN      TSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGIYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_MADGU      TSVLLASGVSITWAHHSLMEGNRNPMLQALFITIALGIYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_OUROU      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_MAMPR      TSVLLASGVTITWAHHSLMEGNRKNMLQALLITILLGVYFTLLQMFEYYEA---------SFTISDG---
COX3_MACRO      TSILLASGVSITWAHHSLMEGNRKQMIQALSITILLGIYFTILQASEYYES---------SFTISDG---
COX3_LOXAF      TSVLLASGVTITWAHHSLMEGNRKNMLQALLITILLGVYFTLLQMFEYYEA---------SFTISDG---
COX3_CEPNA      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_AEPME      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
CYOC_PSEPU      TLFLLLSSITFGFAMLKMFDGKKAGVLGWLAVTFLFGAGFIAMEIYEFHHLIAEGFGPQRSGFLSG----
COX3_TRAST      TSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_TRASR      TSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_TRAOR      TSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_RHIUN      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITISLGIYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_RAPME      TSVLLASGVSITWAHHSLMEGNRYPMLQALFITIALGVYFTLLQASEYYEA---------PFTISDG---
COX3_RAPCA      TSVLLASGVSITWAHHSLMEGNRYPMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_PELCP      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_NEOMO      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA---------PFTISDG---
COX3_MYCTU      TLVLIASSFTCQMGVFAAERGDIFGLRRWYVITFLMGLFFVLGQAYEYR-----------NLMSHGT-SI
COX3_MYCBO      TLVLIASSFTCQMGVFAAERGDIFGLRRWYVITFLMGLFFVLGQAYEYR-----------NLMSHGT-SI
COX3_LITWA      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZTH      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZSP      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZSO      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZSA      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZRU      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZGR      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZGA      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZDO      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZDA      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZCU      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZBE      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_ELEMA      TSVLLASGVTITWAHHSLMEGSRKNMLQALLITILLGVYFTLLQMFEYYEA---------SFTISDG---
COX3_DAMLU      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_CERSI      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITISLGVYFTLLQASEYYEA---------PFTISDG---
COX3_BALPH      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITIALGLYFTLLQASEYYEA---------PFTISDG---
COX3_ANTMR      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITISLGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_ANTCE      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_TRASP      TSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_TRAIM      TSVLLASGVSITWAHHSLMEGDRNHMLQALFITIALGIYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_DIDMA      TSILLASGVSITWAHHSLMEGNRKQMIQALLITISLGLYFTILQAMEYYEA---------SFTISDG---
COX3_CYPCA      TAVLLASGVTVTWAHHSIMEGERKQAIQSLALTILLGLYFTALQAMEYYEA-------PFTIA-DGVYGS
COX3_CARAU      TAVLLASGVTVTWAHHSIMEGERKQAIQSLALTILLGFYFTALQAMEYYEA-------PFTIA-DGVYGS
COX3_SHEEP      TSVLLASGVSITWAHHSLMEGNRYHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_CROLA      TAVLLASGVTVTWAHHSLMEGARKQAIQALALTIILGVYFTALQAMEYYEA-------PFTIA-DGVYGS
COX3_BOSMU      TSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_SQUAC      TAVLLASGVTVTWAHHSLMEGNRKEAIQALTLTVLLGFYFTALQAMEYYEA-------PFTIA-DGVYGS
COX3_ORNAN      TSILLASGVSITWAHHSLMEGNRKQMLQALTITIALGLYFTALQAMEYYEA---------SFTISDG---
COX3_PELSU      TAVLLASGVTITWAHHSLMEGNRPXXXXXXXXXXXXXXYFTILQAMEYFEA---------SFTIADS---
COX3_DANRE      TAVLLASGVTVTWAHHSLMEGERKQAIQSLALTILLGLYFTALQAMEYYEA-------PFTIA-DGVYGS
CYOC_SHIFL      TFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFI---GMEIYE---------FHHLIVNGMGP
CYOC_ECOLI      TFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFI---GMEIYE---------FHHLIVNGMGP
CYOC_ECOL6      TFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFI---GMEIYE---------FHHLIVNGMGP
COX3_TACAC      TSILLASGVSITWSHHSLMEGNRKQMIQALMITIALGLYFTALQAMEYYES---------SFTISDG---
COX3_DINSE      TAVLLSSGATITWSHHTMMKGNKKEATHALMLTIILGAYFTALQLSEYM---------------ETPFTI
COX3_SCYCA      TAVLLASGVTVTWAHHGLMEGNRKEAIQALTLTIILGVYFTALQAMEYYEA-------PFTIA-DGVYGT
COX3_HIPAM      TSVLLASGVSITWAHHSLMEGNRKQMLQALFITIALGVYFTLLQASEYHEA---------SFTISDG---
COX3_SYNCA      TSVLLASGVSITWAHHSLMEGNRSHMLQALFITITLGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZSU      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_GAZLE      TSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEYYEA-------PFTIS-DGVYGS
COX3_XENLA      TAVLLASGVTVTWAHHSIMHGDRKEAIQSLTLTILLGLYFTALQAMEYYEA-------PFTIA-DGVYGS
COX3_DUGDU      TSVLLASGVTITWAHHSLMEGNRKQMLQALFITISLGIYFTLLQASEYHEA---------SFSISDG---
COX3_FELCA      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITISLGVYFTLLQASEYYET---------SFTISDG---
COX3_POLOR      TAVLLASGVTVTWTHHSLMEGKRTEATQALTLTILLGLYFTALQAMEYYEA-------PFTIA-DGVYGT
COX3_COTJA      TAILLASGVTVTWAHHSITEGNRKQAIHALTLTILLGFYFTALQAMEYHEA---------------SFSI
COX3_METSE      TAVLLSSGATVTWAHHALISGKKTEAINGLTITVVLGLIFTGLQAMEYYEA---------PFAISDS---
COX3_PHOVI      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITISLGIYFTLLQASEYYET---------PFTISDG---
COX3_HALGR      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITISLGVYFTLLQASEYYET---------PFTISDG---
COX3_DASNO      TSVLLASGVSITWAHHSLMEGHRKHMLQALFITIALGVYFTLLQASEYYEA---------PFTISDG---
COX3_THEVL      TLILISSSFVIHYGDVAIKKDDVRGMRKWYWITAAMGAVFLGGQVYEYLTGYGLR---------------
COX3_CANLU      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITISLGVYFTLLQASEYYET---------SFTISDG---
COX3_CANFA      TSVLLASGVSITWAHHSLMEGNRKHMLQALFITISLGVYFTLLQASEYYET---------SFTISDG---
QOX3_STAS1      TFALLISSYTCGIAIYYMRKEKEKLML---IWMIITVLLGMVFVGFEIYEFA--------HYVHEGVN-L
COX3_CHICK      TAILLASGVTVTWAHHSITEGNRKQAIHALTLTILLGFYFTALQAMEYHEA---------------SFSI
COX3_SOYBN      TPILLSSGAAVTWAHHAILAGKEKRAVYALVATVSLALVFTGFQGMEYYQA---------PFTISDS---
COX3_STRCO      TTILVLSSLTCQLGVFAAERGDVKKLRMWFIVTFVMGAIFIGGQVFEYTELVKHEGISLSSDPYGSA---
COX3_STRAW      TTILVLSSLTCQLGVFAAERGDVKKLRMWFIVTFIMGAIFIGGQVFEYTELVKKDGLSLSSDPYGS----
COX3_SACKL      TIILLASGATVTYSHHALIQGNRKDALSGLFITTWLIIIFVICQYIEYTNA---------TFTISDG---
COX3_CANGA      TIILLSSGATITYSHHALICNRNKALSGLFITIWLIIIFV-----TCQYIEYTNAAFTISDGVYGS----
COX3_WHEAT      TLILLSSGAAVTWAHHAILAGKEKRXXXXXXXXXXXXXXFTGFQGMEYYQA---------PFTISDS---
COX3_KLULA      TIILLSSGATITYSHHGLVGGNRKNALSGLLITFWLIVIFVTCQYIEYTNA-------TFTIT-DGVYGS
COX3_YEAST      TIILLSSGATVTYSHHALIAGRNKALSGLLITFWLIVIFV-----TCQYIEYTNAAFTISDGVYGS----
COX3_RABIT      TSVLLASGVSITWAHHSLMEGNRKNMQQALAITILLGIYFTLLQASEYYET---------SFTISDG---
COX3_PETMA      TAVLLASGVSVTWAHHSITEKNRTETTQALTLTVLLGLYFTALQIMEYYET-------PFT-MADGVYGS
COX3_BRALA      TAVLLSSGVTVTWAHHALMEGKRTEAIQSLAITVMLGLYFTGLQAWEYYEA---------------PFTI
COX3_BRAFL      TAVLLSSGVTVTWAHHALMEGKRTEAIQSLAITVMLGLYFTGLQAWEYYEA---------------PFTI
COX3_ARATH      TLILLSSGAAVTWAHHAILAGKEKRXXXXXXXXXXXXXXFTGFQGMEYYQA---------PFTISDS---
QOX3_STAHJ      TFALLISSYTCGISIYYMRKEKQNLMMFWMILTXXXXXXXXXXEIYEFAHYVSEGVTPQIGSYWSS----
COX3_RAT        ----------------------------------------------------------------------
COX3_STRCA      TAILLASGVTVTWAHHSITESNRKQAIHALSLTIILGFYFTALQAMEYHEA-------SFSIA-DGVYGS
COX3_MOUSE      ----------------------------------------------------------------------
COX3_MAGGR      TVILLSSGATVTYAHHSI-IGRNRALYGSVATVLLAIVFTGF-QGVEYS-------VSSFTIS-DGA---
COX3_APILI      ----------------------------------------------------------------------
QOX3_STAAW      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
QOX3_STAAS      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
QOX3_STAAR      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
QOX3_STAAN      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
QOX3_STAAM      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
QOX3_STAAC      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
QOX3_STAAB      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
QOX3_STAA8      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
QOX3_STAA3      TFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSS----
COX3_VANPO      TIILLASGATVTYSHHALIQGNRKNSLSGLLITTWLIIIFVICQYIEYTNA---------TFTISDG---
COX3_RHIST      TVILLSSGATVTYAHHANPSNRAGVIYGLIATIVLATVFTGF-QGFEYYNA-------PFTFS-DGVYGS
COX3_LEMCA      TAVLLASGVSITWAHHSLMEGNRVQMLQALLITITLGLYFTLLQASEYFET---------SFTISDG---
QOX3_STAES      --------------------------------------------------------------IYEFAHNP
QOX3_STAEQ      --------------------------------------------------------------IYEFAHNP
COX3_GORGO      TSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASEYFEA---------PFTISDG---
COX3_SYNY3      --------------------------------------------------------------MYEYFHLE
COX3_PONPY      ----------------------------------------------------------------------
COX3_PONAB      ----------------------------------------------------------------------
COX3_PANPA      ----------------------------------------------------------------------
COX3_MYXGL      TAILLGSGVSVTWAHHSLMEKTHKDMVISLSITIILGIYFTLLQGMEYFNS-------TFNISDNA----
COX3_HUMAN      ----------------------------------------------------------------------
COX3_LOCMI      ----------------------------------------------------------------------
COX3_HYLLA      ----------------------------------------------------------------------
COX3_DROME      ----------------------------------------------------------------------
COX3_PAPHA      TSVLLASGVTITWAHHSLMNGNRKXXXXXXXXXXXXGTYFTLVQISEYFEA---------PFTISDG---
COX3_BACP3      -------------------------------------------------------------YVHEG-HKF
COX3_ASHGO      TIILLASGTTITYSHHGLIEGNRKHALSGLTITFWLIVTFVLCQYIEYSNT---------SFTITDG---
COX3_PANTR      ----------------------------------------------------------------------
COX3_DROYA      ----------------------------------------------------------------------
COX3_RICCN      TLILLLSGTTVTWAHYALEEKNQKDCVTALALTILLGIFFTTMQAYEYYHA-------AFKFT-DGIYAS
COX3_RHISA      ----------------------------------------------------------------------
COX3_CYACA      ----------------------------------------------------------------------
COX3_AEDAE      ----------------------------------------------------------------------
COX3_STRPU      TGVLLSSGVTLSWSHHSILAGNRTESIQALFLTVALGSYFTALQAWEYIDA---------------PFTI
COX3_RICFE      TLILLLSGTTVTWAHYALEEKNQKDCVTALALTILLGIFFTTMQAYEYYHA-------AFKFT-DGIYAS
COX3_RICBR      TLILLLSGTTVTWAHYALEERNQKDCVTALGLTIILGIFFTCMQAYEYYHA-------AFKFT-DGIYPS
COX3_OENBE      TPILLSSGAAVTWAHHAILAGKEKRAVYALVATVSLAIVFTGFQGMEYYQAP-----PTISDSIYGS---
COX3_NEUCR      TVILLSSGATITYAHHALIKGEREGALYGSIATILLAIIFTGFQGVEYS-------VSSFTIS-DGA---
COX3_MARPO      ----------------------------------------------------------------------
COX3_EMENI      TIILLSSGVTITYAHHSLIQGNRKGALYGTVVTILLAIVFTFFQGVEY-------TVSSFTISDS-----
COX3_ALLMA      TIILLTSGCTITVSHAKIISGDRGAXXXXXXXXXXXAWMFLGLQWVEYVNA---------------PFTI
COX3_PODAN      TVILLSSGATVTYAHHSLIHGERKGALYGSIITILLAIIFTVFQGVEYN-------VSSFTIS-DGA---
COX3_MYTED      ----------------------------------------------------------------------
COX3_ANOGA      ----------------------------------------------------------------------
CYOC_BUCAP      TLIXXXXXXXXGMLTIQXXXXXXXXXYXXXXXXXXXXXXXXXMEVNEFYKLILENCSPSQH---------
COX3_LOLBL      ----------------------------------------------------------------------
COX3_BACSU      ----------------------------------------------------------------------
COX3_ASTPE      ----------------------------------------------------------------------
COX3_ARTSF      ----------------------------------------------------------------------
COX3_ANOQU      ----------------------------------------------------------------------
COX3_VICFA      TPILLSSGAAVTWAHHAILAGKEKRAVYALVATVSLALVFTGFQGMEYYQA---------PFTISDS---
COX3_ACACA      --------------------------------------------GLEFTVWQGYEYYKASFYIYDGVYGS
COX3_RICPR      ----------------------------------------------------------------------
COX3_PYLLI      TILLLSSGASVTWAHHAIVGGLKKEAMQGLSVTLAFAIAFTAMQGFEYSGAFG---------MSDGVYGS
COX3_CANPA      TIILLASGVTITYA-HHALINGNRA-------------------NTLYGFIYSTLLIALF-VMFQFLEYK
COX3_ALBCO      ----------------------------------------------------------------------
COX3_CHOCR      ----------------------------------------------------------------------
COX3_SCHPO      ----------------------------------------------------------------------
COX3_BACPF      ----------------------------------------------------------------------
COX3_PROWI      ----------------------------------------------------------------------
COX3_PICCA      TIILLASGATITYSHHATIEGNRNHALNGLFITLWLIVIFVVCQYIEYTNA-------PFTIS-DGVYGS
COX3_TRIRU      ----------------------------------------------------------------------
CYOC_BUCBP      ----------------------------------------------------------------------
COX3_PARLI      ----------------------------------------------------------------------
COX3_HELAN      TPIPLSSGAAVTWAHHAILAGKEKRAVYALVATVSLALVFTAFQGMEYYQA---------------PSTI
CYOC_BUCAI      XXXXXXXXXC-GFVVIAMNQKRIKMIYSXXXXXXXXXXXXXXMEVHEFYELIIENFGPDKN---------
COX3_PISOC      ----------------------------------------------------------------------
COX3_SPOFR      ----------------------------------------------------------------------
COX3_ORYSI      TPILPSSGAAVTWAHHAILAGKEKRXXXXXXXXXXXXXXSTGFQGMEYYQA---------------PSTI
COX3_AEGCO      TPILPSSGAAVTWAHHAILAGKEKRAVYALVATVSLALVSTGFQGMEYYQA---------------PSTI
COX3_YARLI      ----------------------------------------------------------------------
COX3_MAIZE      TPILPSSGAAVTWAHHAILAGKEKRXXXXXXXXXXXXXXSTGFQGMEYYQA---------------PSTI
COX3_USTMA      ----------------------------------------------------------------------
COX3_DICDI      ----------------------------------------------------------------------
COX3_DICCI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PVELFFFLYFLMTGMHAVHVTXXXXXXXXXXXXXXRRRFTSYYYTPVELTGLYWAFVDIVWIFLYPLFYL
QOX3_BACSU      STSAFWSGFFVLLGTHGTHVTIGIFWITGILIQLKKRGLTPQTSSKIFISSLYWHFLDVVWIFIFTGVYL
COX3_CORGL      --------FFITTGFHALHVIAGVMAFVVVLMRIHKSKFTPAQATAAMVVSYYWHFVDVVWIGLFITIYF
AOX1_AERPE      DAGMYMQAYYVTTGAHALHVILGVLATTYLLVKLFNGNLRGRQLSEVLAVGIYWGIVEIVWTLVFPLYYL
COX3_MYCPA      PGSAYGSVFYLATGFHDLHVTGGLVAFIFLLARTAMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
COX3_NOCFA      S-SAYGSVFYITTGFHGLHVIGGLIAFVFLLIRTKVSKFTPAQATAAIVVSYYWHFVDIVWIGLFATIYF
COX3_COREF      --------FYITTGFHAAHVIAGVIAFVVVLMRIQKAKFTPAQATAAMVVSYYWHFVDVVWIGLFITIYF
COX3_GADMO      T-------FFVATGFHGLHVIIGSTFLAVCLLRQIRYHFTSEHHFGFEAAAWYWHFVDVVWLFLYISIY-
CYOC_PSEAE      ---AFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSLFWHFLDIVWICVFTVVYL
COX3_ONCMY      T-------FFVATGFHGLHVIIGSTFLAVCLLRQVQYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_MYCLE      PSSAYGSVFYLATGFHGLHVTGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
COX3_LATCH      T-------FFVATGFHGLHVIIGSTFLIVCLVRQTQYHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_TETNG      T-------FFVATGFHGLHVIIGSTFLAICLLRQIRYHFTSEHHFGFEAAAWYWHFVDVVWLFLYISIY-
COX3_BALMU      ---IYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFERAAWYWHFVDVVWLFLYVSIY-
COX3_SALSA      T-------FFVATGFHGLHVIIGSTFLAICLLRQIQYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_PIG        T-------FFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_ONCNE      T-------FFVATGFHGLHVIIGSTFLAVCLLRQVQYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_ONCMA      T-------FFVATGFHGLHVIIGSTFLAVCLLRQVQYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_ONCCL      T-------FFVATGFHGLHVIIGSTFLAVCLLRQVQYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_HORSE      ---VYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_EQUAS      ---VYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_BOVIN      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_BOSIN      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_MADGU      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_OUROU      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_MAMPR      ---IYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYLSIY-
COX3_MACRO      ---VYGSTFFVATGFHGLHVIIGTTFLIVCLLRQFNFHFTSTHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_LOXAF      ---IYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYLSIY-
COX3_CEPNA      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_AEPME      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
CYOC_PSEPU      --------FFALVGTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYL
COX3_TRAST      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_TRASR      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_TRAOR      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_RHIUN      T-------FFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_RAPME      ---IYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_RAPCA      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_PELCP      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_NEOMO      ---IYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_MYCTU      PSSAYGSVFYLATGFHGLHVTGGLIAFIFLLVRTGMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
COX3_MYCBO      PSSAYGSVFYLATGFHGLHVTGGLIAFIFLLVRTGMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
COX3_LITWA      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZTH      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZSP      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZSO      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZSA      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZRU      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZGR      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZGA      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZDO      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZDA      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZCU      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZBE      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_ELEMA      ---IYGSTFFVTTGFHGLHVIIGSTFLLICFIRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYLSIY-
COX3_DAMLU      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSTHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_CERSI      ---IYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_BALPH      ---IYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFERAAWYWHFVDVVWLFLYVSIY-
COX3_ANTMR      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_ANTCE      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_TRASP      T-------FFVATGFHGLHVIIGTTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_TRAIM      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_DIDMA      ---VYGSTFFVATGFHGLHVIIGSTFLIVCLLRQLFYHFTSTHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_CYPCA      T-------FFVATGFHGLHVIIGSTFLAVCLLRQIQYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_CARAU      T-------FFVATGFHGLHVIIGSTFLAVCLLRQIQYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_SHEEP      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYMSIY-
COX3_CROLA      T-------FFVATGFHGLHVIIGSSFLAVCLLRQIQYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_BOSMU      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_SQUAC      T-------FFVATGFHGLHVIIGSTFLMVCLLRQIQYHFTSEHHFGFERAAWYWHFVDVVWLFLYVSIY-
COX3_ORNAN      ---VYGSTFFVATGFHGLHVIIGTTFLITCLVRQTLYHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_PELSU      ---IYGSTFFVATGFHGLHVIIGSTFLIVCLMRQLKYHFTSHHHFGFEAAAWYWHFVDVIWLFLYLSIY-
COX3_DANRE      T-------FFVATGFHGLHVIIGSTFLAVCLLRQVLFHFTSDHHFGFEAAAWYWHFVDVVWLFLYVSIY-
CYOC_SHIFL      DRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYL
CYOC_ECOLI      DRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYL
CYOC_ECOL6      DRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYL
COX3_TACAC      ---VYGSTFFVATGFHGLHVIIGTTFLITCLLRQLLYHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_DINSE      ADSVYGSLFFVATGFHGLHVMIGTSFLMVCALRLAKHHFTITHHFGYEAAIWYWHFVDIVWLFLYISVY-
COX3_SCYCA      T-------FFVATGFHGLHVIIGSTFLAVCLLRQVLYHFTSEHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_HIPAM      ---VYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSDHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_SYNCA      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZSU      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_GAZLE      T-------FFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_XENLA      T-------FFVATGFHGLHVIIGSLFLSVCLLRQIQYHFTSKHHFGFE-AAWYWHFVDVVWLFLYVSIY-
COX3_DUGDU      ---IYGSTFFMATGFHGLHVIIGSTFLAVCFLRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_FELCA      ---VYGSTFFMATGFHGLHVIIGSTFLIVCFLRQLKYHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_POLOR      T-------FFVATGFHGLHVIIGSTFLAGCLLRQILYHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_COTJA      ADSVYGSTFFVATGFHGLHVIIGSSFLTICLLRLIKFHFTSNHHFGFEAAAWYWHFVDIIWLFLYMSMY-
COX3_METSE      ---VYGSTFFVATGFHGMHVIIGTTFLAVCLARLVYHQFTRHHHLGFEAASWYWHFVDVVWLFLYICIY-
COX3_PHOVI      ---IYGSTFFMATGFHGLHVIIGSTFLIVCFVRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_HALGR      ---IYGSTFFMATGFHGLHVIIGSTFLIVCFMRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_DASNO      ---IYGSTFFVATGFHGLHVIIGSSFLIVCFMRQLKFHFTSSHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_THEVL      -TNVFANCFYVMTGFXXXXXXXXXXXXXXXXWRSRRPHYNAQKHTGVAMAEIYWHFVDVIWIILFTLLYI
COX3_CANLU      ---VYGSTFFMATGFHGLHVIIGSTFLIVCFLRQLYYHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_CANFA      ---VYGSTFFMATGFHGLHVIIGSTFLIVCFLRQLYYHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
QOX3_STAS1      TIGSYWSSFFILLGTHGAHVSLGIVWIICLLIQVAMRGLNKDNAPKLFIVSLYWHFLDVVWIFIFTAVYM
COX3_CHICK      ADSVYGSTFFVATGFHGLHVIIGSSFLTVCLLRLIKFHFTPNHHFGFEAAAWYWHFVDIIWLFLYMSMY-
COX3_SOYBN      ---IYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWHFVDVVWLFLFVSIY-
COX3_STRCO      --------FYLTTGFHGLHVTGGLIAFLLVLGRTYARRFTHEQATAAIVVSYYWHFVDVVWIGLFATIYL
COX3_STRAW      -------VFYLTTGFHGLHVTGGLIAFLLVLGRTYARRFTHEQATAAIVVSYYWHFVDVVWIGLFATIYM
COX3_SACKL      ---VYGSVFYAGTGLHFLHMVMLATMLAINYWRLRNYHLTSSHHVGYETTVIYLHVLDIIWLFLYIVFY-
COX3_CANGA      -------VFYAGTGLHFLHMVMLAVMLIICYWRMRTYQFTSTHHVGFETTILYCHVLDIIWLFLYIVFY-
COX3_WHEAT      ---IYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGQMTKKHHVGFEAAAWYWHFVDVVWLFLFVSIY-
COX3_KLULA      -------VFYAGTGLHFLHMVMLAAMLGINYWRLRNYHLTATHHVGYETTVLYCHILDIIWLFLYIVFY-
COX3_YEAST      -------VFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFY-
COX3_RABIT      ---VYGSTFFMATGFHGLHVIIGSTFLTVCLLRQFNFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_PETMA      T-------FFVATGFHGLHVIIGSLFLLTCLLRHLQYHFTSKHHFGFEAAAWYWHFVDVVWLFLYISIY-
COX3_BRALA      ADSVYGSTFFVATGFHGLHVIIGSTFLMVCLGRQVFYHYTSSHHFGFEAAAWYWHFVDVVWLFLYVCIY-
COX3_BRAFL      ADSVYGSTFFVATGFHGLHVIIGSTFLMVCLGRQVFYHYTSSHHFGFEAAAWYWHFVDVVWLFLYVCIY-
COX3_ARATH      ---IYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWHFVDVVWLFLFVSIY-
QOX3_STAHJ      --------FFILLGTHGAHVSLGIGWIICLLIQVATRGLNKYNAPKLFIVSLYWHFLDVVWIFIFTAVYM
COX3_RAT        --------FFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_STRCA      T-------FFVATGFHGLHVIIGSSFLTVCLLRLIKFHFTTNHHFGFEAAAWYWHFVDVIWLFLYMSIY-
COX3_MOUSE      --------FFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVIWLFLYVSIY-
COX3_MAGGR      ----FGTCFYFGTGFHGLHVIIGTIFLLVALWRIFAYHLTDNHHLGFEAGILYWHFVDVVWLFLYISIY-
COX3_APILI      -------IFFMATGFHGLHVLIGSIFLLISLYRMMNIHFSNMHNMNFELAIWYWHFVDVIWLFLYTFIYL
QOX3_STAAW      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAAS      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAAR      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAAN      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAAM      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAAC      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAAB      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAA8      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAA3      --------FFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
COX3_VANPO      ---VYGSVFFAGTGLHFLHMVMLAIMLAVCYWRLRNYHLTNSHHVGYETTIIYLHVLDVIWLFLYIVFY-
COX3_RHIST      T-------FYMATGFHGIHVLVGTIFLTVGLFRVLSYHLTDHHHLGFEQAILYWHFVDVVWLFLFISVY-
COX3_LEMCA      ---VYGSTFFMATGFHGLHVIIGSTFLTVCFFRQLSFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIY-
QOX3_STAES      TIGSFWSSFFILLGTHGAHVSLGIVWVICLLIQIGTRGLDSYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
QOX3_STAEQ      TIGSFWSSFFILLGTHGAHVSLGIVWVICLLIQIGTRGLDSYNAPKLFIVSLYWHFLDVVWVFIFTAVYM
COX3_GORGO      ---IYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_SYNY3      TTNLFASCFYVLTGFHGLHVTFGLLLILSVLW---RSRQPGHYHFGVEAAELYWHFVDVVWIVLFILVYL
COX3_PONPY      --------FFMTTGFHGLHVIIGSTFLTVCLSCQLLFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_PONAB      --------FFMATGFHGLHVIIGSTFLTVCLARQLLFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_PANPA      --------FFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_MYXGL      ----YGSTFFVATGFHGGHVIIGTLFLTVCLLRQLMFHFTSSHHFGFEAAAWYWHFVDVVWLFLFISIY-
COX3_HUMAN      --------FFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_LOCMI      --------FFVATGFHGLHVIIGTTFLLTCLIRHMMNQFSSNHHFGFEAAAWYWHFVDVVWLFLYLSIY-
COX3_HYLLA      --------FFVATGFHGLHVIIGSTFLTICLIRQLLFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIY-
COX3_DROME      --------FFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIY-
COX3_PAPHA      ---IYGSTFFVATGFHGLHVIIGSTFLLICLIRQLFYHFTPSHHFGFEAAAWYWHFVDVIWLFLYISIY-
COX3_BACP3      TTSAFASAFYTLVGTHGSHVAFGLLWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWVFIFTVVYL
COX3_ASHGO      ---IYGSVFFAGTGLHFLHMVMLTIMLGINYWRMRNYHLTSTHHVGYETTTIYLHVLDIIWLALYICFY-
COX3_PANTR      --------FFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFQAAAWYWHFVDVVWLFLYVSIY-
COX3_DROYA      --------FYMATGFHGVHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIY-
COX3_RICCN      N-------FYLATGFHGAHVIIGTIFLIICYFRAKRGDFTTEGHLGFECAAWYWHFVDVVWLFLFTFVYI
COX3_RHISA      ---IFGSTFFMTTGFHGLHVLIGSIFLLVSYFRIKNQLISSDHFFGFEASAWYWHFVDVVWLFLFTFMY-
COX3_CYACA      --------FFMITGLHGFHVIVGTFFLFVCMFRLVQYHFTMQHHYGFEAATWYWHFVDVVWLFLFVSIY-
COX3_AEDAE      --------FFVATGFHGLHVLIGTSFLLICLFRHMNCHFSSSHHFGFEAAAWYWHFVDVVWLFLYISIY-
COX3_STRPU      ADSVYGSTFFVATGFHGLQVIIGTTFLMVCLFRTAGRHFSTHHHFGFEAAAWYWHFVDVVWFVLYWLIY-
COX3_RICFE      N-------FYLATGFHGAHVIIGTIFLIVCYFRAKRGDFTTEGHLGFEFAAWYWHFVDVVWLFLFTFVYI
COX3_RICBR      N-------FYLATGFHGAHVIIGTIFLIVCCFRARRGDFANNGHLGFEFAAWYWHFVDVVWLFLFTFVYI
COX3_OENBE      -------TFYLATGFHGFHVIIGTLFSIICGIRQYLGHLTKEHHVGFEAAAWYWHFVDVVRLFLFVSIY-
COX3_NEUCR      ----FGTCFFFSTGFHGIHVIIGTIFLAVALWRIFAYHLTDNHHVGFEGGILYWHFVDVVWLFLYISVY-
COX3_MARPO      --------FFLATGFHGFHVXXXXXXXXXXXXRQYLGHFTPKHHFGFEAAAFYWHFVDVVWLFLFVSIY-
COX3_EMENI      ---VYGSCFYFGTGFHGLHVIIGTAFLAVGLWRLAAYHLTDHHHLGYESGILYWHFVDVVWLFLYISVY-
COX3_ALLMA      ADSVYGSTFFVATGFHGLHVMIGTIFLTVSLNRILSYHLTSGHHLGYEAAIWYWHVVDVIWLFLYVSVY-
COX3_PODAN      ----FGTCFYFGTGFHGFHVIIGTIFLAVALWRIFAYHLTDNHHVGFEGGILYWHFVDVVWLFLYVSIY-
COX3_MYTED      -------VFYLLTGFHGMHVVVGTIWLMVSLVRLWRGEFSSQRHFGFEACIWYWHFVDVVWVALWCLVYV
COX3_ANOGA      --------FYMATGFHGLHVLIGTTFLLICFLRHINYHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIY-
CYOC_BUCAP      ---AFFSIFFTIVGVHGIHVFFGLIFILSILYQLFYLGITNTIRIRILCFSLFWHFLDIIWICVFTFVYL
COX3_LOLBL      --------FFVATGFHGLHVIIGSVFLLICLFRMLIHHFSTNHHFGFEAAAWYWHFVDVVWLILYTCIY-
COX3_BACSU      --------FYTLVGTHGAHVAFGLMWISTLMIRNAKRGLNLYTAPKFYVASLYWHFIDVVWVFIFTVVYL
COX3_ASTPE      --------FFVATGFHGLHVLIGTTFLFICFLRLITFHFSNNHHFGFEAAAWYWHFVDVVWLFLY-----
COX3_ARTSF      --------FFLATGFHGLHVLIGTIFLMICILRHAKCYFSQHHFG-FEAAAWYWHFVDVVWLFLYLSIY-
COX3_ANOQU      --------FYMATGFHGLHVLIGTTFLLICFLRHINFHFSKNHHFGFEAAAWYWHFVDVVWLFLYISIY-
COX3_VICFA      ---IYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGQMTKEHHVGFEAAAWYWHFVDVVRLFPFVSIY-
COX3_ACACA      T-------FYMTTGLHGLHVIIGTLFLIVCFFRLIDLHFIYNHHFGYEAAIWYWHFVDVVWIFLFLSIY-
COX3_RICPR      --------FYLATGFHGAHVVIGTIFLIVCYFRAKRGDFTTEGHLGFEFAAWYWHFVDVVWLFLFTFVYI
COX3_PYLLI      -------VFYMATGFHGFHVIIGTIFLFICTIRLYLSHFSCQHHFGFEAAAWYWHFVDVVWLFLFLTIY-
COX3_CANPA      YAGVYGSTFYSLTGLHGLHMIMLTIMLVICTWRVYNYDFTNTSHVGAETTILYLHVLDVIWLFIYIIVY-
COX3_ALBCO      --------FFMATGFHGLHVMVGTLFLFVNLVRTYYYHFSTTHHVGFLAAAWYWHFVDVVWLFLYISIY-
COX3_CHOCR      --------FYMATGFHGFHVLVGTISLAVCLIRLLQYQLTQQHHFGFESAAWYWHFVDVVWLFLFVSIY-
COX3_SCHPO      --------FYFATGLHGIHIIVGTILLLAATYNIYTYHLTNTHHNGFECGIYYWHFCDVVWLFLYLTIYI
COX3_BACPF      ---------YSLVGLHGAHVAFGLSWIIVLLIRYRKSGITLTNAPKFYVAGLYWHFIDVVWVFIFTVVYL
COX3_PROWI      --------FYLATGFHGFHVIIGTIFIAVCLFRLVLHHFSKSHHLGFEAAAWYWHMVDVVWLFLFVCIY-
COX3_PICCA      -------VFFAGTGLHFLHMGMLIIMLAVCYWRMRQYHFTTGHHVNYETTILYLHVLDVIWLFLYIVMY-
COX3_TRIRU      --------FYFSTGFHGFHVLIGTAFLSVGLWRLLGYHLTDHHHLGYESGILYWHFVDVVWLILYVCIY-
CYOC_BUCBP      ----FLSSFFVLIATHGIHVISGLIWIIVMIKYVYTFNITNLIYYRMLCLNLFWHFLDIVWVFIFSFVYL
COX3_PARLI      --------FFVATGFHGLHVIIGTTFLLVCLIRLXXXXXXXXXXXXXEAAAWYWHFVDVVWLFLYVCIY-
COX3_HELAN      SDSIYGSTFFLATGFHGFHVIIGTLFSIVCGIRQYLGHLTKEHHVGFEAAAWYWHFVDVVRLFPFVSIY-
CYOC_BUCAI      ---AFFSIFFTLVATHGVHXXXXXXXXXXXXYQIKKLGLTNSIRTRILCFSVFWHFLDIIWICVFTFVYL
COX3_PISOC      --------FFVATGFHGLHVLIGTAFLAVCLLRLYXXXXXXXXXXXXEAASWYWHFVDVVWLFLYICIY-
COX3_SPOFR      --------FFMATGFHGLHVIIGTLFLLICLIRHLXXXXXXXXXXGFEAAAWYWHFVDVVWLFLYISIY-
COX3_ORYSI      SDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWHFVDVVRLFPFVSIY-
COX3_AEGCO      SDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGLMTKKHHVGFEAAAWYWHFVDVVRLFPFVSIY-
COX3_YARLI      -------------------------------------QLTNNHHVGYETSILYYHFVDVVWLFLYIVFY-
COX3_MAIZE      SDSIYGSTFLLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWHFVDVVRLFPFVSIY-
COX3_USTMA      ---------------------------------------TDHHHLGFEASILYWHFVDVVWLFLFISVY-
COX3_DICDI      -------------------------------------------------TLFYWHFVDIVWIFLYIVIY-
COX3_DICCI      -------------------------------------------------TLFYWHFVDIVWIFLYIVIY-


                         .         .         .         +         .         .         .:280
query           VARx
QOX3_BACSU      M---
COX3_CORGL      I---
AOX1_AERPE      V---
COX3_MYCPA      I---
COX3_NOCFA      V---
COX3_COREF      I---
COX3_GADMO      ----
CYOC_PSEAE      M---
COX3_ONCMY      ----
COX3_MYCLE      I---
COX3_LATCH      ----
COX3_TETNG      ----
COX3_BALMU      ----
COX3_SALSA      ----
COX3_PIG        ----
COX3_ONCNE      ----
COX3_ONCMA      ----
COX3_ONCCL      ----
COX3_HORSE      ----
COX3_EQUAS      ----
COX3_BOVIN      ----
COX3_BOSIN      ----
COX3_MADGU      ----
COX3_OUROU      ----
COX3_MAMPR      ----
COX3_MACRO      ----
COX3_LOXAF      ----
COX3_CEPNA      ----
COX3_AEPME      ----
CYOC_PSEPU      L---
COX3_TRAST      ----
COX3_TRASR      ----
COX3_TRAOR      ----
COX3_RHIUN      ----
COX3_RAPME      ----
COX3_RAPCA      ----
COX3_PELCP      ----
COX3_NEOMO      ----
COX3_MYCTU      I---
COX3_MYCBO      I---
COX3_LITWA      ----
COX3_GAZTH      ----
COX3_GAZSP      ----
COX3_GAZSO      ----
COX3_GAZSA      ----
COX3_GAZRU      ----
COX3_GAZGR      ----
COX3_GAZGA      ----
COX3_GAZDO      ----
COX3_GAZDA      ----
COX3_GAZCU      ----
COX3_GAZBE      ----
COX3_ELEMA      ----
COX3_DAMLU      ----
COX3_CERSI      ----
COX3_BALPH      ----
COX3_ANTMR      ----
COX3_ANTCE      ----
COX3_TRASP      ----
COX3_TRAIM      ----
COX3_DIDMA      ----
COX3_CYPCA      ----
COX3_CARAU      ----
COX3_SHEEP      ----
COX3_CROLA      ----
COX3_BOSMU      ----
COX3_SQUAC      ----
COX3_ORNAN      ----
COX3_PELSU      ----
COX3_DANRE      ----
CYOC_SHIFL      M---
CYOC_ECOLI      M---
CYOC_ECOL6      M---
COX3_TACAC      ----
COX3_DINSE      ----
COX3_SCYCA      ----
COX3_HIPAM      ----
COX3_SYNCA      ----
COX3_GAZSU      ----
COX3_GAZLE      ----
COX3_XENLA      ----
COX3_DUGDU      ----
COX3_FELCA      ----
COX3_POLOR      ----
COX3_COTJA      ----
COX3_METSE      ----
COX3_PHOVI      ----
COX3_HALGR      ----
COX3_DASNO      ----
COX3_THEVL      LTR-
COX3_CANLU      ----
COX3_CANFA      ----
QOX3_STAS1      I---
COX3_CHICK      ----
COX3_SOYBN      ----
COX3_STRCO      I---
COX3_STRAW      I---
COX3_SACKL      ----
COX3_CANGA      ----
COX3_WHEAT      ----
COX3_KLULA      ----
COX3_YEAST      ----
COX3_RABIT      ----
COX3_PETMA      ----
COX3_BRALA      ----
COX3_BRAFL      ----
COX3_ARATH      ----
QOX3_STAHJ      I---
COX3_RAT        ----
COX3_STRCA      ----
COX3_MOUSE      ----
COX3_MAGGR      ----
COX3_APILI      L---
QOX3_STAAW      I---
QOX3_STAAS      I---
QOX3_STAAR      I---
QOX3_STAAN      I---
QOX3_STAAM      I---
QOX3_STAAC      I---
QOX3_STAAB      I---
QOX3_STAA8      I---
QOX3_STAA3      I---
COX3_VANPO      ----
COX3_RHIST      ----
COX3_LEMCA      ----
QOX3_STAES      I---
QOX3_STAEQ      I---
COX3_GORGO      ----
COX3_SYNY3      L---
COX3_PONPY      ----
COX3_PONAB      ----
COX3_PANPA      ----
COX3_MYXGL      ----
COX3_HUMAN      ----
COX3_LOCMI      ----
COX3_HYLLA      ----
COX3_DROME      ----
COX3_PAPHA      ----
COX3_BACP3      M---
COX3_ASHGO      ----
COX3_PANTR      ----
COX3_DROYA      ----
COX3_RICCN      ----
COX3_RHISA      ----
COX3_CYACA      ----
COX3_AEDAE      ----
COX3_STRPU      ----
COX3_RICFE      ----
COX3_RICBR      ----
COX3_OENBE      ----
COX3_NEUCR      ----
COX3_MARPO      ----
COX3_EMENI      ----
COX3_ALLMA      ----
COX3_PODAN      ----
COX3_MYTED      ----
COX3_ANOGA      ----
CYOC_BUCAP      ----
COX3_LOLBL      ----
COX3_BACSU      M---
COX3_ASTPE      ----
COX3_ARTSF      ----
COX3_ANOQU      ----
COX3_VICFA      ----
COX3_ACACA      ----
COX3_RICPR      L---
COX3_PYLLI      ----
COX3_CANPA      ----
COX3_ALBCO      ----
COX3_CHOCR      ----
COX3_SCHPO      ----
COX3_BACPF      M---
COX3_PROWI      ----
COX3_PICCA      ----
COX3_TRIRU      ----
CYOC_BUCBP      ----
COX3_PARLI      ----
COX3_HELAN      ----
CYOC_BUCAI      ----
COX3_PISOC      ----
COX3_SPOFR      ----
COX3_ORYSI      ----
COX3_AEGCO      ----
COX3_YARLI      ----
COX3_MAIZE      ----
COX3_USTMA      ----
COX3_DICDI      ----
COX3_DICCI      ----