[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57806.1

[Show Plain Result]


## Summary of Sequence Search
    1::212
   33::241     2e-75  60%  241 aa  PRDXL_DICDI RecName: Full=Peroxiredoxin-like protein DDB_G0282517,
   49::258     6e-57  53%  261 aa  PRX1_YEAST RecName: Full=Mitochondrial peroxiredoxin PRX1;       
    5::224     8e-57  53%  224 aa  PRDX6_RAT RecName: Full=Peroxiredoxin-6;       
    4::223     2e-56  54%  224 aa  PRDX6_CHICK RecName: Full=Peroxiredoxin-6;         EC=1.11.1.15;
    5::224     3e-56  54%  224 aa  PRDX6_MOUSE RecName: Full=Peroxiredoxin-6;       
    5::224     4e-56  53%  224 aa  PRDX6_HUMAN RecName: Full=Peroxiredoxin-6;       
    5::224     4e-55  52%  224 aa  PRDX6_PONAB RecName: Full=Peroxiredoxin-6;         EC=1.11.1.15;
    5::224     1e-54  52%  224 aa  PRDX6_BOVIN RecName: Full=Peroxiredoxin-6;       
    5::224     1e-54  52%  224 aa  PRDX6_MACFA RecName: Full=Peroxiredoxin-6;         EC=1.11.1.15;
    5::224     2e-54  52%  224 aa  PRDX6_PIG RecName: Full=Peroxiredoxin-6;       
    8::231     2e-49  54%  232 aa  TSA_ONCVO RecName: Full=Putative peroxiredoxin;       
    4::216     1e-48  44%  218 aa  REHY_MEDTR RecName: Full=1-Cys peroxiredoxin;       
    7::234     1e-48  52%  235 aa  1CPX_DIRIM RecName: Full=1-Cys peroxiredoxin;       
    7::215     7e-48  44%  218 aa  REHY_TORRU RecName: Full=Probable 1-Cys peroxiredoxin;       
    4::216     4e-47  44%  218 aa  REHY_WHEAT RecName: Full=1-Cys peroxiredoxin PER1;       
    4::216     7e-47  44%  218 aa  REHY_HORVU RecName: Full=1-Cys peroxiredoxin PER1;       
    4::217     1e-46  44%  220 aa  REHYA_ORYSJ RecName: Full=1-Cys peroxiredoxin A;       
    4::217     2e-46  44%  220 aa  REHYA_ORYSI RecName: Full=1-Cys peroxiredoxin A;       
    6::213     5e-46  46%  216 aa  REHY_ARATH RecName: Full=1-Cys peroxiredoxin PER1;       
    9::211     1e-45  46%  222 aa  TDXH_AQUAE RecName: Full=Probable peroxiredoxin;       
    1::200     8e-44  45%  202 aa  REHY_BROSE RecName: Full=Probable 1-Cys peroxiredoxin;       
    4::227     1e-43  43%  229 aa  REHY_MAIZE RecName: Full=1-Cys peroxiredoxin PER1;       
    4::217     1e-43  43%  220 aa  REHYB_ORYSI RecName: Full=1-Cys peroxiredoxin B;       
    4::217     4e-43  43%  220 aa  REHYB_ORYSJ RecName: Full=1-Cys peroxiredoxin B;       
    1::187     4e-41  41%  201 aa  TDXH2_PICTO RecName: Full=Probable peroxiredoxin 2;       
    4::186     6e-41  44%  219 aa  TDXH_METMA RecName: Full=Probable peroxiredoxin;       
    8::197     8e-38  43%  215 aa  TDXH_THEP1 RecName: Full=Probable peroxiredoxin;       
   17::209     1e-37  39%  221 aa  TDXH2_THETN RecName: Full=Probable peroxiredoxin 2;       
    1::183     2e-37  43%  215 aa  TDXH_ARCFU RecName: Full=Probable peroxiredoxin;       
    1::188     2e-37  41%  199 aa  TDXH2_THEAC RecName: Full=Probable peroxiredoxin 2;       
    8::200     2e-37  43%  235 aa  TDXH_STAMF RecName: Full=Probable peroxiredoxin;       
    4::168     5e-37  44%  208 aa  TDXH_TREDE RecName: Full=Probable peroxiredoxin;       
    8::197     5e-37  42%  215 aa  TDXH_THEMA RecName: Full=Probable peroxiredoxin;       
    8::200     9e-37  41%  234 aa  TDXH_IGNH4 RecName: Full=Probable peroxiredoxin;       
    8::193     9e-37  41%  232 aa  TDXH_HYPBU RecName: Full=Probable peroxiredoxin;       
    4::198     9e-37  41%  211 aa  TDXH_CHLTE RecName: Full=Probable peroxiredoxin;       
    4::192     2e-36  41%  209 aa  TDXH_METTH RecName: Full=Probable peroxiredoxin;       
    4::186     5e-36  43%  215 aa  TDXH1_THETN RecName: Full=Probable peroxiredoxin 1;       
    4::206     1e-35  40%  216 aa  TDXH_PYRKO RecName: Full=Probable peroxiredoxin;       
    8::204     2e-35  41%  227 aa  TDXH1_PICTO RecName: Full=Probable peroxiredoxin 1;       
    4::169     3e-35  42%  222 aa  TDXH_NANEQ RecName: Full=Probable peroxiredoxin;       
    4::195     9e-35  41%  217 aa  TDXH_METJA RecName: Full=Probable peroxiredoxin;       
    4::206     1e-34  41%  209 aa  TDXH_METTM RecName: Full=Probable peroxiredoxin;       
    8::193     2e-34  39%  215 aa  TDXH1_SULME RecName: Full=Probable peroxiredoxin 1;       
    9::211     2e-33  39%  215 aa  TDXH1_SULTO RecName: Full=Probable peroxiredoxin 1;       
    8::213     8e-33  37%  214 aa  TDXH2_SULME RecName: Full=Probable peroxiredoxin 2;       
   10::175     8e-33  40%  233 aa  TDXH1_THEAC RecName: Full=Probable peroxiredoxin 1;       
    4::183     1e-32  41%  216 aa  TDXH_PYRHO RecName: Full=Probable peroxiredoxin;       
    4::187     1e-32  41%  216 aa  TDXH_PYRAB RecName: Full=Probable peroxiredoxin;       
    1::173     1e-32  39%  203 aa  TDXH_THEVO RecName: Full=Probable peroxiredoxin;       
    9::194     1e-32  42%  215 aa  TDXH_SULSO RecName: Full=Probable peroxiredoxin;       
    4::194     9e-32  39%  216 aa  TDXH_PYRFU RecName: Full=Probable peroxiredoxin;       
    9::178     1e-31  40%  212 aa  TDXH2_SULTO RecName: Full=Probable peroxiredoxin 2;       
    4::194     5e-30  39%  217 aa  TDXH_METMP RecName: Full=Probable peroxiredoxin;       
    4::194     6e-30  39%  217 aa  TDXH_METVS RecName: Full=Probable peroxiredoxin;       
    8::203     2e-29  37%  250 aa  TDXH_AERPE RecName: Full=Probable peroxiredoxin;       
    4::194     3e-29  38%  217 aa  TDXH_METM5 RecName: Full=Probable peroxiredoxin;       
    7::196     3e-23  34%  198 aa  PRDX2_CRIGR RecName: Full=Peroxiredoxin-2;         EC=1.11.1.15;
    8::179     2e-22  33%  199 aa  TSAA_BUCBP RecName: Full=Probable peroxiredoxin;       
    7::196     3e-22  33%  198 aa  PRDX2_RAT RecName: Full=Peroxiredoxin-2;       
   75::262     6e-22  31%  265 aa  BAS1_SPIOL RecName: Full=2-Cys peroxiredoxin BAS1, chloroplastic;  
    8::196     8e-22  33%  198 aa  PRDX2_MACFA RecName: Full=Peroxiredoxin-2;         EC=1.11.1.15;
    8::196     8e-22  33%  198 aa  PRDX2_HUMAN RecName: Full=Peroxiredoxin-2;       
    8::196     2e-21  33%  198 aa  PRDX2_MOUSE RecName: Full=Peroxiredoxin-2;       
   70::258     2e-21  30%  261 aa  BAS1_ORYSJ RecName: Full=2-Cys peroxiredoxin BAS1, chloroplastic;  
   38::186     2e-21  31%  197 aa  TSAA_BUCAI RecName: Full=Probable peroxiredoxin;       
    5::194     5e-21  32%  200 aa  Y755_SYNY3 RecName: Full=Putative peroxiredoxin sll0755;       
    8::197     9e-21  33%  199 aa  PRDX2_BOVIN RecName: Full=Peroxiredoxin-2;         EC=1.11.1.15;
    6::193     1e-20  31%  198 aa  TSAA_HELPY RecName: Full=Probable peroxiredoxin;       
   80::268     1e-20  29%  271 aa  BAS1B_ARATH RecName: Full=2-Cys peroxiredoxin BAS1-like,
    8::192     2e-20  32%  199 aa  PRDX1_MOUSE RecName: Full=Peroxiredoxin-1;       
   75::263     2e-20  31%  266 aa  BAS1A_ARATH RecName: Full=2-Cys peroxiredoxin BAS1, chloroplastic; 
   38::180     2e-20  32%  198 aa  TSAA_BUCAP RecName: Full=Probable peroxiredoxin;       
    1::180     2e-20  31%  192 aa  TSA1_SCHPO RecName: Full=Peroxiredoxin tpx1;       
    8::192     2e-20  32%  199 aa  PRDX1_CRIGR RecName: Full=Peroxiredoxin-1;       
   20::207     2e-20  28%  210 aa  BAS1_HORVU RecName: Full=2-Cys peroxiredoxin BAS1, chloroplastic;  
    8::192     3e-20  32%  199 aa  PRDX1_RAT RecName: Full=Peroxiredoxin-1;       
    6::194     4e-20  31%  195 aa  PRDX_ASCSU RecName: Full=Peroxiredoxin;       
   20::207     4e-20  28%  210 aa  BAS1_WHEAT RecName: Full=2-Cys peroxiredoxin BAS1, chloroplastic;  
    6::193     5e-20  31%  198 aa  TSAA_HELPJ RecName: Full=Probable peroxiredoxin;       
    6::176     6e-20  32%  180 aa  YKUU_BACSU RecName: Full=Thioredoxin-like protein ykuU;
    8::192     6e-20  31%  199 aa  PRDX1_MYOLU RecName: Full=Peroxiredoxin-1;         EC=1.11.1.15;
    8::192     6e-20  31%  199 aa  PRDX1_HUMAN RecName: Full=Peroxiredoxin-1;       
    8::192     8e-20  32%  199 aa  PRDX1_BOVIN RecName: Full=Peroxiredoxin-1;         EC=1.11.1.15;
    7::192     1e-19  31%  199 aa  PRDX1_GECJA RecName: Full=Peroxiredoxin-1;         EC=1.11.1.15;
    5::176     2e-19  33%  178 aa  R20K_CLOPA RecName: Full=Putative peroxiredoxin in rubredoxin
    1::176     7e-19  30%  193 aa  TDX_ECHGR RecName: Full=Thioredoxin peroxidase;       
    8::193     9e-19  30%  199 aa  YCF42_PORYE RecName: Full=Putative peroxiredoxin ycf42;       
    8::192     1e-18  29%  200 aa  TDX_CYNPY RecName: Full=Peroxiredoxin;       
   43::219     1e-18  30%  233 aa  CR29_ENTHI RecName: Full=Putative peroxiredoxin;       
   33::190     2e-18  31%  194 aa  PRDX1_DROME RecName: Full=Peroxiredoxin 1;       
    8::193     3e-18  31%  200 aa  TDX_ONCMY RecName: Full=Peroxiredoxin;       
    8::193     3e-18  28%  199 aa  YCF42_PORPU RecName: Full=Putative peroxiredoxin ycf42;       
   38::180     4e-18  30%  199 aa  TDX_TRYBR RecName: Full=Thioredoxin peroxidase;       
  113::260     6e-18  30%  274 aa  PRDX4_BOVIN RecName: Full=Peroxiredoxin-4;       
    8::180     1e-17  29%  194 aa  TDX_FASHE RecName: Full=Thioredoxin peroxidase;       
   64::223     1e-17  30%  226 aa  TDX1_CAEEL RecName: Full=Probable peroxiredoxin prdx-3;       
   10::198     2e-17  29%  199 aa  TDX2_BRUMA RecName: Full=Thioredoxin peroxidase 2;       
   34::193     3e-17  31%  196 aa  TSA1_CANAL RecName: Full=Peroxiredoxin TSA1;       
   39::224     3e-17  28%  229 aa  TDX1_BRUMA RecName: Full=Thioredoxin peroxidase 1;       
   94::253     4e-17  31%  256 aa  PRDX3_HUMAN RecName: Full=Thioredoxin-dependent peroxide reductase,
    8::168     4e-17  31%  177 aa  PRDX2_PONAB RecName: Full=Peroxiredoxin-2;         EC=1.11.1.15;
    7::180     5e-17  28%  204 aa  YCF42_ODOSI RecName: Full=Putative peroxiredoxin ycf42;       
  113::260     8e-17  29%  274 aa  PRDX4_MOUSE RecName: Full=Peroxiredoxin-4;       
   94::253     8e-17  31%  256 aa  PRDX3_PONAB RecName: Full=Thioredoxin-dependent peroxide reductase,
   95::257     1e-16  30%  257 aa  PRDX3_MOUSE RecName: Full=Thioredoxin-dependent peroxide reductase,
   95::257     1e-16  30%  257 aa  PRDX3_RAT RecName: Full=Thioredoxin-dependent peroxide reductase,
   33::181     2e-16  33%  187 aa  AHPC_SHIFL RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   33::181     2e-16  33%  187 aa  AHPC_ECOLI RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   33::181     2e-16  33%  187 aa  AHPC_ECOL6 RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   33::181     2e-16  33%  187 aa  AHPC_ECO57 RecName: Full=Alkyl hydroperoxide reductase subunit C;  
  110::257     4e-16  28%  271 aa  PRDX4_HUMAN RecName: Full=Peroxiredoxin-4;       
   33::181     9e-16  32%  187 aa  AHPC_SALTY RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   33::181     9e-16  32%  187 aa  AHPC_SALTI RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   95::234     2e-15  29%  257 aa  PRDX3_BOVIN RecName: Full=Thioredoxin-dependent peroxide reductase,
   14::162     1e-14  32%  168 aa  YNDH_BACYN RecName: Full=Putative peroxiredoxin in ndh 5'region;   
   16::171     4e-14  30%  177 aa  TDX_ENCCU RecName: Full=Putative thioredoxin peroxidase;       
   34::186     1e-13  29%  196 aa  TSA1_YEAST RecName: Full=Peroxiredoxin TSA1;       
    1::127     2e-12  30%  127 aa  PRDX2_PIG RecName: Full=Peroxiredoxin-2;       
   34::186     5e-12  28%  196 aa  TSA2_YEAST RecName: Full=Peroxiredoxin TSA2;       
    4::103     6e-12  37%  152 aa  BCP_HELPJ RecName: Full=Putative peroxiredoxin bcp;       
   33::181     6e-12  27%  187 aa  AHPC_BACSU RecName: Full=Alkyl hydroperoxide reductase subunit C;  
    4::103     8e-12  36%  152 aa  BCP_HELPY RecName: Full=Putative peroxiredoxin bcp;       
   29::177     7e-11  24%  189 aa  AHPC_STAHJ RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAAW RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAAS RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAAR RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAAN RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAAM RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAAC RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAAB RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAA8 RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::175     9e-11  26%  189 aa  AHPC_STAA3 RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::177     4e-10  23%  189 aa  AHPC_STAS1 RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   73::217     4e-09  27%  217 aa  PRXQ_ORYSJ RecName: Full=Peroxiredoxin Q, chloroplastic;       
   73::217     4e-09  27%  217 aa  PRXQ_ORYSI RecName: Full=Putative peroxiredoxin Q, chloroplastic;  
   35::177     5e-09  23%  189 aa  AHPC_STAES RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   35::177     6e-09  23%  189 aa  AHPC_STAEQ RecName: Full=Alkyl hydroperoxide reductase subunit C;  
   73::217     8e-09  26%  217 aa  PRXQ_WHEAT RecName: Full=Peroxiredoxin Q, chloroplastic;       
   72::195     1e-08  33%  216 aa  PRXQ_ARATH RecName: Full=Peroxiredoxin Q, chloroplastic;       
   41::186     2e-08  27%  186 aa  PERQ_SEDLI RecName: Full=Peroxiredoxin Q, chloroplastic;       
    1::134     3e-08  30%  151 aa  BCP_COXBU RecName: Full=Putative peroxiredoxin bcp;       
   97::214     2e-07  33%  214 aa  PERQ_SUASA RecName: Full=Peroxiredoxin Q, chloroplastic;       
   69::213     2e-07  24%  213 aa  PRXQ_POPJC RecName: Full=Peroxiredoxin Q, chloroplastic;       
   73::216     3e-07  25%  217 aa  PRXQ_GENTR RecName: Full=Peroxiredoxin Q, chloroplastic;       
    1::104     6e-07  30%  157 aa  BCP_BACSU RecName: Full=Putative peroxiredoxin ygaF;       
    2::140     5e-06  28%  153 aa  Y2262_MYCBO RecName: Full=Putative peroxiredoxin Mb2262c;       
    2::140     5e-06  28%  153 aa  Y2238_MYCTU RecName: Full=Putative peroxiredoxin Rv2238c/MT2298;   
   49::171     5e-06  31%  192 aa  RESA_OCEIH RecName: Full=Thiol-disulfide oxidoreductase resA;
   39::137     1e-05  32%  179 aa  RESA_BACSU RecName: Full=Thiol-disulfide oxidoreductase resA;
    4::103     2e-05  31%  156 aa  BCP_SHIFL RecName: Full=Putative peroxiredoxin bcp;       
    4::103     2e-05  31%  156 aa  BCP_ECOLI RecName: Full=Putative peroxiredoxin bcp;       
    4::103     2e-05  31%  156 aa  BCP_ECOL6 RecName: Full=Putative peroxiredoxin bcp;       
    4::103     2e-05  31%  156 aa  BCP_ECO57 RecName: Full=Putative peroxiredoxin bcp;       
   37::156     5e-05  29%  177 aa  RESA_BACLD RecName: Full=Thiol-disulfide oxidoreductase resA;
   27::68      3e-04  38%   68 aa  AHPC_RHORU RecName: Full=Alkyl hydroperoxide reductase subunit C;
    7::103     4e-04  26%  158 aa  BCP_BUCAP RecName: Full=Putative peroxiredoxin bcp;       
    1::212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALS
PRDXL_DICDI     --LRIGDVVPDFSQDSSVGQINLYKTLGDSWGLFVSHPKDFTPICTTELGRLAKLKPEFEKRNCKILALS
PRX1_YEAST      --LRINSDAPNFDADTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLS
PRDX6_RAT       --LLLGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALS
PRDX6_CHICK     --LLLGDEAPNFEADTTQGGIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFSKRNVKMIALS
PRDX6_MOUSE     --LLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALS
PRDX6_HUMAN     --LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALS
PRDX6_PONAB     --LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALS
PRDX6_BOVIN     --LLLGDEAPNFEANTTIGRIRFHDYLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKMIALS
PRDX6_MACFA     --LLLGDEAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALS
PRDX6_PIG       --LLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKMIALS
TSA_ONCVO       -----GNKFPDFQAETNEGFISFYDWIGDSWAILFSHPRDFTPVCTTELARLVQLAPEFKKRNVKLIGLS
REHY_MEDTR      --LTIGDTIPDLEVDTTQGKIKLHHFCSDSWTILFSHPGDFTPVCTTELGKMAQYASEFNKRGVMLLGMS
1CPX_DIRIM      ----LGDKFPDFRAETNEGFISFYDWIGDSWAILFSHPRDFTPVCTTELARLVQLAPEFNKRNVKLIGLS
REHY_TORRU      ----LGDLVPDIQADSTMGHIKVRDYCKDGWTIIFSHPGDYPPVCTTELGKIAAYNPEFEKRGVKLLGLS
REHY_WHEAT      --LTIGDTVPNLELDSTHGKIRIHDYVGNGYVILFSHPGDFTPVCTTELAAMANYAKEFEKRGVKLLGIS
REHY_HORVU      --LTIGDTVPNLELDSTHGKIRIHDYVGNGYVILFSHPGDFTPVCTTELAAMANYAKEFEKRGVKLLGIS
REHYA_ORYSJ     --LTIGDTVPNLELDSTHGKIRIHDFVGDTYVILFSHPGDFTPVCTTELAAMAGYAKEFDKRGVKLLGIS
REHYA_ORYSI     --LTIGDTVPNLELDSTHGKIRIHDFVGDTYIILFSHPGDFTPVCTTELAAMAGYAKEFDKRGVKLLGIS
REHY_ARATH      ----LGDTVPNLEVETTHDKFKLHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLS
TDXH_AQUAE      ----LGEPAPAFEAQTTFGPVKFPDDFKGQWVVLFSHPADFTPVCTTEFVAFAKNYEEFKKRNVQLIGLS
REHY_BROSE      ---------------STHGKIRIHDYVANGYVILFSHPGDFTPVCTTELAAMANYAKEFEKRGVKLLGIS
REHY_MAIZE      --LTIGDTVPNLELDSTHGKIRIHDYVGDGYAIIFSHPADFTPVCTTEMAAMAGYAKEFEKRGVKLLGIS
REHYB_ORYSI     --LTLGDVVPDLELDTTHGKIRLHDFVGDAYAIIFSHPADFTPVCTTELSEMAGYAGEFDKRGVKLLGFS
REHYB_ORYSJ     --LTLGDVVPDLELDTTHGKIRLHDFVGDAYVIIFSHPADFTPVCTTELSEMAGYAGEFDKRGVKLLGFS
TDXH2_PICTO     MPVYLGKRAPDFTANTTRGVISLSDY-KNKWVLLFSHPADFTPICTTEFIEFSRRYNDFKELNVELIGLS
TDXH_METMA      ----IGDDAPSFTAVTTQGIIKFPDDYKGKWVILFSHPADFTPVCTTEFMTFASMQEEFRSMNTELIGLS
TDXH_THEP1      ----IGEEFPRLEVKTTHGKKILPDDFRGKWFVLFSHPADFTPVCTTEFVAFQKRYDEFKKLNTELIGLS
TDXH2_THETN     ----IGAPAPDFKANSTFGPIKLSDYRGK-WVVLFSHPGDFTPVCTTEFIAFTQVYTSFVERNVQLIGLS
TDXH_ARCFU      MAPLLGDNFPEIEVVTTHGRMKLPEAFKGKWFVLFSHPADFTPVCTTEFVAFQNRYDEFRKLNCELIGLS
TDXH2_THEAC     ----MGQKAPDFTVNTSKGPVTLSSYRGK-WVLLFSHPGDFTPVCTTEFIAFTERYKDFQALGVELLGLS
TDXH_STAMF      ----IGEKFPEMEVVTQHGKIKLPDYFKGKYWVLFSHPADFTPVCTTEFVAFAKRYEDFKKLNTELIGLS
TDXH_TREDE      ----LGDDFPQLAVSTTHGPMKLPCDLKGSWFVLFSHPADFTPVCTTEFVAFQKLMPEFEKLGVKLIGLS
TDXH_THEMA      ----IGEEFPRVEVKTTHGKKVLPDDFRGKWFVLFSHPADFTPVCTTEFVAFQKRYDEFRKLNTELIGLS
TDXH_IGNH4      ----IGEKLPEMVVHTDHGPKKLPDDYKGKWLVIFSHPADFTPVCTTEFVAFAKRYEDFKKLNTELLGLS
TDXH_HYPBU      ----IGEKFPEIEVMTTHGKIKLPDHFRGKWFVLFSHPADFTPVCTTEFVAFAKRYEDFKKLNTELIGLS
TDXH_CHLTE      ----LGDDFPELKVQTTHGPMNIPGDLKGSWFVLFSHPADFTPVCTTEFVAFQQRVEAFEKIGCKLIGMS
TDXH_METTH      ----IGDKFPEMEVQTTHGPMELPDEFEGKWFILFSHPADFTPVCTTEFVAFQEVYPELRELDCELVGLS
TDXH1_THETN     ----LGEKFPSMEVMTTHGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKAEEFKQLNTELIGLS
TDXH_PYRKO      ----IGEKFPEVEVKTTHGVIKLPDYFAEQWFVLFSHPADFTPVCTTEFYAMQKRVDQFRELGVEPIGLS
TDXH1_PICTO     ----IGEKFPEMEVVTNLGNIKLPDDFKGKWFVLFSHPGDFTPVCTTEFFSFAKHHDDFKKLNTELIGLS
TDXH_NANEQ      ----LGQKFPEVEVQTTHGRMRLPDHYRGKWFVLFSHPADFTPVCTTEFVEFARNYDKFKAMNTELIGLS
TDXH_METJA      ----IGEKFPEVEVKTTHGAIKLPDYVEKGWFVLFSHPADFTPVCTTEFVGFQKRYDEFRKLNTELIGLS
TDXH_METTM      ----IGDKFPEMEVQTTHGLMKLPAEFKGRWFILFSHPADFTPVCTTEFVAFQEVYPELRELDCELVGLS
TDXH1_SULME     ---------PETQVITTKGPLDFYDVFEKGWLFLFAHPADFTPVCTTEFVGFSKVYEEFKRLNVELVGMS
TDXH1_SULTO     ---------PDVQVLTTKGPIDFYDIFGKGWLFLFAHPADFTPVCTTEFVAFSQKYEEFKKLGVELVGLS
TDXH2_SULME     ---------PETQVLTTQGVIDFYDIFGKGWLFLFAHPADFTPVCTTEFVEFSKAYNDFANLGVQLVGLS
TDXH1_THEAC     ----IGEKFPEMTVETTHGSMKLPDQYKGRWFMLFSHPGDFTPVCTTEFYSFARRFEDFQKINTDLIGLS
TDXH_PYRHO      ----IGEKFPEVEVKTTHGVIKLPDYFTKQWFILFSHPADFTPVCTTEFYGMQKRVEEFRKLGVEPIGLS
TDXH_PYRAB      ----IGEKFPEVEVKTTHGVIKLPDHFTKQWFILFSHPADFTPVCTTEFYGMQKRLEEFRKLGVEPIGLS
TDXH_THEVO      MPVVLGQKAPDFTVNTSKGPITLSNYRGK-WVLLFSHPGDFTPVCTTEFIAFTERYEDFQKLGVELIGLS
TDXH_SULSO      ----IGERFPEMEVITTQGRIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFAKKYEEFKKLNTELIGLS
TDXH_PYRFU      ----IGEKFPEVEVKTTHGVIKLPDHFTKQWFMLFSHPADFTPVCTTEFYGLQIRLEKFRELGVEPIGLS
TDXH2_SULTO     ----IGEKFPEMEVITTHGKIKLPDYYQGKWFVLFSHPGDFTPVCTTEFYSFAKKYEEFKKLNTELIGLS
TDXH_METMP      ----IGEKFPEVEVTTTHGKLKLPEYIESGWFVLFSHPGDFTPVCTTEFVAFQKRYDQFRELNTELIGLS
TDXH_METVS      ----IGEKFPDVELLTTHGPEHFIE--AGKWFVLFSHPGDFTPVCTTEFVAFQKRYDQFRELNTELIGLS
TDXH_AERPE      ----IGERFPEMEVTTDHGVIKLPDYVSQGWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
TDXH_METM5      ----IGEKFPEVEVITTHGKLKLPEYIEAGWFVLFSHPGDFTPVCTTEFVAFQKRYDQFRSLNTELIGLS
PRDX2_CRIGR     ---HIGKPAPDFTATAVVDEVKLSDYRGK-YVVLFFYPLDFTFVCPTEIIAFSNHAEDFRKLGCEVLGVS
TSAA_BUCBP      --------APDFTASAIINNFNFKEFTNNQTSILFFWPMDFTFVCPSEIIAFNQELSKFKKRNVKLIGVS
PRDX2_RAT       ---HIGKPAPDFTGTAVVDEIKLSDYRGK-YVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVS
BAS1_SPIOL      ----VGNKAPDFEAEAVFDQVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVS
PRDX2_MACFA     ----IGKPAPDFKATAVVDEVKLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVS
PRDX2_HUMAN     ----IGKPAPDFKATAVVDEVKLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVS
PRDX2_MOUSE     ----IGKSAPDFTATAVVDEIKLSDYRGK-YVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVS
BAS1_ORYSJ      ----VGNKAPDFDAEAVFDQVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVS
TSAA_BUCAI      --------------------------------VLFFWPMDFTFVCPSEIIEFNKLHSEFKKRNVKIVGVS
Y755_SYNY3      --LRVGQPAPDFTATAIVDQVKLSTYRGK-YLVLFFYPLDFTFVCPTEIIAFSDRHSEFTALDTEVVGIS
PRDX2_BOVIN     ---HVGKPAPEFQATAVVDEVKLSDYKGK-YVVLFFYPLDFTFVCPTEIVAFSDRAAEFHKLNCEVLGVS
TSAA_HELPY      -------LAPDFKAPAVLGDEHFEKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVS
BAS1B_ARATH     ----VGNKAPDFEAEAVFDQVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVS
PRDX1_MOUSE     ----IGYPAPNFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGAS
BAS1A_ARATH     ----VGNKAPDFEAEAVFDQVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVS
TSAA_BUCAP      --------------------------------VLFFWPMDFTFVCPSEIIEFNKTFEAFEKRNVKIVGVS
TSA1_SCHPO      MSLQIGKPAPDFKGTAVVNEIKLADYKGK-WVFLGFYPLDFTFVCPTEIVAFSEAASKFAERNAQVILTS
PRDX1_CRIGR     ----IGYPAPNFKATAVMPDGQFRDICRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGAS
BAS1_HORVU      ----VGNKAPDFAAEAVFDQVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVS
PRDX1_RAT       ----IGHPAPSFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGAS
PRDX_ASCSU      ----IGKPAPEFTATAVVDSISLSDYKGK-YVVLFFYPMDFTFVCPTEIIAFSEHVGEFKKLGVEVLAAS
BAS1_WHEAT      ----VGNKAPDFAAEAVFDQVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVS
TSAA_HELPJ      -------LAPDFKAPAVLGDEHFEKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVS
YKUU_BACSU      ----VGKQAPRFEMEAVLASKEFENMKNDKWTVLFFYPMDFTFVCPTEITAMSDRYDEFEDLDAEVIGVS
PRDX1_MYOLU     ----IGHPAPNFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKINCQVIGAS
PRDX1_HUMAN     ----IGHPAPNFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGAS
PRDX1_BOVIN     ----IGHRAPQFKATAVMPDGQFKDIYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGAS
PRDX1_GECJA     ---YIGKLAPDF-QATAVMPIKLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSDRSEEFRKINCEVIGAS
R20K_CLOPA      ----VGKPAPEFEMKAVKGDVKLGDYKGK-WLVMFFYPLDFTFVCPTEITGFSKRAEEFRDLKAELLAVS
TDX_ECHGR       MAAVVGKLAPSFTCKALVDDVSLSDYRGK-YVILFFYPMDFTFVCPTEIIAFNDRADEFHQRGCQLLACS
YCF42_PORYE     --LRVGQLAPDFSADQEFKTLKLSD-LKNKYIVLFFYPLDFTFVCPTEITAFSDKYNAFSELNTEVLGVS
TDX_CYNPY       ----IGKPAPEFQAKAVMPGGEFKDIYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFRKINCELIAAS
CR29_ENTHI      ----IGKEAPEFKAPASIKEIDINEYRGK-YVVLLFYPLDWTFVCPTEMIGYSELAGQLKEINCEVIGVS
PRDX1_DROME     ------------------------------YLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCS
TDX_ONCMY       ----IGHLAPGFTAKAVMPDGQFKDISMSDYVVFFFYPLDFTFVCPTEIIAFSDAAEEFRKIGCEVIGAS
YCF42_PORPU     --LQVGQIAPDFSADQEFKTIKLSDF-KNKYVILFFYPLDFTFVCPTEITAFSDKYSDFSELNTEILGVS
TDX_TRYBR       ------------------------------WVVLFFYPLDFTFVCPTEICQFSDRVKEFNDVDCEVIACS
PRDX4_BOVIN     ------------------------------YLVFFFYPLDFTFVCPTEIIAFGDRIDEFRSINTEVVACS
TDX_FASHE       --------APNFSGQAVVGKISLSDYKGK-WVILAFYPLDFTFVCPTEIIAISDQMEQFAQRNCAVIFCS
TDX1_CAEEL      ------------------------------WLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACS
TDX2_BRUMA      ----IGQPAPNFKTTAVVNGDFKEISLGQKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKQLDVAVMACS
TSA1_CANAL      ------------------------------WVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFAS
TDX1_BRUMA      --------APDFSGTAVVNTISMKDYKGK-WLILFFYPLDFTFVCPTEITAFSDRCAEFQKLNTELIACS
PRDX3_HUMAN     ------------------------------YLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVS
PRDX2_PONAB     ----IGKPAPDFKATAVVDEVKLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSNRAEDFHKLGCEVLGVS
YCF42_ODOSI     ----IGKTPPNFVYKKRLGKIRLSDYRGKKYVILFFYPANFTAISPTELMLLSDRISEFRKLSTQILAIS
PRDX4_MOUSE     ------------------------------YLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACS
PRDX3_PONAB     ------------------------------YLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVS
PRDX3_MOUSE     ------------------------------YLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVS
PRDX3_RAT       ------------------------------YLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVS
AHPC_SHIFL      ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYAVS
AHPC_ECOLI      ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYAVS
AHPC_ECOL6      ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYAVS
AHPC_ECO57      ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYAVS
PRDX4_HUMAN     ------------------------------YLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACS
AHPC_SALTY      ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
AHPC_SALTI      ------------------------------WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVS
PRDX3_BOVIN     ------------------------------YLVLFFYPLDFTFVCPTEIIAFSDKASEFHDVNCEVVAVS
YNDH_BACYN      ------------------------------WSVLCFYPADFTFVCPTELEDLQNEYAALKELGVEVFSAS
TDX_ENCCU       --------------DGEIKEISLQDYIGK-YVVLAFYPLDFTFVCPTEINRFSDLKGAFLRRNAVVLLIS
TSA1_YEAST      ------------------------------YVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFAS
PRDX2_PIG       ---------------------------------LFFYPLDFTFVCPTEIIAFSDRAEEFHQLGCEVLGVS
TSA2_YEAST      ------------------------------YVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVLFAS
BCP_HELPJ       --LEVGQLAPDFRLKNSDGEISLKDLLHKK-VVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGVS
AHPC_BACSU      ------------------------------WSVFCFYPADFSFVCPTELEDLQEQYAALKELGVEVYSVS
BCP_HELPY       --LEVGQLAPDFRLKNSDGEISLKDLLHKK-VVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGIS
AHPC_STAHJ      ------------------------DDLKGSWSVVCFYPADFSFVCPTELEDLQNQYDKLQDLGVNVFSVS
AHPC_STAAW      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAAS      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAAR      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAAN      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAAM      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAAC      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAAB      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAA8      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAA3      ------------------------------WSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVS
AHPC_STAS1      ------------------------------WSVVCFYPADFSFVCPTELEDLQGQYDKLQELGVNVYSVS
PRXQ_ORYSJ      -----GSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGIS
PRXQ_ORYSI      -----GSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGIS
AHPC_STAES      ------------------------------WNVVCFYPADFSFVCPTELEDLQNQYAKLQELGVNVYSVS
AHPC_STAEQ      ------------------------------WNVVCFYPADFSFVCPTELEDLQNQYAKLQELGVNVYSVS
PRXQ_WHEAT      -----GSVPPNFTLKDQDGKTVSLSKFKGKPVVLYFYPADETPGCTKQACAFRDSYEKYKKAGAEVIGIS
PRXQ_ARATH      -----GQAAPDFTLKDQNGPVSLKKYKGKP-VVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGIS
PERQ_SEDLI      -----GSTPPPFTLKDQEGPVSLSKFKGKP-VVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGIS
BCP_COXBU       MSIEVGQKAPIFTLPTDEGEMLSLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWSQLSKAGVVVLGIS
PERQ_SUASA      --------------------------------VVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGIS
PRXQ_POPJC      -----GQAPPSFTLKDQDGKTLSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGIS
PRXQ_GENTR      -----GSVPPQFTLKDQDGKVSLTEFKGKP-VVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGIS
BCP_BACSU       MTIEIGQKAPDLELKGDHGEVKLSDYKGK-YIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVS
Y2262_MYCBO     --LNVGATAPDFTRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAIS
Y2238_MYCTU     --LNVGATAPDFTRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAIS
RESA_OCEIH      ----VGDAAPDFSEEVDQSTVQLSDLEGKG--VMLNFWATWCDPCKAEMPYMQDLYAEYKEKGVEIVAVS
RESA_BACSU      -----GSDAPNFVLEDTNGKIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVN
BCP_SHIFL       --LKAGDIAPKFSLPDQDGEVNLTDFQGQR-VLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGIS
BCP_ECOLI       --LKAGDIAPKFSLPDQDGEVNLTDFQGQR-VLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGIS
BCP_ECOL6       --LKAGDIAPKFSLPDQDGEVNLTDFQGQR-VLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGIS
BCP_ECO57       --LKAGDIAPKFSLPDQDGEVNLTDFQGQR-VLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGIS
RESA_BACLD      ----VGEKAPIFSLEDVDGNLKLDELKGKG--VFLNFWGTWCEPCKREFPYMANQYKVFKDKGVEIVAVN
AHPC_RHORU      ------------------------DTLKGKWSVVFFYPADFTFVCPTELEDLAENYAEFQRLGVEI----
BCP_BUCAP       -----GDIAPKFILPNCIDKIKLSDFLGKK-VLVYFYPKAMTPGCTVQACNIRDNLELFKSKKVEVLGIS


                         .         .         *         .         .         .         .:140
query           VDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYP
PRDXL_DICDI     VDSVKDHLEWMKDIEETQKVKINYPIIADQDRKVADLYGMIHPNADNTFTVRSVFFISPDKRLRAQITLP
PRX1_YEAST      VEDVESHEKWIQDIKEIAKVKVGFPIIGDTFRNVAFLYDMVDAEGFKNITVRSVFVIDPKKKIRLIFTYP
PRDX6_RAT       IDSVEDHFAWSKDINAYNGAKLPFPIIDDKDRDLAILLGMLDPAEKDPVTARVVFIFGPDKKLKLSILYP
PRDX6_CHICK     IDSVPDHLAWSKDINAYNGDQLPFPIIADKDRELAVKLGMLDPDERDPLTARVVFIFGPDKKLKLSILYP
PRDX6_MOUSE     IDSVEDHLAWSKDINETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDPVTARVVFIFGPDKKLKLSILYP
PRDX6_HUMAN     IDSVEDHLAWSKDINEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDPVTARVVFVFGPDKKLKLSILYP
PRDX6_PONAB     IDSVEDHLAWSKDINEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKTARVVFVFGPDKKLKLSILYP
PRDX6_BOVIN     IDSVEDHLAWSKDINAYNGEELPFPIIDDKNRDLAIQLGMLDPAEKDPVTARVVFIFGPDKKLKLSILYP
PRDX6_MACFA     IDSVEDHLAWSKDTNEEPTEKLPFPIIDDKNRDLAILLGMLDPAEKDPVTARVVFVFGPDKKLKLSILYP
PRDX6_PIG       IDSVEDHLAWSKDINAYNGEELPFPIIDDKSRDLAIQLGMLDPAEKDPVTARVVFIFGPDKKLKLSILYP
TSA_ONCVO       CDSADSHSKWADDIMKCVGCKLPYPIIADEDRSLATELGMMDPDERDTLTARCVFIIGSDKTLKLSILYP
REHY_MEDTR      CDDLESHKEWIKDIEHTPGAKVNYPIISDPKREIIKQLNMVDPDEKDSLPSRALHIVGPDKKIKLSFLYP
1CPX_DIRIM      CDSAESHRKWVDDINDGDTCKLPFPIIADENRFLATELGMMDPDERDALTARCVFIIGPEKTLKLSILYP
REHY_TORRU      TDTVEDHQGWIKDIESTPDAPVLYPILADPDRKITVALNMMDPDEKDALASRALHIIGPDCRLKLSLLYP
REHY_WHEAT      CDDVQSHKEWTKDIEAYKGSKVTYPIMADPDRSAIKQLNMVDPDAEGQLPSRTLHIVGPDKKVKLSFLYP
REHY_HORVU      CDDVQSHKEWTKDIEAYKGSKVTYPIMADPDRSAIKQLNMVDPDAQGQLPSRTLHIVGPDKVVKLSFLYP
REHYA_ORYSJ     CDDVQSHKDWIKDIEAYKGNRVTYPIMADPSREAIKQLNMVDPDEKDSLPSRALHIVGPDKKVKLSFLYP
REHYA_ORYSI     CDDVQSHKDWIKDIEAYKGNRVTYPIMADPSREAIKQLNMVDPDEKDSLPSRALHIVGPDKKVKLSFLYP
REHY_ARATH      CDDVQSHKDWIKDIEANHGSKVNYPIIADPNKEIIPQLNMIDP--IENGPSRALHIVGPDSKIKLSFLYP
TDXH_AQUAE      VDSNFSHIAWVMNIKEKFGIEIPFPIIADHNMEVAKKYGMIHPAQSTTFTVRALFVIDDKGILRAMIYYP
REHY_BROSE      CDDVQSHKEWTKDIEAYKGSKVTYPIMADPDRSAIKQLNMVDPDAEGQLPSRTLHIVGPDKKVKLSFLYP
REHY_MAIZE      CDDVESHRQWTKDVEAYGGTKVTFPILADPARDAIRQLNMVDPAAGRSMPSRALHVVGPDKAVKLSFLYP
REHYB_ORYSI     CDDVESHKDWIKDIEAYKGRRVGFPIVADPDREAIRQLNMIDADEKDTLPNRALHIVGPDKKVKLSFLFP
REHYB_ORYSJ     CDDVESHKDWIKDIEAYKGRRVGFPIVADPDREAIRQLNMIDADEKDTLPNRALHIVGPDKKVKLSFLFP
TDXH2_PICTO     VDSLQSHIEWLKDIYEKFGIEIQFPVIADINKEIAREYNLIDENAGN--TVRGVFIIDPNQTVRWMIYYP
TDXH_METMA      IDSVFSHIAWLKRIEEKKNLEIKFPVIEDLKMDVAKKYGMVQPKASTTQAVRAVFIIDPEAKIRTILYYP
TDXH_THEP1      IDQVFSHIKWIEWIKEKLGVEIEFPVIADDLGEVSRRLGLIHP-SKGTNTVRAVFIVDPNGIIRAIVYYP
TDXH2_THETN     VDSNPSHLAWVENIYKTTGVEIPFPIIEDKDMRIAKLYGMISPAETSTSAVRAVFIIDDKQILRLILYYP
TDXH_ARCFU      IDQVFSHIKWIEWIKEKLDIEIEFPVIADDTGRVAEMLGLIHP-AKGTNTVRAVFIVDPEAVIRAVIYYP
TDXH2_THEAC     IDSVYSHIAWIRDIKEHFGIEIPFPIIADIDKEVARQYNLIDEKSG--ATVRGVFIIDPNQIVRWMIYYP
TDXH_STAMF      VDSNFSHIKWIEWIKEKLGVEIPFPIMADPRGTVASKLGMLH-AASSTHTVRAVFVIDPNGIIRAIIYYP
TDXH_TREDE      IDQIQSHLKWIEWIKEKLGVEITFPVIA-ANDSIANQIGLLHPGKG-TNTVRAVFIVDPNGKVRLVLYYP
TDXH_THEMA      IDQVFSHIKWIEWIKEKLGVEIEFPVIADDLGEVSRRLGLIHPNKG-TNTVRAVFIVDPNGIIRAIVYYP
TDXH_IGNH4      VDNSFSHIKWKEWIKEKLNVEIPFPIIADPLGQVATKLGMLHPEGG-VVTVRAVFIVDPEGKVRAILYYP
TDXH_HYPBU      VDSTFSHIKWAEWIKEKLGVEIPFPIIADPTGEVAKKLGLLH-AQSSTATVRAVFVVDDKGVVRAILYYP
TDXH_CHLTE      VDQVFSHIKWVEWIKENLDVDITFPIVAANDRIANKL-GMLHPGKG-TNTVRAVFVGDPNGKVRLVLYYP
TDXH_METTH      VDQVFSHIKWIEWIAENLDTEIEFPVIADTGR-VADTLGLIHP-ARPTNTVRAVFVVDPEGIIRAILYYP
TDXH1_THETN     VDQVFSHIKWVEWIKDNTGVQIPFPVIADELGRVSNQLGMIHPGKG-TNTVRAVFIVDDKGVIRLIMYYP
TDXH_PYRKO      VDQVFSHIKWMEWIKENLGEEITFPVIADDRGELADKLGMIPSGA--TITARAVFIVDDKGIIRAIVYYP
TDXH1_PICTO     VDSKISHIEWINWIKQNLKIDIKFPIIADPMGHVATKLGMIQ-AQSATQTVRAVFIVDDRSTIRAILYYP
TDXH_NANEQ      IDQVFSHIKWIEWIKEKFNVEIPFPVIADDQGELARMLGMISP-YKGTNTVRAVFIVDPEGYIRAMLYYP
TDXH_METJA      IDQVFSHLKWVEWIKEKLNVEIEFPIIADDRGELAEKLGMISPYKGNN-TVRAVFVVDNKGIIRAIIYYP
TDXH_METTM      VDQVFSHIKWIEWIEENLDTEIEFPVIADTGR-VADTLGLIHP-ARPTNTVRAVFVVDPEGIIRAILYYP
TDXH1_SULME     VDSIYSHIEWLKDIQERYGIQVPFPLIADPDKRLARLLDIIDEASG--VTIRAVFLVNPEGIIRFMAYYP
TDXH1_SULTO     VDSIYSHIQWLMDIEQRYGVKVPFPVIADPDKKLARMLDALDEASGQ--TIRIVVLASPDGIIRFVAQYP
TDXH2_SULME     VDSVYSHIEWLKDIQEKYGIKVPFPVIADPDKKFARLLDIVDEASGQ--TIRGVFLVSPDGVIRFIAYYP
TDXH1_THEAC     VDSTISHIEWVNWIRDNLKIEVPFPIIGDSMGRVATRLGMIQ-AESSTSTVRAVFIVDPNSTVRLIMYYP
TDXH_PYRHO      VDQVFSHIKWIEWIKDNLSVEIDFPVIADDRGELAEKLGMIPSGA--TITARAVFVVDDKGIIRAIVYYP
TDXH_PYRAB      VDQVFAHIKWMEWIKENLGVEIEFPIIADDRGELAEKLGMIPSGA--TITARAVFIVDDKGIIRAIVYYP
TDXH_THEVO      IDSVFSHIAWIRDIKEHFGXXXXXXXXXXXXKEVAREYNLIDEKSG--ATVRGVFIIDPNQIVRWMIYYP
TDXH_SULSO      VDSNISHIEWIMWIEKNLKVEIPFPIIADPMGNVAKRLGMIH-AQSSTATVRAVFVVDDKGVVRLILYYP
TDXH_PYRFU      VDQVFSHLKWMEWIKEKLGVEIEFPVIADDRGDLAEKLGMIPSGS--TITARAVFIVDDKGIIRAIVYYP
TDXH2_SULTO     VDSNISHIEWVMWIEKNLKVEIPFPIIADPMGNVAKRLGMIH-AESSTSTVRAVFIVDDKGIVRLIMYYP
TDXH_METMP      IDQVFSHIKWVEWIKEKLDVDIEFPIIADDRGELAVKLGMISPYKGNN-TVRAVFVVDATGTIRAIIYYP
TDXH_METVS      IDQVFSHIKWVEWIKEKLDVDIEFPIIADERGDLAVKLGMISPFKGSN-TVRAVFVVDATGTIRAIIYYP
TDXH_AERPE      VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTMLYYP
TDXH_METM5      IDQVFSHIKWVEWIKEKLDVDIEFPIIADDRGELAVKLGMISPYKGNN-TVRAVFVVDATGTIRAIIYYP
PRDX2_CRIGR     VDSQFTHLAWINTPRKEGGLPLNIPLLADVTRSLSENYGVLK--TDEGIAYRGLFIIDAKGILRQITVND
TSAA_BUCBP      IDSVYVHHAWRNTLSHNQIDKINFTMVSDLKREIQRSYGIEHPQLG--VALRATFLIDKNRIIRHQTIND
PRDX2_RAT       VDSQFTHLAWINTPRKEGGLPLNIPLLADVTKSLSQNYGVLK--NDEGIAYRGLFIIDAKGVLRQITVND
BAS1_SPIOL      VDSVFSHLAWVQTDRKSGGLDLNYPLISDVTKSISKSFGLIH---DQGIALRGLFIIDKEGVIQHSTINN
PRDX2_MACFA     VDSQFTHLAWINTPRKEGGLPLNIPLLADVTRRLSEDYGVLK--TDEGIAYRGLFIIDGKGVLRQITVND
PRDX2_HUMAN     VDSQFTHLAWINTPRKEGGLPLNIPLLADVTRRLSEDYGVLK--TDEGIAYRGLFIIDGKGVLRQITVND
PRDX2_MOUSE     VDSQFTHLAWINTPRKEGGLPLNIPLLADVTKSLSQNYGVLK--NDEGIAYRGLFIIDAKGVLRQITVND
BAS1_ORYSJ      IDSVFSHLAWVQTDRKSGGLDLKYPLISDVTKSISKSFGVLIP--DQGIALRGLFIIDKEGVIQHSTINN
TSAA_BUCAI      IDSVYVHQAWQNTLPKNGGIKINFPMVSDVKHDIQKSYGIQHPNLG--IALRASFLIDSNWIIRHQVVND
Y755_SYNY3      VDSEFSHLAWIQTERKMGGININYPLVSDLKKEISQAYNVLEPDAG--IALRGLFIIDREGILQYATVNN
PRDX2_BOVIN     VDSQFTHLAWINTPRKEGGLPLNIPLLADVTRKLSSDYGVLK--EDEGIAYRGLFVIDGKGVLRQVTIND
TSAA_HELPY      IDSEQVHFAWKNTPVEKGGIQVTFPMVADITKSISRDYDVLF---EEAIALRGAFLIDKNMKVRHAVIND
BAS1B_ARATH     VDSVFSHLAWVQTDRKSGGLDLNYPLVSDITKSISKSFGVLIP--DQGIALRGLFIIDKEGVIQHSTINN
PRDX1_MOUSE     VDSHFCHLAWINTPKKQGGLPMNIPLISDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITIND
BAS1A_ARATH     VDSVFSHLAWVQTDRKSGGLDLNYPLISDVTKSISKSFGLIH---DQGIALRGLFIIDKEGVIQHSTINN
TSAA_BUCAP      IDSVFVHQAWQNTFPENGGIKIKFPMVSDIKHEIQKSYHIEHPELN--IALRASFLIDENWIIRHQVVND
TSA1_SCHPO      TDSEYSHLAFINTPRKEGGLGINIPLLADPSHKVSRDYGVLIEDAG--VAFRGLFLIDPKGVLRQITIND
PRDX1_CRIGR     VDSHFCHLAWINTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITIND
BAS1_HORVU      VDSVFSHLAWVQTERKSGGLDLKYPLVSDVTKSISKSFGVLIP--DQGIALRGLFIIDKEGVIQHSTINN
PRDX1_RAT       VDSHFCHLAWINTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITIND
PRDX_ASCSU      TDSQFSHLAWINTPRKQGGLEMKIPIISDNNHQISRDYGVLK--EDDGIAYRGLFIIDPKGILRQITVND
BAS1_WHEAT      VDSVFSHLAWVQTERKSGGLDLKYPLVSDVTKSISKSFGVLIP--DQGIALRGLFIIDKEGVIQHSTINN
TSAA_HELPJ      IDSEQVHFAWKNTPVEKGGIQVSFPMVADITKSISRDYDVLF---EEAIALRGAFLIDKNMKVRHAVIND
YKUU_BACSU      TDTIHTHLAWINTDRKENGLQLKYPLAADTNHEVSREYGVLI--EEEGVALRGLFIINPEGELQYQTVFH
PRDX1_MYOLU     VDSHFCHLAWINTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITVND
PRDX1_HUMAN     VDSHFCHLAWVNTPKKQGGLPMNIPLVSDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITVND
PRDX1_BOVIN     VDSHFCHLAWINTPKKQGGLPMNIPLISDPKRTIAQDYGVLK--ADEGISFRGLFIIDDKGILRQITIND
PRDX1_GECJA     VDSHFCHLAWINTPKKQGGLSMHIPLVSDTKRVIAKDYGILK--EDEGISYRGLFIIDDKGTLRQITIND
R20K_CLOPA      CDSQYSHETWINDIKQGGLGKINFPIASDKTTEVSTKYGI--QIEEEGISLRGLFIIDPEGIVRYSVVHD
TDX_ECHGR       TDSGYCHLAWNNVSRKEGGVQMRIPMLADTNHKISRDYGVLI--EDQGIALRGLFIIDDKGVLRQITIND
YCF42_PORYE     VDSEYSHLAWLQTDRESGGLDLSYPLVSDLKKEISAAYNVLN---SDGVALRGLFIIDPKGIIQYSTINN
TDX_CYNPY       VDSHFCHLAWTNTSRKEGGLSMKIPLVADTKRTISQDYGVLKE--DEGISFRGLFIIDDKGILRQITIND
CR29_ENTHI      VDSVYCHQAWCEADKSKGGVKLTFPLVSDIKRCISIKYGMLNVEAG--IARRGYVIIDDKGKVRYIQMND
PRDX1_DROME     TDSQFTHLAWINTPRKQGGLSMDIPLLADKSMKVARDYGVLDEETG--IPFRGLFIIDDKQNLRQITVND
TDX_ONCMY       VDSHFCHLAWTNTPRKHGGLAMKIPLVADTMRSISTDYGVFEGGMRASPT-GGLFIIDDKGVLRQITIND
YCF42_PORPU     VDSEYSHLAWLQTDRESGGLDLEYPLVSDLKKEISIAYNVLNSGG---VALRGLFIIDPKGIIQYSTVNN
TDX_TRYBR       MDSEFSHLAWTNVERKKGGLTMNIPILADKTKSIMKAYGVLK--EEDGVAYRGLFIIDPQQNLRQITIND
PRDX4_BOVIN     VDSQFTHLAWINTPRRQGGLSINIPLLADLNHQISKDYGVYLEDSGH--TLRGLFIIDDKGILRQITLND
TDX_FASHE       TDSVYSHLQWTKMDRKVGGIQLNFPLLADKNMSVSRAFGVL--DEEQGNTYRGNFLIDPKGVLRQITVND
TDX1_CAEEL      CDSHFSHLAWVNTPRKDGGLDMDIPLLADFNKKIADSFGVLDKESG--LSYRGLFLIDPSGTVRHTTCND
TDX2_BRUMA      TDSHFSHLAWVNTDRKMGGLQMNIPILAYTNHVISRAYGVLK--EDDGIAYRGLFIIDPKGILGQITIND
TSA1_CANAL      TDSEYTWLAWTNVARKDGGIKVDFPVLADTNHSLSRDYGVLIE--EEGVALRGIFLIDPKGVLRQITIND
TDX1_BRUMA      CDSHFSHLAWIQTPRSEVGGDMKIPVLADFNKDIANAFGVLDHETG--ISYRGLFLIDPSGEIRHSLVND
PRDX3_HUMAN     VDSHFSHLAWINTPRKNGGLHMNIALLSDLTKQISRDYGVLLEGSG--LALRGLFIIDPNGVIKHLSVND
PRDX2_PONAB     VDSQFTHLAWINTPRKEGGLPLNIPLLADVTRRLSEDYGVLK--TDEGIAYRGLFIIDGKGVLRQITVND
YCF42_ODOSI     VDSPFSHLQYLLCNREEGGLELNYPLVSDLTQTITRDYQVL---TDEGLAFPGLFIIDKEGIIQYYTVNN
PRDX4_MOUSE     VDSQFTHLAWINTPRRQGGLPIRIPLLSDLNHQISKDYGVYLEDSGHTL--RGLFIIDDKGVLRQITLND
PRDX3_PONAB     VDSHFSHLAWINTPRKNGGLHMNIALLSDLTKQISRDYGVLLEGSG--LALRGLFIIDPNGVIKHLSVND
PRDX3_MOUSE     VDSHFSHLAWINTPRKNGGLHMNITLLSDITKQISRDYGVLLESAG--IALRGLFIIDPNGVVKHLSVND
PRDX3_RAT       VDSHFSHLAWINTPRKNGGLHMNITLLSDLTKQISRDYGVLLESAG--IALRGLFIIDPNGVIKHLSVND
AHPC_SHIFL      TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
AHPC_ECOLI      TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
AHPC_ECOL6      TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
AHPC_ECO57      TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
PRDX4_HUMAN     VDSQFTHLAWINTPRRQGGLPIRIPLLSDLTHQISKDYGVYLEDSGHTL--RGLFIIDDKGILRQITLND
AHPC_SALTY      TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
AHPC_SALTI      TDTHFTHKAWHSS-SETI-AKIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTA
PRDX3_BOVIN     VDSHFSHLAWINTPRKNGGLHMNIALLSDLTKQISRDYGVLLEGPG--LALRGLFIIDPNGVIKHLSVND
YNDH_BACYN      TDTHFTHKGW-HDSSETIG-KITYAMIGDPSQTLSRNFDVLNEVSG--LADRGTFIIDPDGVVQAAEINA
TDX_ENCCU       CDSVYTHKAWASIPREQNGLGTAWPMVWDAKRELCNQFGLYHP-------MRSTVILAKDLSVRHISSNY
TSA1_YEAST      TDSEYSLLAWTNIPRKEGGLPINIPLLADTNHSLSRDYGVLIE--EEGVALRGLFIIDPKGVIRHITIND
PRDX2_PIG       VDXQXTHLAWINTPRKEGGLPLKIPLLADVTRNLSLDYGVLK--EDEGIAYRGLFIIDGKGVLRQITVND
TSA2_YEAST      TDSEYSLLAWTNLPRKDGGLPVKVPLLADKNHSLSRDYGVLIE--KEGIALRGLFIIDPKGIIRHITIND
BCP_HELPJ       PDNSQSHQKFISQ------CSLNVILLCDEDKKVANLY--------------------------------
AHPC_BACSU      TDTHFVHKGWHDSSEKIS--KITYAMIGDPSQTISRNFDVLDEETG--LADRGTFIIDPDGVIQTVEINA
BCP_HELPY       PDNAQSHQKFISQ------CSLNVILLCDEDKKAANLY--------------------------------
AHPC_STAHJ      TDTHFVHKAWHDHSDAIS--KIQYQMIGDPSQTITRNFDVLDEEAG--LAQRGTFIIDPDGVVQAAEINA
AHPC_STAAW      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAAS      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAAR      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAAN      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAAM      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAAC      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAAB      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAA8      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAA3      TDTHFVHKAWHDHSDAIS--KITYTMIGDPSQTITRNFDVLDEATG--LAQRGTFIIDPDGVVQASEINA
AHPC_STAS1      TDTHFVHKAWHDHSDAIS--KIQYTMIGDPSQTITRNFDVLDEELG--LAQRGTFIVDPDGVVQAAEVNA
PRXQ_ORYSJ      GDDAASHKEF------KKKYKLPFTLLSDEGNKVRKEWG-VPADLFGTLPGRQTYVLDKNGVVQYIYNNQ
PRXQ_ORYSI      GDDAASHKEF------KKKYKLPFTLLSDEGNKVRKEWG-VPADLFGTLPGRQTYVLDKNGVVQYIYNNQ
AHPC_STAES      TDTHFVHKAWHDHSDAIS--KLEYSMIGDPSQTITRNFDVLDEESG--LAQRGTFIIDPDGVVQAAEINA
AHPC_STAEQ      TDTHFVHKAWHDHSDAIS--KLEYSMIGDPSQTITRNFDVLDEETG--LAQRGTFIIDPDGVVQAAEINA
PRXQ_WHEAT      GDDAASHKAF------AKKYRLPFTLLSDEGNKVRKEWG-VPSDLFGTLPGRQTYVLDKKGVVQYIYNNQ
PRXQ_ARATH      GDDSASHKAFASKY------KLPYTLLSDEGNKVRK--DWGVPGLFGALPGRQTYVLDKNGVVQLI----
PERQ_SEDLI      GDSSESHKAF------AKKYKLPFTLLSDEGNKVRKEWG-VPSDLFGTLPGRETYVLDKNGVVQLVYNNQ
BCP_COXBU       KDSVKAHQSFKQKYN------LPFTLLSDKDNTVCEQYDKNRFGKKYKGIERTTFLIDEEGVISAV----
PERQ_SUASA      GDDSSSHKAF------KQKYKLPYTLLSDEGNKVSDLFGAL-PG-------RQTYVLDRNGVVRLVYNNQ
PRXQ_POPJC      GDDPSSHKAF------AKKYRLPFTLLSDEGNKIRKEWG-VPADLFGTLPGRQTYVLDKKGVVQLIYNNQ
PRXQ_GENTR      GDDPSSHKAF------AKKYRLPYTLLSDEGNKIRREWG-VPADLFGTLPGRQTYVLDKNGTVQLIYNNQ
BCP_BACSU       PDSQEKHGKFKEKHN------LPFLLLVDDEHKLAEAFDV------------------------------
Y2262_MYCBO     VGPPPTHKIWATQSGFT------FPLLSDPHGAVSQAYGVFNEQAG--IANRGTFVVDRSGIIRFAEMKQ
Y2238_MYCTU     VGPPPTHKIWATQSGFT------FPLLSDPHGAVSQAYGVFNEQAG--IANRGTFVVDRSGIIRFAEMKQ
RESA_OCEIH      LDGTELVVDQFIDEYD-----LTFPVPHDKNGEVKDLY-KIGP-------MPTTYFIKPNGEIEEIV---
RESA_BACSU      VGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV------------------------------
BCP_SHIFL       TDKPEK----LSRFAEKE--LLNFTLLSDEDHQVCEQF--------------------------------
BCP_ECOLI       TDKPEK----LSRFAEKE--LLNFTLLSDEDHQVCEQF--------------------------------
BCP_ECOL6       TDKPEK----LSRFAEKE--LLNFTLLSDEDHQVCEQF--------------------------------
BCP_ECO57       TDKPEK----LSRFAEKE--LLNFTLLSDEDHQVCEQF--------------------------------
RESA_BACLD      VGESN-----LAVRNFMKDHGVNFPVVLDKDRQVLNAYDV--------TPLPTTFLINPDGEIVKVVT--
AHPC_RHORU      ----------------------------------------------------------------------
BCP_BUCAP       PDNTNKLLTFV------EKKMLNFTLLSDKQNIVSKKF--------------------------------


                         +         .         .         .         .         *         .:210
query           PSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIVPSLTDPEVLKEKFPKGYEEIKPYLRMTPQP
PRDXL_DICDI     ASTGRNFNEIIRILDSFQLTDKYKVATPADWVDGDDCIIVPTVFD-EDAKKLFPKGFPKIKSYLRVTPQP
PRX1_YEAST      STVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDEA-KAKFGQ-FNEIKPYLRFT---
PRDX6_RAT       ATTGRNFDEILRVVDSLQLTASNPVATPVDWKKGESVMVLPTLPEEEA-KQLFPKGVKELKKYLRYTPQP
PRDX6_CHICK     ATTGRNFDEILRVVDSLQLTAYKKVATPVDWKCGDSVMVVPTLPDEEA-KKLFPKGLPSGKKYLRYTPQP
PRDX6_MOUSE     ATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEA-KQCFPKGVKELKKYLRYTPQP
PRDX6_HUMAN     ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEA-KKLFPKGVKELKKYLRYTPQP
PRDX6_PONAB     ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEA-KKLFPKGVKELRKYLRYTPQP
PRDX6_BOVIN     ATTGRNFDEILRVIISLQLTAEKRVATPVDWKNGDSVMVLPTIPEEEA-KKLFPKGVKELKKYLRYTPQP
PRDX6_MACFA     ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEA-KKLFPKGVKELKKYLRYTPQP
PRDX6_PIG       ATTGRNFDEILRVIISLQLTAEKRVATPVDWKNGDSVMVLPNIPEEEA-KKLFPKGVKELKKYLRYTPQP
TSA_ONCVO       ATTGRNFDEILRVVDSLQLTAVKLVATPVDWKDGDDCVVLPTIDDNEAKKEKLPSG----KHYLRMVPHP
REHY_MEDTR      AQTGRNMDEVLRVVESLQKASKYKIATPANWKPGEPVVISPDVTNDQA-KEMFPQGFKTAKEYLRFT---
1CPX_DIRIM      ATTGRNFDEILRVVDSLQLTAVKLVATPVDWKDGDDCVVLPTIDDTEAKKEKLPSG----KHYLRMVAHP
REHY_TORRU      GTTGRNFDEVLRVLDSLQLASKHKIATPANWQKGEPVVISPSVSD-EKAKQMFPQGWETVNKALRMT---
REHY_WHEAT      SCTGRNMDEVVRAVDSLLTAAKHKVATPANWNPGECVVIAPGVSDDEA-KKMFPQGFETAKGYLRFT---
REHY_HORVU      SCTGRNMDEVVRAVDSLLTAAKHKVATPANWKPGECVVIAPGVSDEEA-KKMFPQGFETAKGYLRFT---
REHYA_ORYSJ     ACVGRNMDEVVRAVDALQTAAKHAVATPVNWKPGERVVIPPGVSDDEA-KEKFPQGFDTAKGYLRFT---
REHYA_ORYSI     SCVGRNMDEVVRAVDALQTAAKHAVATPVNWKPGERVVIPPGVSDDEA-KEKFPQGFDTAKGYLRFT---
REHY_ARATH      STTGRNMDEVLRALDSLLMASNNKIATPVNWKPDQPVVISPAVSDEEA-KKMFPQGFKTAKGYLRHT---
TDXH_AQUAE      LTTGRNIREVIRLVDALQTADREGVATPADWTEENTKVIVPPPTTYEDAVKRLQEGYE------------
REHY_BROSE      SCTGRNMDEVVRAVDSLLTAAKHKVATPANWKPGECVVIAPGVSDEEA-KKLFPQGFESKKGYLRFT---
REHY_MAIZE      ATTGRNMDEVLRAVDSLLTAAKHKVATPANWKPGECAVIAPGVSDEEA-RKMFPQGFETAKGYLRFT---
REHYB_ORYSI     ACTGRNMAEVXXXXXXXXXXXXHRVATPVNWKPGERVVIPPGVSDEEA-KARFPAGFETAKCYLRFT---
REHYB_ORYSJ     ACTGRNMAEVXXXXXXXXXXXXHRVATPVNWKPGERVVIPPGVSDEEA-KARFPAGFETAKCYLRFT---
TDXH2_PICTO     AETGRNIDEILRSVKALQANWSRKIATPVNWRPGDKGILPPPSTLEDALQ--------------------
TDXH_METMA      QSTGRNMQEIKRIVVALQKNAAEKVATPANWQPGEDVIIPP-----------------------------
TDXH_THEP1      QEVGRNIDEILRAVRALQTSDEKGVAIPANWPSNEDSVIVPPASSVEEARER------------------
TDXH2_THETN     LXXXXXXXXXXXXXDALQTVDKYKVLAPANWYPGMPVIVPPPKTYPELKQRKNVEGY-------------
TDXH_ARCFU      QELGRNMDEILRAVKALQVSDQNGVAMPANWPNNEDAVIIP-----------------------------
TDXH2_THEAC     AETGRNIDEIIRVIKALQFNWERKLATPANWQPGQEGIEAPSTVDASLKRDGEP----------------
TDXH_STAMF      LDNGRNIDEILRLVKAIQITDKYGRATPANWPNNEDSVIVPPAGTVKEAEERLKK---------------
TDXH_TREDE      QEIGRNMEEIVRAVKALQTSDKNKVALPADW---------------------------------------
TDXH_THEMA      QEVGRNIDEILRAVKALQTSDEKGVAIPANWPSNEDSVIVPPASSVEEARKR------------------
TDXH_IGNH4      LNVGRNIDEILRLLKALQVTDKLGRATPANWPCNEDHVIVPPASTEQEAKERLQK---------------
TDXH_HYPBU      QEVGRNIDEILRLIESLQISDKYGRAIPANWPNGDNLIVPPAATVQE-----------------------
TDXH_CHLTE      QEIGRNMDEILRAVKVLQISDSNKVAMPADWPNNKDHVIIPPANNVEDAKKRKEQQYD------------
TDXH_METTH      QELGRNIPEIVRMIRAFRVIDAEGVAAPANWPDNQDHVIVPPASDIETARKR------------------
TDXH1_THETN     QEVGRNVDEILRALKALQTADQYGVALPEKWPNNKDHVIVPPSTD-------------------------
TDXH_PYRKO      AEVGRDWDEILRLVKALKVSDEKGVALPHKWPNGDKAIVPPASTVDEVKQREEAKAKGEIECY-------
TDXH1_PICTO     METGRNISEILRLIKSLQMVDKYKIVTPANWPNGDNVLNPPPATQNDIERTKKYKGY-------------
TDXH_NANEQ      QETGRNIPEILRLVEALQTADKYGVATPANW---------------------------------------
TDXH_METJA      QEVGRNLDEIVRLVKALQVSDEKGVAMPANWPENDDKVIIPPASSVEEIKQR------------------
TDXH_METTM      QELGRNIPEIVRMIRAFRVIDAEGVAAPANWPDNQDHVIVPPASDIETAR----KRKEEYECYLALPPQ-
TDXH1_SULME     IEYGRKIEELLRITKAALVNYKAKVSLPVDWEPGQEVIVAPSTIDEAQIRMKLP----------------
TDXH1_SULTO     MEFGRNIDELLRITKAAIVNYKAKVVLPANWQPGQDVIVPPAIFDEAEMRIKLPKKYEELPP--------
TDXH2_SULME     LEAGRKISELLRITKAMIVNYKAKVVLPANWEPGQDVIVPPNVFDEATMRMKMPKAYLLFKDYNEL-PQD
TDXH1_THEAC     LEIGRNVDELLRAIKALQMSDKYRGAMPANW---------------------------------------
TDXH_PYRHO      AEVGRDWDEILRLVKALKISTEKGVALPHKWPNNEDKVIVP-----------------------------
TDXH_PYRAB      AEVGRDWDEILRLVKALKISTENGVALPHKWPNGDKVIIPPAST--------------------------
TDXH_THEVO      AETGRNIEEIIRVIKALQFNWDRKLATPANWQPGQE----------------------------------
TDXH_SULSO      MEIGRNIDEILRAIRALQLVDKAGVVTPANWPNNEDKVINPA---PRTIKD-------------------
TDXH_PYRFU      AEVGRDWDEILRLVKALKISTEKGVALPHKWPNNEDKVIVPPASSVEQIKER------------------
TDXH2_SULTO     MEIGRNIDEILRSIRALQLVDKSGVVIPANWPNNE-----------------------------------
TDXH_METMP      QEVGRNMDEIVRLVKALQTADK-GYATPANWPNNDEKVIVPPANNMDARKKR------------------
TDXH_METVS      QEVGRNMDEVVRLVKALQTADK-GYATPADWPNNEEKVIIPPAKDMKTRAER------------------
TDXH_AERPE      MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESG--------------
TDXH_METM5      QEVGRNMDEVVRLVKALQTADK-GYATPANWPENDEKVIVPPANNMDARKNR------------------
PRDX2_CRIGR     LPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSD-TIKPNVDDS---KEYFSK---------------
TSAA_BUCBP      LPFGRNISETLRMIDALHFYEKYGEVCPANWKKGD-----------------------------------
PRDX2_RAT       LPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSD-TIKPNVDDS---KEYFSK---------------
BAS1_SPIOL      LGIGRSVDETMRTLQALQYTGNPDEVCPAGWKPGEKSM----KPDPKLSKEYF-----------------
PRDX2_MACFA     LPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSD-TIKPNVDDS---KEYFSK---------------
PRDX2_HUMAN     LPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSD-TIKPNVDDS---KEYFSK---------------
PRDX2_MOUSE     LPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSD-TIKPNVDDS---KEYFSK---------------
BAS1_ORYSJ      LAIGRSVDETMRTLQALQVQDNPDEVCPAGWKPGDKSM----KPDPKGSKEYF-----------------
TSAA_BUCAI      LPFGRNITDMIRMVDALDFHNKFGEVCPANWKKGEEGITASS----------------------------
Y755_SYNY3      LSFGRSVDETLRVLKAIRHVQSHNEVCPVDWQEGDKTMI----PDPEKAKTYF-----------------
PRDX2_BOVIN     LPVGRSVDEALRLVQAFQYTDEHGEVCPAGWTPGSD-TIKPNVDDS---KEYFSK---------------
TSAA_HELPY      LPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKE-------------------
BAS1B_ARATH     LGIGRSVDETMRTLQALQVQENPDEVCPAGWKPGEKSM----KPDPKLSKEYF-----------------
PRDX1_MOUSE     LPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTI------KPDVNKSK------------------
BAS1A_ARATH     LGIGRSVDETMRTLQALQIQENPDEVCPAGWKPGEKSM----KPDPKLSKEYF-----------------
TSAA_BUCAP      LPFGRNIDEMIRMIDALNFHNKYGEVCPVNWKHGQE----------------------------------
TSA1_SCHPO      LPVGRSVDEALRLLDAFQFVEEHGEVCPANWHKGSDTI--------------------------------
PRDX1_CRIGR     LPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTI------KPDVQKSK------------------
BAS1_HORVU      LGIGRSVDETLRTLQALQYVKKPDEVCPAGWKPGEKSM----KPDPKGSKEYF-----------------
PRDX1_RAT       LPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTI------KPDVNKSK------------------
PRDX_ASCSU      LPVGRSVTETLRLVQAFQFVDKHGEVCPAGWTPGAD-TIKPGVKESKAYFEK------------------
BAS1_WHEAT      LGIGRSVDETLRTLRALQYVKKPDEVCPAGWKPGEKSM----KPDPKGSKEYF-----------------
TSAA_HELPJ      LPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKE-------------------
YKUU_BACSU      NNIGRDVDETLRVLQALQT----GGLCPANWKPG------------------------------------
PRDX1_MYOLU     LPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTI------KPDVQKSK------------------
PRDX1_HUMAN     LPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTI------KPDVQKSK------------------
PRDX1_BOVIN     LPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTI------KPDVQKSK------------------
PRDX1_GECJA     LPVGRSVDETLRLVQAFQFTDKHGEVCPAGWQPGSDTI------KPDVQKSK------------------
R20K_CLOPA      LNVGRSVDETLRVLKAFQT----GGMCALDWHEGDD----------------------------------
TDX_ECHGR       LPVGRSVDEALRLLDAFQFTDKHGEVCPANWQPG------------------------------------
YCF42_PORYE     LEFGRSVEETLRVLQAIQYVQSHDEVCPANWKPGDKTM------NPDPIKSK------------------
TDX_CYNPY       LPVGRSVDETLRLVQAFQHTDKFGEVCPAGWKPGSDTI------KPDISKSK------------------
CR29_ENTHI      DGIGRSTEETIRIVKAIQFSDEHGAVCPLNWKPGKDTI--------------------------------
PRDX1_DROME     LPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMV----ADPTKSKEYF-----------------
TDX_ONCMY       LPVGRCVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTI------KPDVQKSK------------------
YCF42_PORPU     LEFGRSVEETLRVLQAIQYVQAHDEVCPANWKPGDRTM------NPDPIKSK------------------
TDX_TRYBR       LPVGRNVDETLRLVKAFQFVEKHGEVCPANWKPG------------------------------------
PRDX4_BOVIN     LPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETII-------------------------------
TDX_FASHE       DPVGRSVEEALRLLDAFIFHEEHGEVCPANWKPKSKTIV-------------------------------
TDX1_CAEEL      LPVGRSVDETLRVLKAFQFSDKHGEVCPADWHE-DSPTIKPGVA---TSKEYFNK---------------
TDX2_BRUMA      LPVGRSVDETLRLIQAFQFVDKHGEVCPANWHPGSE-TIKPGVKESKAYFEK------------------
TSA1_CANAL      LPVGRSVEESLRLLEAFQFTEKYGEVCPANWHPGDE-TIKPS---PEASKEYFNK---------------
TDX1_BRUMA      LSVGRSVDEAFRTLKAFQFVEKHGEVCPANWSD-DKPTIKPGIKES---KEYFKK---------------
PRDX3_HUMAN     LPVGRSVEETLRLVKAFQYVETHGEVCPANWTP-DSPTIKPS---PAASKEYFQK---------------
PRDX2_PONAB     LPVGRSVDEALRLVQAFQYTDEH-----------------------------------------------
YCF42_ODOSI     LLCGRNINELLRILESIQVKENPGYACPVNWNFGD-----------------------------------
PRDX4_MOUSE     LPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETII-------------------------------
PRDX3_PONAB     LPVGRSVEETLRLVKAFQYVETHGEVCPANWTP-DSPTIKP---NPAASKEYFQK---------------
PRDX3_MOUSE     LPVGRSVEETLRLVKAFQFVETHGEVCPANWTP-ESPTIKPS---PTASKEYFEKVHQ------------
PRDX3_RAT       LPVGRSVEEPLRLVKAFQFVETHGEVCPANWTP-ESPTIKPS---PTASKEYFEKVHQ------------
AHPC_SHIFL      EGIGRDASDLLRKIKAAQYVASHGEVCPAKWKEG-EATLAPSL---------------------------
AHPC_ECOLI      EGIGRDASDLLRKIKAAQYVASHGEVCPAKWKEG-EATLAPSL---------------------------
AHPC_ECOL6      EGIGRDASDLLRKIKAAQYVASHGEVCPAKWKEG-EATLAPSL---------------------------
AHPC_ECO57      EGIGRDASDLLRKIKAAQYVASHGEVCPAKWKEG-EATLAPSL---------------------------
PRDX4_HUMAN     LPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETII-------------------------------
AHPC_SALTY      EGIGRDASDLLRKIKAAQVAAHPGEVCPAKWKEG-EATLAPSL---------------------------
AHPC_SALTI      EGIGRDASDLLRKIKAAQVAAHPGEVCPAKWKEG-EATLAPSL---------------------------
PRDX3_BOVIN     LPVGRSVEETLRLVKAFQFVEAHGEVCPANW---------------------------------------
YNDH_BACYN      EGIGRDASTLVNKIKAAQVRNNPGEVCPAKWQEGDE-TLKPSL---------------------------
TDX_ENCCU       HAIGRSVDEIIRLIDAITFNDENGDICPAEWR--------------------------------------
TSA1_YEAST      LPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPG-AATIKPTVED-------------------------
PRDX2_PIG       LPVGRXVDEALRLVQGXQYTD-------------------------------------------------
TSA2_YEAST      LSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPG-AATIKPDVKD-------------------------
BCP_HELPJ       ----------------------------------------------------------------------
AHPC_BACSU      GGIGRDASNLVNKVKAAQVRQNPGEVCPAKWEEGGE-TLTPSL---------------------------
BCP_HELPY       ----------------------------------------------------------------------
AHPC_STAHJ      DGIGRDASTLVNKIKAAQYVRQHGEVCPAKWEEGSE----------------------------------
AHPC_STAAW      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAAS      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAAR      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAAN      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAAM      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAAC      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAAB      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAA8      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAA3      DGIGRDASTLAHKIKAAQVRKNPGEVCPAKWEEG------------------------------------
AHPC_STAS1      DGIGRDASTLVHKIKAAQYVRQHGEVCPAKWEEGSE----------------------------------
PRXQ_ORYSJ      FQPEKHIGETLKILQSL-----------------------------------------------------
PRXQ_ORYSI      FQPEKHIGETLKILQSL-----------------------------------------------------
AHPC_STAES      DGIGRDASTLVNKIKAAQYVRQHGEVCPAKWEEGSE----------------------------------
AHPC_STAEQ      DGIGRDASTLVNKIKAAQYVRQHGEVCPAKWEEGSE----------------------------------
PRXQ_WHEAT      FQPEKHIGETLKIIQNL-----------------------------------------------------
PRXQ_ARATH      ----------------------------------------------------------------------
PERQ_SEDLI      FQPEKHIDETLKLLQSLK----------------------------------------------------
BCP_COXBU       ----------------------------------------------------------------------
PERQ_SUASA      FQPEKHIDETLKFLQSL-----------------------------------------------------
PRXQ_POPJC      FQPEKHIDETLKLLQSL-----------------------------------------------------
PRXQ_GENTR      FQPEKHIDETLKFLQS------------------------------------------------------
BCP_BACSU       ----------------------------------------------------------------------
Y2262_MYCBO     PGEVRD----------------------------------------------------------------
Y2238_MYCTU     PGEVRD----------------------------------------------------------------
RESA_OCEIH      ----------------------------------------------------------------------
RESA_BACSU      ----------------------------------------------------------------------
BCP_SHIFL       ----------------------------------------------------------------------
BCP_ECOLI       ----------------------------------------------------------------------
BCP_ECOL6       ----------------------------------------------------------------------
BCP_ECO57       ----------------------------------------------------------------------
RESA_BACLD      ----------------------------------------------------------------------
AHPC_RHORU      ----------------------------------------------------------------------
BCP_BUCAP       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NK
PRDXL_DICDI     NK
PRX1_YEAST      --
PRDX6_RAT       --
PRDX6_CHICK     --
PRDX6_MOUSE     --
PRDX6_HUMAN     --
PRDX6_PONAB     --
PRDX6_BOVIN     --
PRDX6_MACFA     --
PRDX6_PIG       --
TSA_ONCVO       --
REHY_MEDTR      --
1CPX_DIRIM      --
REHY_TORRU      --
REHY_WHEAT      --
REHY_HORVU      --
REHYA_ORYSJ     --
REHYA_ORYSI     --
REHY_ARATH      --
TDXH_AQUAE      --
REHY_BROSE      --
REHY_MAIZE      --
REHYB_ORYSI     --
REHYB_ORYSJ     --
TDXH2_PICTO     --
TDXH_METMA      --
TDXH_THEP1      --
TDXH2_THETN     --
TDXH_ARCFU      --
TDXH2_THEAC     --
TDXH_STAMF      --
TDXH_TREDE      --
TDXH_THEMA      --
TDXH_IGNH4      --
TDXH_HYPBU      --
TDXH_CHLTE      --
TDXH_METTH      --
TDXH1_THETN     --
TDXH_PYRKO      --
TDXH1_PICTO     --
TDXH_NANEQ      --
TDXH_METJA      --
TDXH_METTM      --
TDXH1_SULME     --
TDXH1_SULTO     --
TDXH2_SULME     QK
TDXH1_THEAC     --
TDXH_PYRHO      --
TDXH_PYRAB      --
TDXH_THEVO      --
TDXH_SULSO      --
TDXH_PYRFU      --
TDXH2_SULTO     --
TDXH_METMP      --
TDXH_METVS      --
TDXH_AERPE      --
TDXH_METM5      --
PRDX2_CRIGR     --
TSAA_BUCBP      --
PRDX2_RAT       --
BAS1_SPIOL      --
PRDX2_MACFA     --
PRDX2_HUMAN     --
PRDX2_MOUSE     --
BAS1_ORYSJ      --
TSAA_BUCAI      --
Y755_SYNY3      --
PRDX2_BOVIN     --
TSAA_HELPY      --
BAS1B_ARATH     --
PRDX1_MOUSE     --
BAS1A_ARATH     --
TSAA_BUCAP      --
TSA1_SCHPO      --
PRDX1_CRIGR     --
BAS1_HORVU      --
PRDX1_RAT       --
PRDX_ASCSU      --
BAS1_WHEAT      --
TSAA_HELPJ      --
YKUU_BACSU      --
PRDX1_MYOLU     --
PRDX1_HUMAN     --
PRDX1_BOVIN     --
PRDX1_GECJA     --
R20K_CLOPA      --
TDX_ECHGR       --
YCF42_PORYE     --
TDX_CYNPY       --
CR29_ENTHI      --
PRDX1_DROME     --
TDX_ONCMY       --
YCF42_PORPU     --
TDX_TRYBR       --
PRDX4_BOVIN     --
TDX_FASHE       --
TDX1_CAEEL      --
TDX2_BRUMA      --
TSA1_CANAL      --
TDX1_BRUMA      --
PRDX3_HUMAN     --
PRDX2_PONAB     --
YCF42_ODOSI     --
PRDX4_MOUSE     --
PRDX3_PONAB     --
PRDX3_MOUSE     --
PRDX3_RAT       --
AHPC_SHIFL      --
AHPC_ECOLI      --
AHPC_ECOL6      --
AHPC_ECO57      --
PRDX4_HUMAN     --
AHPC_SALTY      --
AHPC_SALTI      --
PRDX3_BOVIN     --
YNDH_BACYN      --
TDX_ENCCU       --
TSA1_YEAST      --
PRDX2_PIG       --
TSA2_YEAST      --
BCP_HELPJ       --
AHPC_BACSU      --
BCP_HELPY       --
AHPC_STAHJ      --
AHPC_STAAW      --
AHPC_STAAS      --
AHPC_STAAR      --
AHPC_STAAN      --
AHPC_STAAM      --
AHPC_STAAC      --
AHPC_STAAB      --
AHPC_STAA8      --
AHPC_STAA3      --
AHPC_STAS1      --
PRXQ_ORYSJ      --
PRXQ_ORYSI      --
AHPC_STAES      --
AHPC_STAEQ      --
PRXQ_WHEAT      --
PRXQ_ARATH      --
PERQ_SEDLI      --
BCP_COXBU       --
PERQ_SUASA      --
PRXQ_POPJC      --
PRXQ_GENTR      --
BCP_BACSU       --
Y2262_MYCBO     --
Y2238_MYCTU     --
RESA_OCEIH      --
RESA_BACSU      --
BCP_SHIFL       --
BCP_ECOLI       --
BCP_ECOL6       --
BCP_ECO57       --
RESA_BACLD      --
AHPC_RHORU      --
BCP_BUCAP       --