[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57898.1

[Show Plain Result]


## Summary of Sequence Search
    1::152
   82::164     8e-11  33%  170 aa  Y531_METJA RecName: Full=Uncharacterized protein MJ0531;
    5::147     7e-10  22%  148 aa  YXIE_BACSU RecName: Full=Uncharacterized protein yxiE;Flags:
    7::165     4e-09  31%  166 aa  NHAX_BACSU RecName: Full=Stress response protein nhaX;
   35::157     2e-08  29%  162 aa  Y577_METJA RecName: Full=Uncharacterized protein MJ0577;
    5::142     3e-06  26%  166 aa  Y1819_STAA8 RecName: Full=Putative universal stress protein
    5::142     3e-06  26%  166 aa  Y1788_STAAR RecName: Full=Putative universal stress protein
    5::142     3e-06  26%  166 aa  Y1759_STAAC RecName: Full=Putative universal stress protein
    5::142     3e-06  26%  166 aa  Y1710_STAAM RecName: Full=Putative universal stress protein
    5::142     3e-06  26%  166 aa  Y1656_STAA3 RecName: Full=Putative universal stress protein
    5::142     3e-06  26%  166 aa  Y1653_STAAW RecName: Full=Putative universal stress protein MW1653;
    5::142     3e-06  26%  166 aa  Y1637_STAAS RecName: Full=Putative universal stress protein
    5::142     3e-06  26%  166 aa  Y1569_STAAB RecName: Full=Putative universal stress protein
    5::142     3e-06  26%  166 aa  Y1532_STAAN RecName: Full=Putative universal stress protein SA1532;
  107::161     4e-06  40%  175 aa  USPAL_ARATH RecName: Full=Universal stress protein A-like protein;
   35::137     2e-05  35%  143 aa  YB54_METTM RecName: Full=Uncharacterized protein ORF143 in mtr
    5::142     2e-05  25%  165 aa  Y1215_STAHJ RecName: Full=Putative universal stress protein SH1215;
    5::142     3e-05  25%  167 aa  Y1056_STAS1 RecName: Full=Putative universal stress protein
   93::140     5e-05  52%  146 aa  Y1154_METTH RecName: Full=Uncharacterized protein MTH_1154;
    5::142     7e-05  24%  166 aa  Y1385_STAES RecName: Full=Putative universal stress protein
    5::142     7e-05  24%  166 aa  Y1273_STAEQ RecName: Full=Putative universal stress protein
   82::136     1e-04  38%  137 aa  YQA3_THEAQ RecName: Full=Uncharacterized protein in QAH/OAS
  217::283     1e-04  28%  287 aa  Y1230_SYNY3 RecName: Full=Uncharacterized protein slr1230;
   61::141     3e-04  32%  142 aa  USPG_SHIFL RecName: Full=Universal stress protein G;
   61::141     3e-04  32%  142 aa  USPG_ECOLI RecName: Full=Universal stress protein G;
   61::141     3e-04  32%  142 aa  USPG_ECO57 RecName: Full=Universal stress protein G;
   43::93      3e-04  31%  107 aa  SP5G_STACT RecName: Full=Putative septation protein spoVG;
   43::91      3e-04  33%  100 aa  SP5G_STAHJ RecName: Full=Putative septation protein spoVG;
   43::91      3e-04  33%  102 aa  SP5G_STAES RecName: Full=Putative septation protein spoVG;
   43::91      3e-04  33%  102 aa  SP5G_STAEQ RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAAW RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAAS RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAAN RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAAM RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAAE RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAAC RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAAB RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAA9 RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAA8 RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAA3 RecName: Full=Putative septation protein spoVG;
   43::91      4e-04  31%  100 aa  SP5G_STAA2 RecName: Full=Putative septation protein spoVG;
   61::141     6e-04  31%  142 aa  USPG_ECOL6 RecName: Full=Universal stress protein G;
   43::91      6e-04  31%  100 aa  SP5G_STAAR RecName: Full=Putative septation protein spoVG;
  875::937     7e-04  29% 1235 aa  SLK_HUMAN RecName: Full=STE20-like serine/threonine-protein kinase;
  871::936     0.001  26% 1231 aa  SLK_CAVPO RecName: Full=STE20-like serine/threonine-protein kinase;
    1::152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxEDIIVTVDGSENXXXXXXXXXXXXXXXXNKMTLLYVFPTRATSDFDFLSITHPEEEDNEQL
Y531_METJA      --------------------------------------------------------------------EL
YXIE_BACSU      -----------MLVAIDGSDMSAKALDAAVHLAKEQQAELSILHVGREAVVTTSSLTGIVYVPEHFIDEI
NHAX_BACSU      -----------IIVAFDGSENSKKALLTAIDLAKTVNAAITVAHIDPPRPAAEASYISVTSPEP----MI
Y577_METJA      --------------------------------------EVILLHVIDEREIKKRDIFSLLSVEEFENELK
Y1819_STAA8     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
Y1788_STAAR     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
Y1759_STAAC     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
Y1710_STAAM     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
Y1656_STAA3     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
Y1653_STAAW     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
Y1637_STAAS     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
Y1569_STAAB     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
Y1532_STAAN     ---------KNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFA-
USPAL_ARATH     ----------------------------------------------------------------------
YB54_METTM      ------------------------------------------LYVVDTSVP----FLTPKKVKEMMVKEL
Y1215_STAHJ     ---------KNILIAVDGSHEAEWAFNKAVDVAKRNDAKLTIVNIIDSRTYSSYEVYDAQFTEKSRSFS-
Y1056_STAS1     ---------KSILIAVDGSHEAEWAFNKAVDVAKRNDAKLTVVNVIDSRTYSSYEVYDAQFTEKSKNFS-
Y1154_METTH     ----------------------------------------------------------------------
Y1385_STAES     ---------KNILIAVDGSHEAEWAFNKAVGVAKRNDAQLTIVNVIDSRTYSSYEVYDAQFTEKSKHFS-
Y1273_STAEQ     ---------KNILIAVDGSHEAEWAFNKAVGVAKRNDAQLTIVNVIDSRTYSSYEVYDAQFTEKSKHFS-
YQA3_THEAQ      ----------------------------------------------------------------------
Y1230_SYNY3     ----------------------------------------------------------------------
USPG_SHIFL      ------------------------------------------------------------HLQHEAEERL
USPG_ECOLI      ------------------------------------------------------------HLQHEAQERL
USPG_ECO57      ------------------------------------------------------------HLQHEAEERL
SP5G_STACT      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAHJ      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAES      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAEQ      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAAW      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAAS      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAAN      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAAM      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAAE      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAAC      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAAB      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAA9      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAA8      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAA3      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SP5G_STAA2      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
USPG_ECOL6      ------------------------------------------------------------HLQHEAEERL
SP5G_STAAR      -----------------------------------------LFVAMPSKRTPDGEFRDIAHPINSDMRQE
SLK_HUMAN       ----------------------------------------------------DQEIENLEKQQKQTIERL
SLK_CAVPO       ----------------------------------------------------DQEIENLEKQQKQTIERL


                         .         .         *         .         .         .         .:140
query           KKETARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLEKRPNTITVIGRRGLSRFEALLLGSVSEKV
Y531_METJA      LKEEGQEALKKVKKMAEEWGVKIHTEMLEGVPANEIVEFAEKKKADLIVMGTTGKTGLERILLGSVAERV
YXIE_BACSU      RNEVKKKILENAKEKAAEKGVQAETIYANGEPAHEILNHAKEKGVSLIVVGSRGISGLKEMMLGSVSHKV
NHAX_BACSU      YEDRTEEVIAEARMMLNEQQADGDIDILEGDPAESIIEHANRISADMIVTGSRDQNRLKKLIFGSVSEKL
Y577_METJA      NKEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENV
Y1819_STAA8     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
Y1788_STAAR     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
Y1759_STAAC     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
Y1710_STAAM     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
Y1656_STAA3     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
Y1653_STAAW     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
Y1637_STAAS     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
Y1569_STAAB     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
Y1532_STAAN     --EELLNGYKEVATNAGVKDVETRLEF--GSPKSIIPKKLAHEINADLIMGTSGLNAVERFIVGSVSESI
USPAL_ARATH     --------------------------IKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFC
YB54_METTM      TERGKEILRDMEKGLTGPENPNVKFRMLEGNPADEIVKLAEEEDVDVIIMGT-GKSLVDKHLLGSVSEKV
Y1215_STAHJ     --EELLKGYQEVATRAGVTNVETRLEF--GSPKAIIPKKLASELGVLIMCGTSGLNAVERFIVGSVSEAI
Y1056_STAS1     --DDLLKGYKEVATNAGVKNVETRLEF--GSPKAIIPKKLATDVDALIMCGTSGLNAVERFIVGSVSEAI
Y1154_METTH     -----------------------------GDPADEIVKVAEEEDVDVIVMGT-GKSLVDKHLLGSVSEKV
Y1385_STAES     --EELLKGYKEVATNAGVKNVDTRLEF--GSPKAIIPKKLARDVGADLIMGTSGLNAVERFIVGSVSEAI
Y1273_STAEQ     --EELLKGYKEVATNAGVKNVDTRLEF--GSPKAIIPKKLARDVGADLIMGTSGLNAVERFIVGSVSEAI
YQA3_THEAQ      --------------------------LLQGRPAEAILQAAIGEKADLIVMGTRGLGAVGSLFLGSQSQKV
Y1230_SYNY3     -----------AEKVLEKAGFKLEVELLVGHAEEAIVRYQEDNAIDLLLMGAHGHSRIRHLVIGSTTAQV
USPG_SHIFL      QTMVSHFTIDPSR---------IKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSV
USPG_ECOLI      QTMVSHFTIDPSR---------IKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSV
USPG_ECO57      QTMVSHFTIDPSR---------IKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSV
SP5G_STACT      IQDAVMKVYDETDEVIPDKNAQ------------------------------------------------
SP5G_STAHJ      IQDAVMKVYDETDEVIPDKN--------------------------------------------------
SP5G_STAES      IQDAVMKVYDETDEVIPDKN--------------------------------------------------
SP5G_STAEQ      IQDAVMKVYDETDEVIPDKN--------------------------------------------------
SP5G_STAAW      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAAS      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAAN      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAAM      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAAE      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAAC      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAAB      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAA9      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAA8      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAA3      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
SP5G_STAA2      IQDAVMKVYDETDEVVPDKN--------------------------------------------------
USPG_ECOL6      QTMVSHFTIDPSR---------IKQHVRFGSVRDEVNELAKELDADVVVIGSRNPS-ISTHLLGSNASSV
SP5G_STAAR      IQDAVMKVYDEIDEVVPDKN--------------------------------------------------
SLK_HUMAN       EQEHTNRLRDEAKRIKGEQEKELKFQNMLKNRKKEVINEVEKAP--------------------------
SLK_CAVPO       EQEHTNRLRDEAKRIKGEQEKELKFQNILKNRKKEVLNEVEKAPKDL-----------------------


                         +         .         .         .         .         *         .:210
query           VRHASGPVTIIx
Y531_METJA      IKNAHCPVLVV-
YXIE_BACSU      SQLSTCPVLIV-
NHAX_BACSU      SAKSDIPVLIV-
Y577_METJA      IKKSNKPVLVV-
Y1819_STAA8     VRHAPCDVLVV-
Y1788_STAAR     VRHAPCDVLVV-
Y1759_STAAC     VRHAPCDVLVV-
Y1710_STAAM     VRHAPCDVLVV-
Y1656_STAA3     VRHAPCDVLVV-
Y1653_STAAW     VRHAPCDVLVV-
Y1637_STAAS     VRHAPCDVLVV-
Y1569_STAAB     VRHAPCDVLVV-
Y1532_STAAN     VRHAPCDVLVV-
USPAL_ARATH     VKHAECPVMTI-
YB54_METTM      VHYA--PCTI--
Y1215_STAHJ     VRHAPCDVLVV-
Y1056_STAS1     VRHSPCDVLVV-
Y1154_METTH     VHYA--PCTI--
Y1385_STAES     VRHAPCDVLVV-
Y1273_STAEQ     VRHAPCDVLVV-
YQA3_THEAQ      VAEAPCPVLLV-
Y1230_SYNY3     LRKTSIPV----
USPG_SHIFL      IRHANLPVLVV-
USPG_ECOLI      IRHANLPVLVV-
USPG_ECO57      IRHANLPVLVV-
SP5G_STACT      ------------
SP5G_STAHJ      ------------
SP5G_STAES      ------------
SP5G_STAEQ      ------------
SP5G_STAAW      ------------
SP5G_STAAS      ------------
SP5G_STAAN      ------------
SP5G_STAAM      ------------
SP5G_STAAE      ------------
SP5G_STAAC      ------------
SP5G_STAAB      ------------
SP5G_STAA9      ------------
SP5G_STAA8      ------------
SP5G_STAA3      ------------
SP5G_STAA2      ------------
USPG_ECOL6      IRHANLPVLVV-
SP5G_STAAR      ------------
SLK_HUMAN       ------------
SLK_CAVPO       ------------