[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57974.1

[Show Plain Result]


## Summary of Sequence Search
    1::120
    1::117     1e-16  38%  118 aa  Y714_METJA RecName: Full=Uncharacterized protein MJ0714;
    1::113     2e-16  41%  114 aa  Y1340_METJA RecName: Full=Uncharacterized protein MJ1340;
    1::113     5e-16  40%  114 aa  Y310_METJA RecName: Full=Uncharacterized protein MJ0310;
    1::120

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRADMLTAVLNDLNSTSADIEASGVISTDGLMIAAVLPTTLDEDRVGAMSAAMLSLGDRSAKELERGALE
Y714_METJA      MVESMIDRVLLELNRTDG-VKGSMVVGKDGLVIASQLPGNVDAELVGXXXXXXXXXXERTSSEIGLSGLE
Y1340_METJA     ----MIDRVLLELNKTEG-IKGSMVVGKDGLVIASQLPGSVDAELVGXXXXXXXXXXXXXXXEIGMGTLE
Y310_METJA      ----MIDRVLLELNKTEG-IKGSMVVGKDGLVIASQLPGSVDAELVGXXXXXXXXXXXXXXXEIGMGTLE


                         .         .         *         .         .         .         .:140
query           QVLIKGDHGYVLMTYAGDEAVLTVMAKPRAKLGLIFLDVKRAAESIASMx
Y714_METJA      QTMIEGEHGKTLMVDAG-EGILVVLTDAKVNLGLIRITMKRAADKIKAM-
Y1340_METJA     QTMIEGEHGKTLMVDAG-EGILVVLTDAKVNLGLIRITMKRAAEKIKAM-
Y310_METJA      QTMIEGEHGKTLMVDAG-EGILVVLTDAKVNLGLIRITMKRAADKIKAM-