[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57977.1

[Show Plain Result]


## Summary of Sequence Search
    1::366
    1::349     e-115  57%  350 aa  AROG_ECOLI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    1::349     e-115  57%  350 aa  AROG_ECO57 RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   13::358     e-108  54%  362 aa  AROG_HAEIN RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   19::366     3e-97  52%  368 aa  AROF_SCHPO RecName: Full=Putative
    8::342     8e-94  49%  356 aa  AROF_ECOLI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    8::342     5e-93  49%  356 aa  AROF_SALTY RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    8::342     5e-93  49%  356 aa  AROF_SALTI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   18::367     2e-92  49%  372 aa  AROG_SCHPO RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     3e-91  48%  348 aa  AROH_ENTAG RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     3e-89  47%  348 aa  AROH_SALTY RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     6e-89  46%  348 aa  AROH_SALTI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     2e-88  46%  348 aa  AROH_ECOLI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     2e-88  46%  348 aa  AROH_ECO57 RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     2e-88  46%  348 aa  AROH_ECOL6 RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     3e-88  46%  348 aa  AROH_SHIFL RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   15::370     2e-87  48%  370 aa  AROF_YEAST RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     3e-87  48%  348 aa  AROH_BUCBP RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     6e-86  47%  348 aa  AROH_BUCAP RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   21::370     8e-86  49%  370 aa  AROG_YEAST RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::347     7e-85  46%  348 aa  AROH_BUCAI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    7::368     4e-83  48%  370 aa  AROG_CANAL RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   15::368     1e-79  47%  368 aa  AROF_CANAL RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   13::337     2e-75  46%  366 aa  AROG_CORGL RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    4::202     2e-58  54%  213 aa  AROF_ENTAG RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   35::203     8e-44  47%  203 aa  AROG_AMYME RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    1::366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSFPTEDLRIKNIQEVIPPAQLHEGLPITSEASKTVYRTRQAIQEVLGGKDDRLLVVAGPCSIHDPQAAR
AROG_ECOLI      MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPVAAK
AROG_ECO57      MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPVAAK
AROG_HAEIN      -----DDTRIEKVDQVLPPIALLEKYPASEQAAALVKQTRHEAHNIIHGKDDRLLVVIGPCSIHDPKAAI
AROF_SCHPO      ----TEDSRIKGYDPVISPALIQSELAASDETLAFVSDQRRQAADIIAGRDDRLLLIVGPCSLHDPVAAK
AROF_ECOLI      ------NVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETAL
AROF_SALTY      ------NVRITDEQVLMTPEQLKAAFPLSLAQEAQIAQSRGIISDIIAGRDPRLLVVCGPCSIHDPETAL
AROF_SALTI      ------NVRITDEQVLMTPEQLKAAFPLSLAQEAQIAQSRGIISDIIAGRDPRLLVVCGPCSIHDPETAL
AROG_SCHPO      -----DDNRVLGYNPLVPAALVQQEIPVSETSRKVITDSRKEIQAILNKQDDRIIVVVGPCSIHDPKLAM
AROH_ENTAG      ----TDELRTARIGSLITPPSLAAEHPVSPAIADNVTAARKRIACILTGEDHRLLVVIGPCSLHDPKAAL
AROH_SALTY      ----TDELRTARIDSLVTPTELAQRYPVSSSVASHVTDSRRRIEKILNGEDPRLLVVIGPCSIHDLNAAM
AROH_SALTI      ----TDELRTARIDSLVTPTELAQRYPVSSSVASHVTDSRRRIEKILNGEDPRLLVVIGPCSIHDLNAAM
AROH_ECOLI      ----TDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAM
AROH_ECO57      ----TDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAM
AROH_ECOL6      ----TDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAM
AROH_SHIFL      ----TDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAM
AROF_YEAST      -----EDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHDPKAAY
AROH_BUCBP      ----TDELRTIRIDPLVTPAELAQRHVITPSIMDTVISTRKNIANIMTGLDPRLLVIIGPCSVHDPVAAV
AROH_BUCAP      ----TDELRTIRIDPLITPSELAKKYAITSEIMDNVIITRQNIARIMTGEDLRLLVVIGPCSVHDPIAAV
AROG_YEAST      -----EDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHDLEAAQ
AROH_BUCAI      ----TDELRTIRIDPLITPAELARQYAITSDIMDTVIATRQNIARIMTGQDARLLVVIGPCSVHDPIAAV
AROG_CANAL      ---PTEDTRILGYDPLVPPALLQHEIKASAESLDVVIKGRYDSAQILKGNDDRCIVIVGPCSIHDPPQAL
AROF_CANAL      -----EDWRIRGYDPLTPPDLLQHEYPLTPESQKIIVEGRNAACDILNGKDRRLI---GPCSIHDPQAAL
AROG_CORGL      ----TSNKRVVAFHELPSPTDLIAANPLTPKQASKVEQDRQDIADIFAGDDDRLVVVVGPCSVHDPEAAI
AROF_ENTAG      ----------------------------------------------------------------------
AROG_AMYME      -----DNQRTLGVSPLISPALLRQELPVDAAIAKTVAHGRSSAVDILHGDDDRLIVVVGPCSVHDPAAAL


                         .         .         *         .         .         .         .:140
query           DYGKRXXXXXXXXXXXXXXVMRVYFEKPRSTVGWKGLINDPHLDGSFQINEGXXXXXXXXXXXXETGVPA
AROG_ECOLI      EYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
AROG_ECO57      EYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
AROG_HAEIN      EYATRLKPLREKYKDSLEIIMRVYFEKPRTTVGWKGLINEPYLNDTYRLNDGLRIARKLLSDINDLGVPA
AROF_SCHPO      EYAIRLQKEAIKHKKDLHIIMRAYLEKPRTTVGWKGLINDPDLDGSYNINKGIRVARRIFLELLETGVGI
AROF_ECOLI      EYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLELVNMGLPL
AROF_SALTY      EYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLKIARQLLVELVNMGLPL
AROF_SALTI      EYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLKIARQLLVELVNMGLPL
AROG_SCHPO      DYAKLLKPKADELQDALCVVMRCYLEKPRTTIGWKGLVNDPNLDGSFAINKGIRMARQMYCDVTNFGIPL
AROH_ENTAG      EYAERLNALRRRYEDRLEIVMRAYFEKPRTVVGWKGLISDPDLDGSYDVNRGIGIARQLLIDINALGLPT
AROH_SALTY      EYATQLQAQRQKHQARLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNYGLELARRLLLQVNELGVPT
AROH_SALTI      EYATQLQAQRQKHQARLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARRLLLQVNELGVPT
AROH_ECOLI      EYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARKLLLQVNELGVPT
AROH_ECO57      EYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRINHGLELARKLLLQVNELGVPT
AROH_ECOL6      EYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARKLLLQVNELGVPT
AROH_SHIFL      EYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARKLLLQVNELGVPT
AROF_YEAST      DYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRISREMFIKLVEK-LPI
AROH_BUCBP      EYAGRLQVLRKKYESRLEIVMRTYFEKPRTVIGWKGLISDPDLNGSFHVNNGLSIARKLLLDINKLGVPA
AROH_BUCAP      EYAHRLYELRKKYQDRLEIIMRTYFEKPRTVVGWKGLISDPDLNGSFRVNHGLAVARKLLLDINELGMPA
AROG_YEAST      EYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQSARQLFVNLTNIGLPI
AROH_BUCAI      EYAHRLYELRVKYKDRLEIIMRTYFEKPRTVVGWKGLISDPDLNGSFRVNHGLAVARKLLLDINALGMPA
AROG_CANAL      EYGXXXXXXXXXXXXXXVIIMRAYLEKPRTTVGWKGLINDPDVDNSFDINRGLKISRQLYSDLTSVGLPI
AROF_CANAL      DYCERLYQASEKHKGELLIVMRAYLEKPRTTVGWKGLINDPDIDGTFHINKG-LRIARKLFVQLTSKLPI
AROG_CORGL      DYANRLAPLAKRLDQDLKIVMRVYFEKPRTIVGWKGLINDPHLNETYDIPEGLRIARKVLIDVVNLDLPV
AROF_ENTAG      ----------------------------------------------------------------------
AROG_AMYME      DYAHRLAEHAAGVRDELHVIMRVYFEKPRTTLGWKGLINDPDLDGSYAVNKGLRMARKLLLDISALGLPV


                         +         .         .         .         .         *         .:210
query           GTEYLDLVSPQYIADLIAWGAIGARTTESQVHRELASGLSCPVGFKNATNGSLGAAMSAIVSASKPHHFL
AROG_ECOLI      AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
AROG_ECO57      AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
AROG_HAEIN      AGEFLDMITPQYLADFMSWGAIGARTTESQVHRELASGLSCAVGFKNATNGGVKVALDAIGAAEAPHYFL
AROF_SCHPO      ASEMLDTISPQYLADLICWGAIGARTTESQLHRELASGLSFPIGFKNATDGNIGIAIDAMNSSANPHHFL
AROF_ECOLI      ATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFV
AROF_SALTY      ATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFV
AROF_SALTI      ATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFV
AROG_SCHPO      ASEMLDNISPQFFADLLSFGAIGARTTESQLHRELASALSFPVGFKNGTDGTVGVAIDAIGATAHPHTML
AROH_ENTAG      ATEFLDMVIGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNVQIAVDAIRAARASHMFL
AROH_SALTY      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTRIAVDAIRASRASHMFL
AROH_SALTI      ATEFLDMVTGQFIADLISWGTIGARTTESQIHREMASALSCPVGFKNGTDGNTRIAVDAIRASRASHMFL
AROH_ECOLI      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTXXXXXXXXXXXXSHMFL
AROH_ECO57      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTXXXXXXXXXXXXSHMFL
AROH_ECOL6      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTXXXXXXXXXXXXSHMFL
AROH_SHIFL      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTXXXXXXXXXXXXSHMFL
AROF_YEAST      AGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFL
AROH_BUCBP      ATEFLDMVIGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNIRIAVDAIRAASVEHLFL
AROH_BUCAP      ATEFLDMVIGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNXXXXXXXXXXXXXXHLFF
AROG_YEAST      GSEMLDTISPQYLADLVSFGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLNVAVDACQAAAHSHHFM
AROH_BUCAI      ATEFLDIVIGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNXXXXXXXXXXXKVRHLFF
AROG_CANAL      GSEMLDTISPQYFSDFLSFGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLAVALDAVQASSKGHHFM
AROF_CANAL      AGEMLDTISPQFLSDLFSVGAIGARTTESQLHRELASGYHSQLDSKTVPMVLWVLPLTPLRAASHPHHFL
AROG_CORGL      GCEFLEPNSPQYYADTVAWGAIGARTTESQVHRQLASGMSMPIGFKNGTDGNIXXXXXXXXXXXNPHFFF
AROF_ENTAG      --------SPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLGTAINAMRAAAMPHRFV
AROG_AMYME      GCEFLDPITPQFIADTVSWGSIGARTAASQVHRQ------------------------------------


                         .         .         .         +         .         .         .:280
query           SLTLAGRSAIFSTAGNPDCHLILRGGQKPNYDAASVNETAHNLIQTGLRPQVMIDCSHGNSSKNPKKQVL
AROG_ECOLI      SVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMD
AROG_ECO57      SVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMD
AROG_HAEIN      SVTKFGHSAIVSTKGNEDCHIILRGGDKPNYSAEDVEKVCADIEKTGRIPHVMVDFSHANSSKQYKKQMD
AROF_SCHPO      SVTKQGVVAIVTTTGNPDTHIILRGGKSTNFDADSVAGAKAKLEECNKLPSIMIDCSHGNSSKNHKNQPK
AROF_ECOLI      GINQAGQVALLQTQGNPDGHVILRGGKAPNYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPA
AROF_SALTY      GINQAGQVALLQTQGNPHGHVILRGGKAPNYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPA
AROF_SALTI      GINQAGQVALLQTQGNPHGHVILRGGKAPNYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPA
AROG_SCHPO      GVTKQGLAAITMTRGNKDTFIILRGGKKPNYDAEHVAAVRKDLEKANLPPRIMIDCSHGNSSKNHLNQPK
AROH_ENTAG      SPDKLGQMTIYQTSGNPHGHVILRGGKQPNYHASDVAAAAESLSAFNLPQQLVIDFSHGNCLKQHRRQMD
AROH_SALTY      SPDKDGQMTIYQTSGNPYGHIIMRGGKKPNYHAEDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_SALTI      SPDKDGQMTIYQTSGNPYGHIIMRGGKKPNYHAEDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLD
AROH_ECOLI      SPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_ECO57      SPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_ECOL6      SPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_SHIFL      SPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROF_YEAST      SVTKPGVTAIVGTEGNKDTFLILRGGKNTNFDKESVQNTKKQLEKAGLQKRIMIDCSHGNSNKDFKNQPK
AROH_BUCBP      APNKYGQMTINYTSGNPFGHVIMRGGKSPNYHAKDIAIAIKYLHEFTLSEYLMIDFSHGNCLKQHRRQLD
AROH_BUCAP      APNKDGQMTINHTSGNPYGHIIMRGGRTPNYHAHDINSAIEHLREFNLLEHLMIDFSHGNCLKEHIRQKD
AROG_YEAST      GVTKHGVAAITTTKGNEHCFVILRGGKKTNYDAKSVAEAKAQLPSNGL----MIDYSHGNSNKDFRNQPK
AROH_BUCAI      APNKDGQMTINHTSGNPYGHIIMRGGRAPNYHPDDINSAVKHLREFDLLEHLMIDFSHGNCLKEHLRQKN
AROG_CANAL      GVTKNGMAAITTTKGNDCCFIILRGGKKTNYDVESVKAAKEAIAKTDPSIKLMVDCSHDNSRKDYRNQPQ
AROF_CANAL      SVTKPGVVAIVGTDGNQDCFVILRGGKKTNYDAKSVQETQEELIKSKVGPRIMVDCSHGNSNKDHRNQPK
AROG_CORGL      GTSDDGALSVVETAGNSNSHIILRGGTSPNHDAASVEAVVEKL---GENARLMIDASHANSGKDHIRQVE
AROF_ENTAG      GINQAGQVCLLQTQGNPDGHVILRGGKAPNYGPEDVAQCEKEMLKAGLRPALMIDCSHGNSNKDYSRQPG
AROG_AMYME      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VARDIAGQIAAGDRRIMGVMLESHLVAGRQDVIPNTPLTYGQSITDACIGWEESEQLLREFARAIQKRRQ
AROG_ECOLI      VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARR-
AROG_ECO57      VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARR-
AROG_HAEIN      VCQDVCNQIAFGSKQIFGVMVESHLVEGRQDLVDGKAQTYGQSITDACIGWEDSERLLQQLSDAVIARRK
AROF_SCHPO      VAACIAEQVANGQKAITGVMIESHLNEGKQ-AIPEDDLSYGVSVTDACIGWDDTTAVFEQLAAAVRSRR-
AROF_ECOLI      VAESVVAQIKDGNRSIIGLMIESNIHEGNQSEQPRSEMKYGVSVTDACISWEMTDALLRE----------
AROF_SALTY      VAESVVAQIKDGNRSIIGLMIESNIHEGNQSEQPRSEMKYGVSVTDACISWEMTDALLRE----------
AROF_SALTI      VAESVVAQIKDGNRSIIGLMIESNIHEGNQSEQPRSEMKYGVSVTDACISWEMTDALLRE----------
AROG_SCHPO      VSKSIAEQIRNGDSSIVGVMIESHINEGRQDA-PIRPLKYGVSITDACVSWEQTAPMLDDLAEAVRARRQ
AROH_ENTAG      VAAEVAEQIKAGSQAVAGVMIESFLEEGNQKVVSGEPLVYGKSITDPCLGWQESEKVLALLAEAVSHR--
AROH_SALTY      VCDDICQQIRNGSTAIAGIMAESFLREGTQKIISGQPLIYGQSITDPCLNWEDTEVLLEKLAAAVDSR--
AROH_SALTI      VCDDICQQIRNGSTAIAGIMAESFLREGTQKIISGQPLIYGQSITDPCLNWEDTEVLLEKLAAAVDSR--
AROH_ECOLI      VCEDICQQIRNGSTAIAGIMAESFLREGTQKIVGSQPLTYGQSITDPCLGWEDTERLVEKLASAVDTR--
AROH_ECO57      VCEDICQQIRNGSTAIAGIMAESFLREGTQKIVGGQPLTYGQSITDPCLGWEDTERLVEKLASAVDTR--
AROH_ECOL6      VCEDICQQIRNGSTAIAGIMAESFLREGTQKIVGGQPLTYGQSITDPCLGWEDTERLVEKLASAVDTR--
AROH_SHIFL      VCEDICQQIRNGSTEIAGIMAESFLREGTQKIVGGQPLTYGQSITDPCLGWEDTERLVEKLAFAVDTR--
AROF_YEAST      VAKCIYDQLTEGENSLCGVMIESNINEGRQDIPKREGLKYGCSVTDACIGWESTEQVLELLAEGVRNRRK
AROH_BUCBP      VGESIAKQIRDGSTAIFGVMIESFLEEGSQKVIDNKSLVYGKSITDPCLGWNDSAFLLEKLANAVDSR--
AROH_BUCAP      VAKSVSKQISQGSKTIFGVMIESFLEEGFQTVKENQPLIYGKSITDACLNWKDSVLIIKQLADAVDTR--
AROG_YEAST      VNDVVCEQIANGENAITGVMIESNINEGNQGIPAKAGLKYGVSITDACIGWETTEDVLRKLAAAVRQRRE
AROH_BUCAI      VSKSVSYQISHGSKAIFGVMIESFLEEGFQTVTNNQPLIYGKSITDACLNWKDSVLIIEQLADAVDAR--
AROG_CANAL      VLDSVAEQISNGEDSIIGVMIESNIHEGKQPMPPKEALKYGVSITDGCVSWETTVEMLTKLSQAVQTRRS
AROF_CANAL      XXXXXXXXXXGGDKSICGLMIESNINDGRQDVPPKDALKYGVSITDACIGWETTEEVLEVLANAVKTRRS
AROG_CORGL      VVREIAEQISGGSEAVAGIMIESFLVGGAQNLDPGEGLVYGQSV--------------------------
AROF_ENTAG      VAESAIAQIKDGNRSIIGLMLESHINEGNQSEQPRSEMKYGVSVTDACINWEVTETLLREMHQDLQ----
AROG_AMYME      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           MPEKHIxxxxxxxxxx
AROG_ECOLI      ----------------
AROG_ECO57      ----------------
AROG_HAEIN      ----------------
AROF_SCHPO      ----------------
AROF_ECOLI      ----------------
AROF_SALTY      ----------------
AROF_SALTI      ----------------
AROG_SCHPO      ----------------
AROH_ENTAG      ----------------
AROH_SALTY      ----------------
AROH_SALTI      ----------------
AROH_ECOLI      ----------------
AROH_ECO57      ----------------
AROH_ECOL6      ----------------
AROH_SHIFL      ----------------
AROF_YEAST      ALKK------------
AROH_BUCBP      ----------------
AROH_BUCAP      ----------------
AROG_YEAST      VNKK------------
AROH_BUCAI      ----------------
AROG_CANAL      LKKQKV----------
AROF_CANAL      L---------------
AROG_CORGL      ----------------
AROF_ENTAG      ----------------
AROG_AMYME      ----------------