[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA57987.1

[Show Plain Result]


## Summary of Sequence Search
    1::397
    7::354     2e-39  36%  402 aa  YSNA_STRPR RecName: Full=Uncharacterized 45.4 kDa protein in
    1::116     1e-27  59%  119 aa  VSDF_SALDU RecName: Full=Virulence protein vsdF;
    4::392     6e-24  26%  402 aa  YDCM_ECOLI RecName: Full=Uncharacterized protein ydcM;
   13::406     7e-14  29%  460 aa  Y2885_MYCTU RecName: Full=Uncharacterized protein
  395::520     8e-08  27%  527 aa  YR854_MIMIV RecName: Full=Putative transposase R854;
  388::513     8e-08  27%  520 aa  YL770_MIMIV RecName: Full=Putative transposase L770;
  388::513     8e-08  27%  520 aa  YL079_MIMIV RecName: Full=Putative transposase L79;
  253::372     7e-06  26%  414 aa  Y1635_METJA RecName: Full=Uncharacterized protein MJ1635;
  412::532     6e-05  23%  545 aa  YR104_MIMIV RecName: Full=Putative transposase R104;
    1::397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLKATKIRLYPTREQAEFLNRQFGSVRFCYNTGLRIMSHRYKRHGQSLSAKYDIKKLLPVAKKSRKYGWL
YSNA_STRPR      --RAFKYRFYPTDEQAAELSRTFGCVRLVYNKALEGRTRAW--YGEQRRVSYQSSAALTEWKKTEELAFL
VSDF_SALDU      MLRATKVCIYPTPEQAEHLNAQFGAVRFVYSKSLHIKKHAYQRHGVSLTPRKDIKPLLAVAXXXXXYAWL
YDCM_ECOLI      -LQAFKFQLRPGGQQECEMRRFAGACRFVFNRALARQNENHEA-GNKYIPYGKMASWLVEWKNATETQWL
Y2885_MYCTU     -VQAFRFTLNPTQTQAASLARHFGARRKAFNTALKADIKAWRADGTELRKRWNTVKDQVCVNAQTGQVWW
YR854_MIMIV     ----------------------------------------------------------------------
YL770_MIMIV     ----------------------------------------------------------------------
YL079_MIMIV     ----------------------------------------------------------------------
Y1635_METJA     ----------------------------------------------------------------------
YR104_MIMIV     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KEADSVALAQACINLDKAFQRFFKEKKGYPRFKRKRGKQSSYHCMSVSCGESWVKVPKLGPIKARVHRSV
YSNA_STRPR      SEVSSVPLQQALRHLQTAFANFFXXXXXXXXXXXXXXXXXEYTRSAFTWRNGQLTLAKTAPLDIRWSRPL
VSDF_SALDU      KEYDSIALQQAVINLDVAFSNCFKLKARFPMFKRKHGK--------------------------------
YDCM_ECOLI      KDSPSQPLQQSLKDLERAYXXXXXXXXXXXXXXXXGQNDAFRYPQGVKLDQSRIFLPKLGWMRYRNSRQV
Y2885_MYCTU     PECSKEAYADGIAGAVDAYWNWQSKTVGVPRFKKK-GRDADRVCMRVEPDRRHLTLPVIGTIRTRVERLI
YR854_MIMIV     ----------------------------------------------------------------------
YL770_MIMIV     ----------------------------------------------------------------------
YL079_MIMIV     ----------------------------------------------------------------------
Y1635_METJA     ----------------------------------------------------------------------
YR104_MIMIV     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGKLKSITLSRTVTGKHYASLLYETEQPVPEPMTAIDATKVLGLDMGLSHLAIDSTGRKVANPRFIKQVQ
YSNA_STRPR      EGEPTTVTVSRDRAGRWFVSLLCEDXXXXXXXXXXX-----VGIDAGITSLVTLSTGEKITNPKHERRDR
VSDF_SALDU      ----------------------------------------------------------------------
YDCM_ECOLI      TGVVKNVTVSQSC-GKWYISIQTESEVSTPVHPSA----SMVGLDAGVAKLATLSDGTVFEPVNSFQKNQ
Y2885_MYCTU     RARVLAITVRRNGT-RLDASXXXXXXXXXXXXXALPDSXXXXXXXXXXLATVADAEGEQVPNPRPLDXXX
YR854_MIMIV     ----------------------------------------------------------------------
YL770_MIMIV     ----------------------------------------------------------------------
YL079_MIMIV     ----------------------------------------------------------------------
Y1635_METJA     ----------------------------------------------------------------------
YR104_MIMIV     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KNXXXXXXXXXXXXXXXXXXXXXXXXXXXXHERVADARSDFQHKLSRQIVDDNQAVIVETLKVNNMMKNA
YSNA_STRPR      ARLAKAQRDVSRKAKGSANXXXXXXXXXXXXXXITDRRCDFLHKLSTRLVRENQTVVIEDLTVRNLLKNG
VSDF_SALDU      ----------------------------------------------------------------------
YDCM_ECOLI      KKLARLQRQLSRKVKFSNNWQKQKRKIQRLHSCIANIRRDYLHKVTTAVSKNHAMIVIEDLKVSNMSKSA
Y2885_MYCTU     XXXXXXXXXXXXCTKGSRRYCERTTELSRLHRRVNDVRTHHLHVLTTRLAKTHGRIVVEGLDAAGMLRQK
YR854_MIMIV     ------------------------------HRRVTNKMKDMHYKVSHELVNTFDKICIGKLNVKSILSKA
YL770_MIMIV     ------------------------------HRRVTNKMKDMHYKVSHELVNTFDKICIGKLNVKSILSKA
YL079_MIMIV     ------------------------------HRRVTNKMKDMHYKVSHELVNTFDKICIGKLNVKSILSKA
Y1635_METJA     -------------------------------ERRRNRVKDFLHKLTIQLLFPDAIFVFEDLNKRRMYKSK
YR104_MIMIV     ------------------------------HKKIEHLQRELHYKTAIYLCENYQRIMVTDFSSKKVSSDA


                         .         *         .         .         .         .         +:350
query           KLAKHIGDASWHALIAKLAYKAKEQGKHLVKIDPWFASSKTCHVCQHKMDAMPLNIRSWACPTCHTRHDR
YSNA_STRPR      KLARAISDAAWTELRSMLEYKCAWYGRELVVIDRWFPSSKLCGTCGTVRGKLPLNVREWTC-DCGAVHDR
VSDF_SALDU      ----------------------------------------------------------------------
YDCM_ECOLI      ALNRSILDQGWYEMRRQLAYKQLWRGGQVLAVPPAYTSQR-CAYCGHTAKENRLSQSKFRCQVCGYTANA
Y2885_MYCTU     GLPGXXXXXXXXXXXXXLSYKTGWYGSSLVVADRWFPSSKTCHACRHVQDIG--WDEKWQCDGCSITHQR
YR854_MIMIV     NLKRKLATLSFYRFTQRLTHMGYKYGTEVVNVNEYL-TTKTCSNCGKIKDLGASKI--YECESCGMYADR
YL770_MIMIV     NLKRKLATLSFYRFTQRLTHMGYKYGTEVVNVNEYL-TTKTCSNCGKIKDLGASKI--YECESCGMYADR
YL079_MIMIV     NLKRKLATLSFYRFTQRLTHMGYKYGTEVVNVNEYL-TTKTCSNCGKIKDLGASKI--YECESCGMYADR
Y1635_METJA     YFNRKIDRVNWNGLIEKISYKT-----IVILVNPAYTST-ICPICGSRMESQEGQV--VYCSNCLNSFNR
YR104_MIMIV     MSKRILGKISHYRFRQRLQQKCEEFNCQYLEVEAW--TSKTCCNCGY-IHAKLGTSKIYDCPKCKQKRDR


                         .         .         .         .         *         .         .:420
query           DINAALNIQHQGILKLKAEGLSVSAHRGLRKxxxxxxxxxxxxxxxx
YSNA_STRPR      DV---------------------------------------------
VSDF_SALDU      -----------------------------------------------
YDCM_ECOLI      DVNGARNILAAGHAVL-ACGEMVQSGRPLKQ----------------
Y2885_MYCTU     DDNAAINL---------------------------------------
YR854_MIMIV     DENAAKNILKVGL----------------------------------
YL770_MIMIV     DENAAKNILKVGL----------------------------------
YL079_MIMIV     DENAAKNILKVGL----------------------------------
Y1635_METJA     QLVGCYNIFKRGLGNIK------------------------------
YR104_MIMIV     DVNGAINI---------------------------------------