[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58119.1

[Show Plain Result]


## Summary of Sequence Search
    1::258
    8::212     7e-53  52%  269 aa  NIFP_AZOCH RecName: Full=Probable serine acetyltransferase;        
    3::214     9e-53  51%  217 aa  CYSE_BACSU RecName: Full=Serine acetyltransferase;       
    1::206     6e-51  57%  244 aa  CYSE_SYNE7 RecName: Full=Serine acetyltransferase;       
    1::201     1e-50  54%  213 aa  CYSE_STAES RecName: Full=Serine acetyltransferase;       
    1::201     1e-50  54%  213 aa  CYSE_STAEQ RecName: Full=Serine acetyltransferase;       
    1::174     2e-50  54%  213 aa  CYSE_STAAW RecName: Full=Serine acetyltransferase;       
    1::174     2e-50  54%  213 aa  CYSE_STAAN RecName: Full=Serine acetyltransferase;       
    1::174     2e-50  54%  213 aa  CYSE_STAAM RecName: Full=Serine acetyltransferase;       
    1::174     2e-50  54%  213 aa  CYSE_STAAC RecName: Full=Serine acetyltransferase;       
    3::176     5e-50  53%  215 aa  CYSE_STAAS RecName: Full=Serine acetyltransferase;       
    3::176     5e-50  53%  215 aa  CYSE_STAAR RecName: Full=Serine acetyltransferase;       
    1::174     6e-49  54%  249 aa  CYSE_SYNY3 RecName: Full=Serine acetyltransferase;       
    6::180     2e-47  52%  216 aa  CYSE_STAXY RecName: Full=Serine acetyltransferase;       
    4::171     3e-44  57%  171 aa  CYSE_HELPJ RecName: Full=Serine acetyltransferase;       
    4::171     1e-43  56%  171 aa  CYSE_HELPY RecName: Full=Serine acetyltransferase;       
  108::287     2e-33  39%  323 aa  SAT2_ARATH RecName: Full=Serine acetyltransferase 2;       
  121::291     2e-33  41%  314 aa  SAT1_ARATH RecName: Full=Serine acetyltransferase 1;       
  148::314     3e-30  37%  355 aa  SAT4_ARATH RecName: Full=Serine acetyltransferase 4;       
  200::364     3e-30  39%  391 aa  SAT3_ARATH RecName: Full=Serine acetyltransferase 3, mitochondrial;
   83::244     3e-30  39%  274 aa  CYSE_BUCAI RecName: Full=Serine acetyltransferase;       
  139::303     6e-30  43%  319 aa  SRPH_SYNE7 RecName: Full=Serine acetyltransferase, plasmid;        
  161::331     4e-29  46%  354 aa  SAT2_ORYSJ RecName: Full=Probable serine acetyltransferase 2;      
   84::248     7e-29  38%  273 aa  CYSE_SHIFL RecName: Full=Serine acetyltransferase;       
   84::248     7e-29  38%  273 aa  CYSE_ECOLI RecName: Full=Serine acetyltransferase;       
   84::248     7e-29  38%  273 aa  CYSE_ECOL6 RecName: Full=Serine acetyltransferase;       
   84::248     7e-29  38%  273 aa  CYSE_ECO57 RecName: Full=Serine acetyltransferase;       
   80::260     2e-28  37%  267 aa  CYSE_HAEIN RecName: Full=Serine acetyltransferase;       
   84::244     6e-28  38%  273 aa  CYSE_SALTY RecName: Full=Serine acetyltransferase;       
  123::279     4e-25  36%  303 aa  SAT1_ORYSJ RecName: Full=Probable serine acetyltransferase 1;      
   83::241     1e-24  34%  261 aa  CYSE_BUCAP RecName: Full=Serine acetyltransferase;       
  120::285     8e-24  41%  312 aa  SAT5_ARATH RecName: Full=Serine acetyltransferase 5;       
  151::293     1e-23  36%  315 aa  SAT4_ORYSJ RecName: Full=Probable serine acetyltransferase 4;      
  156::312     2e-22  34%  340 aa  SAT5_ORYSJ RecName: Full=Probable serine acetyltransferase 5;      
   96::252     7e-21  31%  270 aa  SAT_SCHPO RecName: Full=Putative serine acetyltransferase;       
  145::252     2e-15  39%  301 aa  SAT3_ORYSJ RecName: Full=Probable serine acetyltransferase 3;      
   29::158     1e-12  35%  162 aa  WCAB_SHIFL RecName: Full=Putative colanic acid biosynthesis
   29::158     1e-12  35%  162 aa  WCAB_ECOLI RecName: Full=Putative colanic acid biosynthesis
   29::158     1e-12  35%  162 aa  WCAB_ECO57 RecName: Full=Putative colanic acid biosynthesis
   85::251     9e-10  25%  254 aa  CYSE_BUCBP RecName: Full=Serine acetyltransferase;       
   79::224     4e-09  32%  234 aa  DAPH_LEUCK RecName:
  109::224     6e-09  28%  233 aa  DAPH_THEAB RecName:
  109::224     8e-09  29%  233 aa  DAPH_PETMO RecName:
  109::222     2e-08  27%  232 aa  DAPH_STRSV RecName:
  109::222     2e-08  27%  232 aa  DAPH_STRGC RecName:
  107::222     2e-08  28%  231 aa  DAPH_THEM4 RecName:
  109::222     3e-08  25%  232 aa  DAPH_STRTD RecName:
  109::222     3e-08  25%  232 aa  DAPH_STRT2 RecName:
  109::222     3e-08  25%  232 aa  DAPH_STRT1 RecName:
  109::222     3e-08  27%  232 aa  DAPH_STRSY RecName:
  109::222     3e-08  27%  232 aa  DAPH_STRS2 RecName:
  109::222     6e-08  27%  232 aa  DAPH_STRZJ RecName:
  109::222     6e-08  27%  232 aa  DAPH_STRR6 RecName:
  109::222     6e-08  27%  232 aa  DAPH_STRPS RecName:
  109::222     6e-08  27%  232 aa  DAPH_STRPJ RecName:
  109::222     6e-08  27%  232 aa  DAPH_STRPI RecName:
  109::222     6e-08  27%  232 aa  DAPH_STRP7 RecName:
  109::222     6e-08  27%  232 aa  DAPH_STRP4 RecName:
  109::222     6e-08  27%  232 aa  DAPH_STRP2 RecName:
  109::222     8e-08  27%  232 aa  DAPH_STRZT RecName:
  109::222     8e-08  27%  232 aa  DAPH_STRZP RecName:
  109::222     8e-08  25%  232 aa  DAPH_STRU0 RecName:
  109::222     8e-08  27%  232 aa  DAPH_STRPN RecName:
   91::223     1e-07  33%  233 aa  DAPH_OENOB RecName:
  111::224     2e-07  26%  236 aa  DAPH_OCEIH RecName:
  113::226     2e-07  38%  240 aa  DAPH_BACSK RecName:
  113::232     3e-07  35%  236 aa  DAPH_LACPL RecName:
   91::232     2e-06  35%  239 aa  DAPH_STAAB RecName:
   78::190     5e-06  36%  196 aa  Y5507_DICDI RecName: Full=Putative acetyltransferase DDB_G0275507; 
  130::224     8e-06  39%  234 aa  DAPH_LACC3 RecName:
  113::226     8e-06  36%  236 aa  DAPH_GEOTN RecName:
  112::225     8e-06  34%  235 aa  DAPH_ANOFW RecName:
   91::232     1e-05  34%  239 aa  DAPH_STAAE RecName:
  127::237     1e-05  37%  245 aa  DAPH_METKA RecName:
   94::222     1e-05  34%  236 aa  DAPH_LACAC RecName:
  113::226     1e-05  34%  240 aa  DAPH_BACHD RecName:
  130::222     1e-05  34%  344 aa  LPXD_DESVH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
  130::224     2e-05  39%  234 aa  DAPH_LACCB RecName:
  113::226     2e-05  34%  236 aa  DAPH_GEOSW RecName:
  112::227     2e-05  25%  235 aa  DAPH_EXIS2 RecName:
  100::236     2e-05  37%  241 aa  DAPH_THETN RecName:
  109::222     3e-05  36%  233 aa  DAPH_THEP1 RecName:
   88::192     4e-05  30%  192 aa  ATRF2_STAHJ RecName: Full=Putative acetyltransferase SH0499;       
  222::343     7e-05  34%  355 aa  LPXD_AGRRK RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
  109::222     7e-05  34%  233 aa  DAPH_THESQ RecName:
  112::225     7e-05  34%  236 aa  DAPH_THEMA RecName:
  114::227     9e-05  34%  238 aa  DAPH_THENN RecName:
  111::224     9e-05  36%  234 aa  DAPH_LACS1 RecName:
  109::216     9e-05  36%  232 aa  DAPH_KOSOT RecName:
  107::184     1e-04  36%  380 aa  LPXD_RHOBA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
  373::449     1e-04  30%  468 aa  GLMU_RUBXD RecName: Full=Bifunctional protein glmU;Includes:
  118::226     1e-04  36%  240 aa  DAPH_BACWK RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACHK RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACCZ RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACCR RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACCQ RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACC7 RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACC4 RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACC3 RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACC2 RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACC1 RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACC0 RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACAN RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACAH RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACAC RecName:
  118::226     1e-04  36%  240 aa  DAPH_BACAA RecName:
   73::188     2e-04  28%  203 aa  THGA_ECOLI RecName: Full=Galactoside O-acetyltransferase;       
   94::226     3e-04  31%  236 aa  DAPH_LACH4 RecName:
   95::227     3e-04  31%  237 aa  DAPH_LACF3 RecName:
  178::214     3e-04  35%  214 aa  Y1064_METJA RecName: Full=Uncharacterized acetyltransferase MJ1064;
  247::326     3e-04  39%  355 aa  LPXD_AGRT5 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
  203::322     3e-04  30%  341 aa  LPXD2_NITWN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
  180::274     3e-04  39%  343 aa  LPXD2_LEGPA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
  128::220     4e-04  25%  342 aa  LPXD_DESDG RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
  114::218     4e-04  24%  236 aa  DAPH_CLOBM RecName:
  114::218     4e-04  24%  236 aa  DAPH_CLOBL RecName:
  114::218     4e-04  24%  236 aa  DAPH_CLOB6 RecName:
   95::231     4e-04  37%  236 aa  DAPH_CLOAB RecName:
   88::185     4e-04  29%  199 aa  ATRF2_STAAW RecName: Full=Putative acetyltransferase MW2476;       
   88::185     4e-04  29%  199 aa  ATRF2_STAAS RecName: Full=Putative acetyltransferase SAS2441;      
   88::185     4e-04  29%  199 aa  ATRF2_STAAR RecName: Full=Putative acetyltransferase SAR2635;      
   88::185     4e-04  29%  199 aa  ATRF2_STAAN RecName: Full=Putative acetyltransferase SA2342;       
   88::185     4e-04  29%  199 aa  ATRF2_STAAM RecName: Full=Putative acetyltransferase SAV2555;      
   88::185     4e-04  29%  199 aa  ATRF2_STAAC RecName: Full=Putative acetyltransferase SACOL2570;    
   88::185     4e-04  29%  199 aa  ATRF2_STAA1 RecName: Full=Putative acetyltransferase;       
  114::218     6e-04  23%  236 aa  DAPH_CLOBK RecName:
  114::218     6e-04  23%  236 aa  DAPH_CLOBJ RecName:
  118::159     7e-04  40%  349 aa  LPXD_MYXXD RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
  114::218     7e-04  22%  236 aa  DAPH_CLOBH RecName:
  114::218     7e-04  22%  236 aa  DAPH_CLOB1 RecName:
   98::146     0.001  40%  159 aa  Y304_METJA RecName: Full=Uncharacterized protein MJ0304;
  115::235     0.001  34%  329 aa  LPXD_RHOFD RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
   71::171     0.001  31%  348 aa  LPXD_HAHCH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
   91::240     0.001  28%  258 aa  LPXA_PSEPW RecName:
    1::258

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKRLQEEIKCVFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLTGIEIHP
NIFP_AZOCH      -----REDIRCVFERDPAARTTFEVLTTYPGVHAIMLYRLAHRLWXXXXXXXXXXXXXXXXX-SNVDIHP
CYSE_BACSU      -FRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHALYKRKFYFLARLISQVSRFFTGIEIHP
CYSE_SYNE7      MFKTLAADFRIIFERDPAARNGLEVLLCYPGFQALVCHRVAHWLYQQRLPVIPRLLSHLSRLLTGVEIHP
CYSE_STAES      MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYKNRRYVAARMISQLSRFFTGIEIHP
CYSE_STAEQ      MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYKNRRYVAARMISQLSRFFTGIEIHP
CYSE_STAAW      MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHP
CYSE_STAAN      MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHP
CYSE_STAAM      MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHP
CYSE_STAAC      MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHP
CYSE_STAAS      LLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHP
CYSE_STAAR      LLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHP
CYSE_SYNY3      MLNSLIADFRIIFERDPAARNWLEVLFCYPGLQALLIHRFSHRLYTLGLPFFPRLMSHLARFFTGIEIHP
CYSE_STAXY      --KRIKDDVNMVFEQDPAARTTLEVITSYAGVHAVWSHLIAHELYKKKKYVLARLISQVTRFFTGIEIHP
CYSE_HELPJ      ----LSYSLERVLQEDPAARNKWEVLLLYPGIHALLCYRLAHALHKRRFYFIARALSQLARFITGIEIHP
CYSE_HELPY      ----LSYSLERVLQEDPAARNKWEVLLLYPGIHALLCYRLAHALHKRRFYFIARALSQLARFITGIEIHP
SAT2_ARATH      ----IRHDLQAFKDRDPACLSYSSAILHLKGYHALQAYRVAHKLWNEGRKLLALALQSRISEVFGIDIHP
SAT1_ARATH      -----KQDLIAVKERDPACISYVHCFLGFKGFLACQAHRIAHTLWKQNRKIVALLIQNRVSESFAVDIHP
SAT4_ARATH      -------DVQAFKDRDPACLSYSSAILHLKGYLALQAYRVAHKLWKQGRKLLALALQSRVSEVFGIDIHP
SAT3_ARATH      -------DLLAVKERDPACISYVHCFLHFKGFLACQAHRIAHELWTQDRKILALLIQNRVSEAFAVDFHP
CYSE_BUCAI      ------QDIKAVLKRDPAVNDYLTPLLYLKGFHALEAYRISHYLWNTGKKSLSLYLQSRISSEFSVDIHP
SRPH_SYNE7      ----LDSDVNAAYLGDPAAQSISEILFCYPGITAITFHRLAHRLYQLGLPLLARITAEVSHSETGIDIHP
SAT2_ORYSJ      -------------DRDPACAQYSWALLYLKGYHSVQSYRIAHVLWNQGRKVLALALQSRISEVFAVDIHP
CYSE_SHIFL      -------DIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWNQGRRALAIFLQNQVSVTFQVDIHP
CYSE_ECOLI      -------DIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWNQGRRALAIFLQNQVSVTFQVDIHP
CYSE_ECOL6      -------DIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWNQGRRALAIFLQNQVSVTFQVDIHP
CYSE_ECO57      -------DIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWNQGRRALAIFLQNQVSVTFQVDIHP
CYSE_HAEIN      -------DIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHP
CYSE_SALTY      -------DIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWNKGRRALAIFLQNQVSVSFQVDIHP
SAT1_ORYSJ      --------------RDPACVGFSHCLLNYKGFLAIQAQRVAHVLWAQDRRXXXXXXQSRVAEVFAVDIHP
CYSE_BUCAP      ------KDIKAASQRDPVVKHYLTPLLYLKGFHALEAYRLSHYLWNIKRYELSAYLQSRISTVFSVDIHP
SAT5_ARATH      -------DLRAARVRDPACISFSHCLLNYKGFLAIQAHRVSHKLWTQSRKPLALALHSRISDVFAVDIHP
SAT4_ORYSJ      ----------------------------YKGFXXXXXXXXXXXXWSDNRRAPALLLQSRASEVFGVDIHP
SAT5_ORYSJ      ---------------DPACVGFSQCLLNFKGFLAIQAHRVSHVLWAQQRRPLALALQSRVADVFAVDIHP
SAT_SCHPO       -----------LYTTNPACPDLISAFLSFRGFHALQLYRIAHGLWSEGDKTSAVLVQNWTAVAYGVDIHP
SAT3_ORYSJ      ----------------------------YRGFXXXXXXXXXXXXWSDNRRAPALLLQSRASEVFGVDIHP
WCAB_SHIFL      -----------------------------------VW-RKKNVLNNLWAAPLLVLYRIITECFFGYEIQA
WCAB_ECOLI      -----------------------------------VW-RKKNVLNNLWAAPLLVLYRIITECFFGYEIQA
WCAB_ECO57      -----------------------------------VW-RKKNVLNNLWAAPLLVLYRIITECFFGYEIQA
CYSE_BUCBP      ------QDIKALFNHGLVHCYSFSLLHS-KGFHALQAYRISNFLWCEEKKSLALYFQNRISCLFSVDIHP
DAPH_LEUCK      ------------------------------------------------------AVPLLDKKAVNARIEP
DAPH_THEAB      --------------------------------------------------------------MMGAVINI
DAPH_PETMO      --------------------------------------------------------------MMGAVINI
DAPH_STRSV      --------------------------------------------------------------MMGAVINI
DAPH_STRGC      --------------------------------------------------------------MMGAVINI
DAPH_THEM4      --------------------------------------------------------------MMGAVINI
DAPH_STRTD      --------------------------------------------------------------MMGAVINI
DAPH_STRT2      --------------------------------------------------------------MMGAVINI
DAPH_STRT1      --------------------------------------------------------------MMGAVINI
DAPH_STRSY      --------------------------------------------------------------MMGAVINI
DAPH_STRS2      --------------------------------------------------------------MMGAVINI
DAPH_STRZJ      --------------------------------------------------------------MMGAVINI
DAPH_STRR6      --------------------------------------------------------------MMGAVINI
DAPH_STRPS      --------------------------------------------------------------MMGAVINI
DAPH_STRPJ      --------------------------------------------------------------MMGAVINI
DAPH_STRPI      --------------------------------------------------------------MMGAVINI
DAPH_STRP7      --------------------------------------------------------------MMGAVINI
DAPH_STRP4      --------------------------------------------------------------MMGAVINI
DAPH_STRP2      --------------------------------------------------------------MMGAVINI
DAPH_STRZT      --------------------------------------------------------------MMGAVINI
DAPH_STRZP      --------------------------------------------------------------MMGSVINI
DAPH_STRU0      --------------------------------------------------------------MMGAIINI
DAPH_STRPN      --------------------------------------------------------------MMGSVINI
DAPH_OENOB      -------------------------------------------------------------------IEP
DAPH_OCEIH      --------------------------------------------------------------MMGASINI
DAPH_BACSK      --------------------------------------------------------------MMGASINI
DAPH_LACPL      --------------------------------------------------------------MMGAVINI
DAPH_STAAB      ---------------------------------------------------------------TNARIEP
Y5507_DICDI     ----------------------------------------------------------------GVNIH-
DAPH_LACC3      ----------------------------------------------------------------------
DAPH_GEOTN      --------------------------------------------------------------MMGAVINI
DAPH_ANOFW      --------------------------------------------------------------MMGAVINI
DAPH_STAAE      ---------------------------------------------------------------TNARIEP
DAPH_METKA      -------------------------------------------------------------------INI
DAPH_LACAC      -------------------------------------------------------------------IEP
DAPH_BACHD      --------------------------------------------------------------MMGASINI
LPXD_DESVH      ----------------------------------------------------------------GTVLFP
DAPH_LACCB      ----------------------------------------------------------------------
DAPH_GEOSW      --------------------------------------------------------------MMGAVINI
DAPH_EXIS2      --------------------------------------------------------------MMGAIINI
DAPH_THETN      -------------------------------------------------------------------IEP
DAPH_THEP1      --------------------------------------------------------------MMGAVINV
ATRF2_STAHJ     ----------------------------------------------------------------------
LPXD_AGRRK      -------------------------------------------------------------------IQD
DAPH_THESQ      --------------------------------------------------------------MMGAVINV
DAPH_THEMA      --------------------------------------------------------------MMGAVINV
DAPH_THENN      --------------------------------------------------------------MMGAVINV
DAPH_LACS1      --------------------------------------------------------------MMGAVINI
DAPH_KOSOT      --------------------------------------------------------------MMGAVINI
LPXD_RHOBA      --------------------------------HAAFTKLVSHYRPALGETMPVSGIDPTAKVDPTCQVHP
GLMU_RUBXD      ----------------------------------------------------------------------
DAPH_BACWK      -------------------------------------------------------------------INI
DAPH_BACHK      -------------------------------------------------------------------INI
DAPH_BACCZ      -------------------------------------------------------------------INI
DAPH_BACCR      -------------------------------------------------------------------INI
DAPH_BACCQ      -------------------------------------------------------------------INI
DAPH_BACC7      -------------------------------------------------------------------INI
DAPH_BACC4      -------------------------------------------------------------------INI
DAPH_BACC3      -------------------------------------------------------------------INI
DAPH_BACC2      -------------------------------------------------------------------INI
DAPH_BACC1      -------------------------------------------------------------------INI
DAPH_BACC0      -------------------------------------------------------------------INI
DAPH_BACAN      -------------------------------------------------------------------INI
DAPH_BACAH      -------------------------------------------------------------------INI
DAPH_BACAC      -------------------------------------------------------------------INI
DAPH_BACAA      -------------------------------------------------------------------INI
THGA_ECOLI      ----------------------------------------------------------------GSNIH-
DAPH_LACH4      -------------------------------------------------------------------IEP
DAPH_LACF3      -------------------------------------------------------------------IEP
Y1064_METJA     ----------------------------------------------------------------------
LPXD_AGRT5      ----------------------------------------------------------------GTKIDN
LPXD2_NITWN     ----------------------------------------------LGGKWVKVP------QVGGVIIQD
LPXD2_LEGPA     ---------------------------------------------------------------SNVVVYP
LPXD_DESDG      ----------------------------------------------------------------GTTLFP
DAPH_CLOBM      --------------------------------------------------------------MMGAVINI
DAPH_CLOBL      --------------------------------------------------------------MMGAVINI
DAPH_CLOB6      --------------------------------------------------------------MMGAVINI
DAPH_CLOAB      -------------------------------------------------------------------IEP
ATRF2_STAAW     ----------------------------------------------------------------------
ATRF2_STAAS     ----------------------------------------------------------------------
ATRF2_STAAR     ----------------------------------------------------------------------
ATRF2_STAAN     ----------------------------------------------------------------------
ATRF2_STAAM     ----------------------------------------------------------------------
ATRF2_STAAC     ----------------------------------------------------------------------
ATRF2_STAA1     ----------------------------------------------------------------------
DAPH_CLOBK      --------------------------------------------------------------MMGAVINI
DAPH_CLOBJ      --------------------------------------------------------------MMGAVVNI
LPXD_MYXXD      --------------------------------------------------------------LPGASVDR
DAPH_CLOBH      --------------------------------------------------------------MMGAVVNI
DAPH_CLOB1      --------------------------------------------------------------MMGAVVNI
Y304_METJA      ----------------------------------------------------------------------
LPXD_RHOFD      -------------------------------------------------------------------VHP
LPXD_HAHCH      ---------------DQCSTNVLVMENSYFGY-ALCSQLFSPQWWSMSGISPSAAISESAKLGAGVEIGE
LPXA_PSEPW      ----------------------------------------------------------------GVTIHR


                         .         .         *         .         .         .         .:140
query           GAQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTXXXXXXXXXXXXXXXPIHIGS
NIFP_AZOCH      GAVIGARFFIDHGACVVIGETAEIGRDVTLYHGVTLGGTTGAKGKRHPTLGDVVLVGAGAKILGPITIGA
CYSE_BACSU      GATIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGGTGKEKGKRHPTIKDDALIATGAKVLGSITVGE
CYSE_SYNE7      GARLGQGIFIDHGMGVVIGETAIVGDYCLIYQGVTLGGTGKQSGKRHPTXXXXXXXXXXXXXXXXIQIGE
CYSE_STAES      GAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKEKGKRHPDIGDNVLIAAGSKILGNIKIES
CYSE_STAEQ      GAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKEKGKRHPDIGDNVLIAAGSKILGNIKIES
CYSE_STAAW      GAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINS
CYSE_STAAN      GAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINS
CYSE_STAAM      GAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINS
CYSE_STAAC      GAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINS
CYSE_STAAS      GAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINS
CYSE_STAAR      GAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINS
CYSE_SYNY3      GAQIGQGVFIDHGMGVVIGETAIVGDYSLIYQGVTLGGTGKESGKRHPTLGENVVVGAGAKVLGNIAIGD
CYSE_STAXY      GAQIGRRLFIDHGMGVVIGETCRIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNITINA
CYSE_HELPJ      GAKIGRGLFIDHGMGVVIGETTEIGDDVTIYHGVTLGGTGKFKGKRHPTLGNRXXXXXXXXXXXXICVGD
CYSE_HELPY      GAKIGRGLFIDHGMGVVIGETTEIGDDVTIYHGVTLGGTGKFKGKRHPTLGNRXXXXXXXXXXXXICVGD
SAT2_ARATH      AARIGEGILLDHGTGVVIGETAVIGNGVSILHGVTLGGTGKETGDRHPKIGEGALLGACVTILGNISIGA
SAT1_ARATH      GAKIGKGILLDHATGVVIGETAVVGDNVSILHGVTLGGTGKQSGDRHPKIGDGVLIGAGSCILGNITIGE
SAT4_ARATH      AARIGKGILLDHGTGVVIGETAVIGDRVSILHGVTLGGTGKETGDRHPNIGDGALLGACVTILGNIKIGA
SAT3_ARATH      GAKIGTGILLDHATAIVIGETAVVGNNVSILHNVTLGGTGKQCGDRHPKIGDGVLIGAGTCILGNITIGE
CYSE_BUCAI      AAFIGSGVMLDHATGIVIGEGVTIENDVSILHSVTLGGTGKNSQNRHPTIRKGVVIGAGAKILGNIEVGS
SRPH_SYNE7      GAAIGGSFFIDHGTGVVIGETCVIGDRVRIYQAVTLGAKSFPRDERHPVIEDDVVIYAGATLLGRITVGR
SAT2_ORYSJ      AARIGEGILLDHGTGLVIGETAIVGNWVSLMQGVTLGGTGKENGDRHPKXXXXXXXXXXXXXXXXXNVGE
CYSE_SHIFL      AAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKSGGDRHPKIREGVMIGAGAKILGNIEVGR
CYSE_ECOLI      AAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKSGGDRHPKIREGVMIGAGAKILGNIEVGR
CYSE_ECOL6      AAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKSGGDRHPKIREGVMIGAGAKILGNIEVGR
CYSE_ECO57      AAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKSGGDRHPKIREGVMIGAGAKILGNIEVGR
CYSE_HAEIN      AAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGKESGDRHPKVREGVMIGAGAKILGNIEVGK
CYSE_SALTY      AAKIGRGIMLDHATGIVVGETAVIEDDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGR
SAT1_ORYSJ      AAAIGKGVLLDHATGVVIGETAVIGDNVSILHHVTLGGTGKAVGDRHPKIGDGVLIGAGATILGNVRIGA
CYSE_BUCAP      AASIGSGIMLDHATXXXXXXXXXXXNDVSIFHSVTLGGTGSNTGKRHPIIRKNVTIGAGAKILGNIEVGQ
SAT5_ARATH      AAKIGKGILLDHATGVVVGETAVIGNNVSILHHVTLGGTGKACGDRHP------------------KIGD
SAT4_ORYSJ      GARIGCGILLDHATGVVIGETAVVGYDVSILHGVTLGGTGKESGDRHPKVGDGVLIGAGASVLGNVHIGD
SAT5_ORYSJ      AAVVGKGILLDHATGVVIGETAVVGDNVSILHHVTLGGTGKAVGDRHPKIGDGVLIGAGATILGNVXXXX
SAT_SCHPO       AASIGDGLFLDHALGIVIGETAIVEDGVSIWHNVTLGSTFKDSGARHPVIRKNAMLCTGATVLGRXXXXX
SAT3_ORYSJ      GARIGGGILLDHATGVVIGETAVVGYGVSILHAVTLGGTGKESGDRHP------------------KVGD
WCAB_SHIFL      AATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRG-ADNMACPHIGNGVELGANVIILGDITLGN
WCAB_ECOLI      AATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRG-ADNMACPHIGNGVELGANVIILGDITLGN
WCAB_ECO57      AATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRG-ADNMACPHIGNGVELGANVIILGDITLGN
CYSE_BUCBP      ASMIGSGIVLDNAIGITIGQTSAIKDXXXXXXXXXXXXXXXFKSVQCPKINEGVIIGANVAILGNVVIGE
DAPH_LEUCK      GAIIRDQVTIGDNLGAVINIGAEIGSGTMIDMGAVLGGRAIVGEQSHIGAGAVLAGVIEPASAQPVRIGD
DAPH_THEAB      GAKIGEGTMID--MNAVVGGRAIIGKNCHIGAGAVIAGVIEPPSAQPVIIEDNVMVGANAVILEGVRIGQ
DAPH_PETMO      GACIKENTMID--MNVVIGGRAQIGKNCHIGAGAVIAGVIEPPSAQPVVIENNVLIGANAVVLEGVKVGQ
DAPH_STRSV      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRGC      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_THEM4      GAVIGEKTMID--MNTVIGGRAIIGKNCHIGAGSVIAGVIEPPSAKPVMIKDNVMVGANAVILEGVEIGE
DAPH_STRTD      GAEIGAGTMID--MGAILGGRATVGKNSHIGAGAVLAGVIEPASAEPVRIGDNVLVGANAVVIEGVQVGN
DAPH_STRT2      GAEIGAGTMID--MGAILGGRATVGKNSHIGAGAVLAGVIEPASAEPVRIGDNVLVGANAVVIEGVQVGN
DAPH_STRT1      GAEIGAGTMID--MGAILGGRATVGKNSHIGAGAVLAGVIEPASAEPVRIGDNVLVGANAVVIEGVQVGN
DAPH_STRSY      GAEIGPGTMID--MGAILGGRATVGKNSHIGAGAVLAGVIEPASAEPVRVGDNVLVGANAVVIEGVQIGS
DAPH_STRS2      GAEIGPGTMID--MGAILGGRATVGKNSHIGAGAVLAGVIEPASAEPVRVGDNVLVGANAVVIEGVQIGS
DAPH_STRZJ      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRR6      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRPS      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRPJ      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRPI      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRP7      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRP4      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRP2      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRZT      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPVSAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRZP      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_STRU0      GAEIGPGTMID--MGAILGGRATVGKNSHIGAGAVLAGVIEPASAEPVRIGDNVLVGANAVVIEGVQVGN
DAPH_STRPN      GAEIGAGTMID--MGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGS
DAPH_OENOB      GAIIRDQVKIADNMGAVINIGAEIGEATMIDMGAVLGGRAIVGKHSHIGAGAVLAGVVEPASAQPVRVGD
DAPH_OCEIH      GSVIGEGTMID--MNAVLGGRATVGKNCHIGAGSVLAGVIEPPSAKPVIVEDDVVIGANVVILEGITVGK
DAPH_BACSK      GAVIGEGTMID--MNAVLGGRATVGKNCHVGAGAVLAGV------------------IEPPSASPVIIED
DAPH_LACPL      GAEIGEGSMID--MGAILGGRAIVGKNCHIGAGTVLAGVVEPPSAK------------------PVQIDD
DAPH_STAAB      GAFIREQAIIEDGAVVMMGATAVVGEGTMIDMNATLGGRATTGKNVHXXXXXXXXXXIEPPSASPVIIED
Y5507_DICDI     ---VGDKFFINHGYGAMIGPNSQLGSDENFTKGITIGDNFWGGGN--------------VIILPGVTLGN
DAPH_LACC3      -------------MGAVLGGRAIVGKHCHIGAGTVLAGVVEPRSAK------------------PVTIGD
DAPH_GEOTN      GAVIGEGTMID--MNAVLGGRATVGKNCHIGAGAVLAGVIEPPSAK------------------PVVIED
DAPH_ANOFW      GAVVGEGTMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_STAAE      GAFIREQAIIEDGAVVMMGATAVVGEGTMIDMNATLGGRATTGKNVHXXXXXXXXXXIEPPSASPVIIED
DAPH_METKA      GAKIGDGTMVD--MNAVVGSRAEVGKNVHIGAGAVIAGVLEPPSAK------------------PVVIED
DAPH_LACAC      GAIIRDQVAIGKNMGAIINIGAEIGDDTMIDMGVVLGGRAIVGKHCHIGAGSVLAGVIEPASAKPVQIDD
DAPH_BACHD      GSVIGEGTMID--MNVVLGGRATVGKNCHIGAGSVLAGVIEPPSAK------------------PVVVED
LPXD_DESVH      GCYIGEDCVVGGGCNVVLMAGVEIGDDCILHAGVVLGADGFGFARTE-------FGIQKIPQVGTVRIGS
DAPH_LACCB      -------------MGAVLGGRAIVGKHCHIGAGTVLAGVVEPPSAK------------------PVTIGD
DAPH_GEOSW      GAVVGEGTMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_EXIS2      GASIGDGTMID--MNAVVGARGTIGKNVHXXXXXXXXXXLEPPSKTPVIIEDGVLIGANAVILEGVRVGK
DAPH_THETN      GAIIRDKVKIGKNMGAVINIGAEIGENSMIDMNAVIGARGIIGKNVHXXXXXXXXXXLEPPSSVPVVIED
DAPH_THEP1      GAVIGEGTMID--MNAVIGGRAIIGKKCHIGAGAVIAGVIEPPSAK------------------PVVIED
ATRF2_STAHJ     -------YFMDGG-GITIGNDVFIGPSCTAHHPLTPKERNAGLELAQPITIGNNIWFGGNVVVTPVTIGD
LPXD_AGRRK      NVEIGANTTIDRGTDTVIGEGTKIDNQVQIGHNVRIGRVSQVGIAGSAVIGDGVQIGGHTGINGHIQIGD
DAPH_THESQ      GAVIGEGTMID--MNAVVGGRAIIGKKCHIGAGAVIAGVIEPPSAK------------------PVVIED
DAPH_THEMA      GAVIGEGTMID--MNAVVGGRAIIGKKCHIGAGAVIAGVIEPPSAK------------------PVVIED
DAPH_THENN      GAVIGEGTMID--MNAVVGGRAIIGKKCHIGAGAVIAGVIEPPSAK------------------PVVIED
DAPH_LACS1      GAEIGEGSMID--MGAVLGGRAIVGKNCHIGAGTVLAGV------------------VEPPSAQPVVIED
DAPH_KOSOT      GAVIGKGTMID--MNAVIGGRAIIGDNCHIGAGAVVAGV------------------IEPPSATPVIIED
LPXD_RHOBA      SANIGANVEIGPGCGVNIGAGCQIGADCTLHPNVTL----------------------------------
GLMU_RUBXD      ---------------------AEIGEDANLGAGTITA--NYDGAKKHRTVIEDGAFTGINTNLIPVTIGQ
DAPH_BACWK      GAVIGEGTMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACHK      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACCZ      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACCR      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACCQ      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACC7      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACC4      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACC3      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACC2      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACC1      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACC0      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACAN      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACAH      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACAC      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
DAPH_BACAA      GAVIGEGSMID--MNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAK------------------PVIVED
THGA_ECOLI      ---IGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHKNGEMYSTIGNNVWIGSHVVINPGVTIGD
DAPH_LACH4      GAIIRDQVAIGKNMGAIINIGAEIGDDTMIDMGVVLGGRAIVGKHCHIGAGSVLAGVIEPASATPVKIDD
DAPH_LACF3      GATIRDQVLIGDNMGAVINIGAEIGEGTMIDMGAILGGRALVGKHCHIGAGTVLAGVVEPASAEPVRIDD
Y1064_METJA     -----------------------------------------------------------------VKIGE
LPXD_AGRT5      QVQIGHNVRIGRHCGIVSG--VGIAGSTRIGDGVMIGGATGVNGH--------------------ITIGD
LPXD2_NITWN     DVEVGANTTIDRGSATVIGEGTKLDNLVQVAHNVTIGAIAAQVGIAGSTTIGDFVAIGGHAGIAPLTIGE
LPXD2_LEGPA     GARIGQDGFIPHAGGVIIGNDVEIGANTCIDRG-SLGNTVIEDWCRLDNL---------------VQIGH
LPXD_DESDG      GCYVGEDCAVGENCNVTLMAATTVGDDCVLHSGVVLGADGFGFARTE-------YGIQKIPQIGRVHVGN
DAPH_CLOBM      GAEIGEGTMVD--MNAVVGARGKLGKNVHLXXXXXXXXXLEPPSSDPCTIEDNVLIGANAVILEGIKIGK
DAPH_CLOBL      GAEIGEGTMVD--MNAVVGARGKLGKNVHLXXXXXXXXXLEPPSSDPCTIEDNVLIGANAVILEGIKIGK
DAPH_CLOB6      GAEIGEGTMVD--MNAVVGARGKLGKNVHLXXXXXXXXXLEPPSSDPCTIEDNVLIGANAVILEGIKIGK
DAPH_CLOAB      GAIIRDKVSIGKNMGAVINIGSEIGEGAMIDMNAVVGARGKIGKRAHXXXXXXXXXXLEPPSKSPCEIGD
ATRF2_STAAW     -------YFMDGGQ-ITIGDNVFIGPNCGFYHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPVTIGE
ATRF2_STAAS     -------YFMDGGQ-ITIGDNVFIGPNCGFYHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPVTIGE
ATRF2_STAAR     -------YFMDGGQ-ITIGDNVFIGPNCGFYHPLNFHHRNEGFEKAGPINIGSNTWFGGHVAVLPVTIGE
ATRF2_STAAN     -------YFMDGGQ-ITIGDNVFIGPNCGFYHPLNFYHRNEGYEKAGPIHIGSNTWFGGHVAVLPVTIGE
ATRF2_STAAM     -------YFMDGGQ-ITIGDNVFIGPNCGFYHPLNFYHRNEGYEKAGPIHIGSNTWFGGHVAVLPVTIGE
ATRF2_STAAC     -------YFMDGGQ-ITIGDNVFIGPNCGFYHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPVTIGE
ATRF2_STAA1     -------YFMDGGQ-ITIGDNVFIGPNCGFYHPLNFYHRNEGYEKAGPIHIGSNTWFGGHVAVLPVTIGE
DAPH_CLOBK      GAEIGEGTMVD--MNAVVGARGKLGKNVHLXXXXXXXXXLEPPSSDPCTIEDNVLIGANAVILEGVKIGK
DAPH_CLOBJ      GAEIGEGTMVD--MNAVVGARGKLGKNVHLXXXXXXXXXLEPPSSDPCTIEDNVLIGANAVILEGIKIGK
LPXD_MYXXD      GGRVGARTVLYPG--AYVGEQAEVGEDCVLYPNVTV----------------------------------
DAPH_CLOBH      GAEIGEGTMVD--MNAVVGARGKLGKNVHLXXXXXXXXXLEPPSSDPCTIEDNVLIGANAVILEGVKIGK
DAPH_CLOB1      GAEIGEGTMVD--MNAVVGARGKLGKNVHLXXXXXXXXXLEPPSSDPCTIEDNVLIGANAVILEGVKIGK
Y304_METJA      -------------------------------------------------------------------IGE
LPXD_RHOFD      RACIGALCVIESGASVTVGENCVIGERCLLHSGVVIGADAWEKIEQ----------------LGAVRIGN
LPXD_HAHCH      GAVIGPGCYI--GAGSIIGAKTQLRPNVTVYHGVNIG---------------------------------
LPXA_PSEPW      GTDRAETTLGDHNLIMAIGHDSVIGNHCILVNNTALAG--------HVHVGDWAILSGFTLVHQYCHIGA


                         +         .         .         .         .         *         .:210
query           GVRIGSNSVVVKSVPANTTVIGVPGRMVQSKDQRREAKHQAMAKRIGFDAYGTPQDTPDPIERAIHGLIE
NIFP_AZOCH      NARVGANSVVVQDVPEGCTVVGIPGKVVKLREAGQ------------LNPYGIDLDIPDPVGKAIACLLE
CYSE_BACSU      GSKIGAGSVVLHDVPDFSTVVGIPGRVVNGKKVRRDLNH---------------QDLPDPVADRFKSLEQ
CYSE_SYNE7      NVRIGAGSVVLRDVPSDCTVVGIPGRVIYRSGVRVDLDHSQM---------------PDSEARVIRMLLD
CYSE_STAES      NVNIGANSVVLQSVPSYTTVVGIPGHIVKQE-----------GRRIGFD----HRNLPDP-------LYE
CYSE_STAEQ      NVNIGANSVVLQSVPSYTTVVGIPGHIVKQE-----------GRRIGFD----HRNLPDP-------LYE
CYSE_STAAW      NVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVR------------------------------------
CYSE_STAAN      NVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVR------------------------------------
CYSE_STAAM      NVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVR------------------------------------
CYSE_STAAC      NVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVR------------------------------------
CYSE_STAAS      NVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVR------------------------------------
CYSE_STAAR      NVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVR------------------------------------
CYSE_SYNY3      NVRIGAGSVVLRDVPADFTVVGVPGRMVHPSGER------------------------------------
CYSE_STAXY      NVNIGANSVVLNSVPSYSTVVGIPGHIVK-QDGRRIGK--------------------------------
CYSE_HELPJ      DVRIGANAVVLSDLPTGSTAVGAKAKTI-TKDR-------------------------------------
CYSE_HELPY      DVKIGANAVVLSDLPTGSTAVGSKAKTI-TKDR-------------------------------------
SAT2_ARATH      GAMVAAGSLVLKDVPSHSVVAGNPARVMEEQDPSLAMKHDA-----------------------------
SAT1_ARATH      GAKIGSGSVVVKDVPARTTAVGNPARLIGGKENPRK----------------------------------
SAT4_ARATH      GAMVAAGSLVLKDVPSHSMVAGNPAKLIGFVDEQ------------------------------------
SAT3_ARATH      GAKIGAGSVVLKDVPPRTTAVGNPARLLGGKD--------------------------------------
CYSE_BUCAI      GAKIGAGSIVLKNVPSDVTVVGVPAKI-------------------------------------------
SRPH_SYNE7      GSTIGGNVWLTRSVPAGSFI--------------------------------------------------
SAT2_ORYSJ      GAMIAAGSLVLKDVPPHSMAVGNPAKVVGYKDKEDPSKHDA-----------------------------
CYSE_SHIFL      GAKIGAGSVVLQPVPPHTTAAGVPARIVGKPD--------------------------------------
CYSE_ECOLI      GAKIGAGSVVLQPVPPHTTAAGVPARIVGKPD--------------------------------------
CYSE_ECOL6      GAKIGAGSVVLQPVPPHTTAAGVPARIVGKPD--------------------------------------
CYSE_ECO57      GAKIGAGSVVLQPVPPHTTAAGVPARIVGKPD--------------------------------------
CYSE_HAEIN      YAKIGANSVVLNPVPEYATAAGVPARIV-SQDKAAKPAFDMNQYFIGID---------------------
CYSE_SALTY      GAKIGAGSVVLQPVPPHTTAAGVPARIV------------------------------------------
SAT1_ORYSJ      GAKIGAGSLVLIDVPPRTTAVGNPARLLGGK---------------------------------------
CYSE_BUCAP      GVKVGAGSIVLKNIPPFVTVVGVP----------------------------------------------
SAT5_ARATH      GCLIGAGATILGNVPCRGTAVGNPARLVGGKEK-------------------------------------
SAT4_ORYSJ      GAKIGAGAVVLRDVADGTTAVGNPAKPIIGK---------------------------------------
SAT5_ORYSJ      XXXXXXXSVVLIDVPARNTAVGNPARLIGRKN--------------------------------------
SAT_SCHPO       XXXXXXXXLVTKDVAPNRLALGSPARDV------------------------------------------
SAT3_ORYSJ      GVLIGAGASVLGNV--------------------------------------------------------
WCAB_SHIFL      NVTVGAGSVVLDSVPDNALVVGEKARV-------------------------------------------
WCAB_ECOLI      NVTVGAGSVVLDSVPDNALVVGEKARV-------------------------------------------
WCAB_ECO57      NVTVGAGSVVLDSVPDNALVVGEKARV-------------------------------------------
CYSE_BUCBP      KTKIQACTVVLQSVPPNSIVTSVLAKIVSFKN--------------------------------------
DAPH_LEUCK      HVLVGANAVVIKDVPANTVVAGVPAKIIKQIDSKTQQK--------------------------------
DAPH_THEAB      NSVIAAGAVVIEDVPPNSVVAGVPAKIIKKVDEKTKQKTQ------------------------------
DAPH_PETMO      GSIIGAGSVVISDVEPYSVVAGVPAKFIKKVDDKTKAKTQ------------------------------
DAPH_STRSV      GSVVAAGAIVTQDVPENVVVAGVPARVIKTIDEKTQQK--------------------------------
DAPH_STRGC      GSVVAAGAIVTQDVPENVVVAGVPARIIKTIDEKTQQK--------------------------------
DAPH_THEM4      HSVIAAGAVVIEDIPPYSVVAGVPAKVIKKVDKKTESKTQ------------------------------
DAPH_STRTD      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDEKTQQK--------------------------------
DAPH_STRT2      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDEKTQQK--------------------------------
DAPH_STRT1      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDEKTQQK--------------------------------
DAPH_STRSY      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRS2      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRZJ      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRR6      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRPS      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRPJ      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRPI      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRP7      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRP4      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRP2      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRZT      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRZP      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_STRU0      GSVVAAGAIVTEDVPENVVVAGVPARIIKEIDSQTQQK--------------------------------
DAPH_STRPN      GSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQK--------------------------------
DAPH_OENOB      NVLIGANAVIIEDVPAHTVVAGVPAKVIKQIDEKTENK--------------------------------
DAPH_OCEIH      GSIVAAGSIVTKDVAPNTLVGGTPAKVLKEIDEQTKSK--------------------------------
DAPH_BACSK      GVVIGANAVILEDVPANTVVAGTPARVIKEIDEKTKGK--------------------------------
DAPH_LACPL      DVLIGANAIVIEDVAPNTVVGGVPARKLKDIDDKTKSKTELMAE--------------------------
DAPH_STAAB      DVLIGANAVILEDVPAGTVVAGTPAKVIKQASEVQDTKKEIVA---------------------------
Y5507_DICDI     NVIVGAGSVVTKSFPDNSIIAGNPAKLIR-----------------------------------------
DAPH_LACC3      HVMIGANAVVLEDVPAHTVVAGVPAKVIKQVNDQTEAK--------------------------------
DAPH_GEOTN      DVLIGANAVILEDVPPYTVVAGVPARVIKQIDEQTRAK--------------------------------
DAPH_ANOFW      DVMIGANAVILEDVPPYTVVAGVPARVIKQIDEKTKAK--------------------------------
DAPH_STAAE      DVLIGANAVILEDVPAGAVVAGTPCKVIKAASEVQDTKKEIVA---------------------------
DAPH_METKA      DVVIGANAVILEDVPPSKVVAGVPARVVKDVDKKTEAKTQ------------------------------
DAPH_LACAC      DVVIGANAVVIKDVEPYTMVAGVPAKVIKKVDNK------------------------------------
DAPH_BACHD      DVVIGANCVILEDVPPNTVVAGTPARVIKEIDEKTKGK--------------------------------
LPXD_DESVH      DVEIGANTTIDRSVLGVTTV--------------------------------------------------
DAPH_LACCB      HVMIGANAVVLEDVPAHTVVAGVPAKVIKQVNDQTEAK--------------------------------
DAPH_GEOSW      DVVIGANAVILEDVPPYTVVAGVPARVIKQIDEKTRAK--------------------------------
DAPH_EXIS2      DAVVAAGSVVTEDVPAGSVVAGTPARVIKQKDEKTAEKTQ------------------------------
DAPH_THETN      NVMIGANAVIIEDVPPNTVVAGVPAKIVKVVDEKTREKTKLM----------------------------
DAPH_THEP1      EVVVGANAVILEDVPPYTVVAGVPARVIKQIDERTKEK--------------------------------
ATRF2_STAHJ     GSVIAAGSVVTKDVPPNSLVAGVPAKVIREINENDAPKN-------------------------------
LPXD_AGRRK      GVQIGAMSGVMNSIPAGERFAGIPARPLW--DFLREAAE--VAKRSG-----------------------
DAPH_THESQ      EVLVGANAVILEDVPPYTVVAGVPARVIKQIDEKTKEK--------------------------------
DAPH_THEMA      EVLVGANAVILEDVPPYTVVAGVPARVIKQIDEKTKEK--------------------------------
DAPH_THENN      EVVVGANAVILEDVPPYTVVAGVPARVIKQIDEKTKEK--------------------------------
DAPH_LACS1      DVLIGANAVVLKDVEPYTVVMGMPAKKVKDVSQVDDSK--------------------------------
DAPH_KOSOT      NVLVGANAVILKDVPSGTVVAGIPAKVIKAFD--------------------------------------
LPXD_RHOBA      ----------------------------------------------------------------------
GLMU_RUBXD      GAYLGAGSVVNKDIPPGKLAVGAPARVIR-----------------------------------------
DAPH_BACWK      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACHK      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACCZ      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACCR      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACCQ      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACC7      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACC4      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACC3      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACC2      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACC1      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACC0      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACAN      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACAH      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACAC      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
DAPH_BACAA      DVVIGANVVVLEDVPPYTVVAGTPARVIKEIDEKTKAK--------------------------------
THGA_ECOLI      NSVIGAGSIVTKDIPPNVVAAGVPCRVIREINDR------------------------------------
DAPH_LACH4      NVVMGANXXXTHDVEPHTMVAGVPAKVIKKVDDQTESK--------------------------------
DAPH_LACF3      DVLIGANXXXTQDVAPHTVVAGVPARYIKDVDEQTDSK--------------------------------
Y1064_METJA     GAVIGAGSVVTRDIPPYSVAVGVPARVIKKRE--------------------------------------
LPXD_AGRT5      GVQIAAMSGVVSDVPAGTRYGGIPAR--------------------------------------------
LPXD2_NITWN     KAQIGGASGVMCDIPAGERWVGLPAR--------------------------------------------
LPXD2_LEGPA     NVKIGKGSIIVAQVGAGSTELG------------------------------------------------
LPXD_DESDG      DVEIGANTAIDRAVLGVTTI--------------------------------------------------
DAPH_CLOBM      GSVVAAGSIVTTDVPENVVVAGAPAKIIK-----------------------------------------
DAPH_CLOBL      GSVVAAGSIVTTDVPENVVVAGAPAKIIK-----------------------------------------
DAPH_CLOB6      GSVVAAGSIVTTDVPENVVVAGAPAKIIK-----------------------------------------
DAPH_CLOAB      DVLIGANSVILEGVKANSVIAGTPARIIKEVDDKTKDKTQIM----------------------------
ATRF2_STAAW     GSVIGAGSVVTKDIPPHSLAVGNPCKVVRKID--------------------------------------
ATRF2_STAAS     GSVIGAGSVVTKDIPPHSLAVGNPCKVVRKID--------------------------------------
ATRF2_STAAR     GSVIGAGSVVTKDIPPHSLAVGNPCKVVRKID--------------------------------------
ATRF2_STAAN     GSVIGAGSVVTKDIPPHSLAVGNPCKVVRKID--------------------------------------
ATRF2_STAAM     GSVIGAGSVVTKDIPPHSLAVGNPCKVVRKID--------------------------------------
ATRF2_STAAC     GSVIGAGSVVTKDIPPHSLAVGNPCKVVRKID--------------------------------------
ATRF2_STAA1     GSVIGAGSVVTKDIPPHSLAVGNPCKVVRKID--------------------------------------
DAPH_CLOBK      GSVVAAGSIVTTDVPENVVVAGAPAKIIK-----------------------------------------
DAPH_CLOBJ      GSVVAAGSIVTTDVPENVVVAGAPAKIIK-----------------------------------------
LPXD_MYXXD      ----------------------------------------------------------------------
DAPH_CLOBH      GSVVAAGSIVTTDVPENVVVAGAPAKIIK-----------------------------------------
DAPH_CLOB1      GSVVAAGSIVTTDVPENVVVAGAPAKIIK-----------------------------------------
Y304_METJA      NCIIGANALVTKEIPPNSLVLGVPGRVVRTEEEIKSIKENAL----------------------------
LPXD_RHOFD      DVEIGANTCIDRGALQDTVIDGVKDNLIQIGHNVHVGKHTAMA---------------------------
LPXD_HAHCH      ----------------------------------------------------------------------
LPXA_PSEPW      HAFSGMGTAIGKDVPAFVTVFGSPA-------EARSMNFEGMRRR-GFS---------DEVIHALRRSYK


                         .         .         .         +         .         .         .:280
query           HIQRLDERIEQMTAEIKNLGGDLPxxxxxxxxxxxxxxxxxxxxxxxx
NIFP_AZOCH      RIDSLEKRVE--------------------------------------
CYSE_BACSU      QILELKAELEDRKERI--------------------------------
CYSE_SYNE7      RIEALEDQLE--------------------------------------
CYSE_STAES      QIKHLERQLEK-------------------------------------
CYSE_STAEQ      QIKHLERQLEK-------------------------------------
CYSE_STAAW      ------------------------------------------------
CYSE_STAAN      ------------------------------------------------
CYSE_STAAM      ------------------------------------------------
CYSE_STAAC      ------------------------------------------------
CYSE_STAAS      ------------------------------------------------
CYSE_STAAR      ------------------------------------------------
CYSE_SYNY3      ------------------------------------------------
CYSE_STAXY      ------------------------------------------------
CYSE_HELPJ      ------------------------------------------------
CYSE_HELPY      ------------------------------------------------
SAT2_ARATH      ------------------------------------------------
SAT1_ARATH      ------------------------------------------------
SAT4_ARATH      ------------------------------------------------
SAT3_ARATH      ------------------------------------------------
CYSE_BUCAI      ------------------------------------------------
SRPH_SYNE7      ------------------------------------------------
SAT2_ORYSJ      ------------------------------------------------
CYSE_SHIFL      ------------------------------------------------
CYSE_ECOLI      ------------------------------------------------
CYSE_ECOL6      ------------------------------------------------
CYSE_ECO57      ------------------------------------------------
CYSE_HAEIN      ------------------------------------------------
CYSE_SALTY      ------------------------------------------------
SAT1_ORYSJ      ------------------------------------------------
CYSE_BUCAP      ------------------------------------------------
SAT5_ARATH      ------------------------------------------------
SAT4_ORYSJ      ------------------------------------------------
SAT5_ORYSJ      ------------------------------------------------
SAT_SCHPO       ------------------------------------------------
SAT3_ORYSJ      ------------------------------------------------
WCAB_SHIFL      ------------------------------------------------
WCAB_ECOLI      ------------------------------------------------
WCAB_ECO57      ------------------------------------------------
CYSE_BUCBP      ------------------------------------------------
DAPH_LEUCK      ------------------------------------------------
DAPH_THEAB      ------------------------------------------------
DAPH_PETMO      ------------------------------------------------
DAPH_STRSV      ------------------------------------------------
DAPH_STRGC      ------------------------------------------------
DAPH_THEM4      ------------------------------------------------
DAPH_STRTD      ------------------------------------------------
DAPH_STRT2      ------------------------------------------------
DAPH_STRT1      ------------------------------------------------
DAPH_STRSY      ------------------------------------------------
DAPH_STRS2      ------------------------------------------------
DAPH_STRZJ      ------------------------------------------------
DAPH_STRR6      ------------------------------------------------
DAPH_STRPS      ------------------------------------------------
DAPH_STRPJ      ------------------------------------------------
DAPH_STRPI      ------------------------------------------------
DAPH_STRP7      ------------------------------------------------
DAPH_STRP4      ------------------------------------------------
DAPH_STRP2      ------------------------------------------------
DAPH_STRZT      ------------------------------------------------
DAPH_STRZP      ------------------------------------------------
DAPH_STRU0      ------------------------------------------------
DAPH_STRPN      ------------------------------------------------
DAPH_OENOB      ------------------------------------------------
DAPH_OCEIH      ------------------------------------------------
DAPH_BACSK      ------------------------------------------------
DAPH_LACPL      ------------------------------------------------
DAPH_STAAB      ------------------------------------------------
Y5507_DICDI     ------------------------------------------------
DAPH_LACC3      ------------------------------------------------
DAPH_GEOTN      ------------------------------------------------
DAPH_ANOFW      ------------------------------------------------
DAPH_STAAE      ------------------------------------------------
DAPH_METKA      ------------------------------------------------
DAPH_LACAC      ------------------------------------------------
DAPH_BACHD      ------------------------------------------------
LPXD_DESVH      ------------------------------------------------
DAPH_LACCB      ------------------------------------------------
DAPH_GEOSW      ------------------------------------------------
DAPH_EXIS2      ------------------------------------------------
DAPH_THETN      ------------------------------------------------
DAPH_THEP1      ------------------------------------------------
ATRF2_STAHJ     ------------------------------------------------
LPXD_AGRRK      ------------------------------------------------
DAPH_THESQ      ------------------------------------------------
DAPH_THEMA      ------------------------------------------------
DAPH_THENN      ------------------------------------------------
DAPH_LACS1      ------------------------------------------------
DAPH_KOSOT      ------------------------------------------------
LPXD_RHOBA      ------------------------------------------------
GLMU_RUBXD      ------------------------------------------------
DAPH_BACWK      ------------------------------------------------
DAPH_BACHK      ------------------------------------------------
DAPH_BACCZ      ------------------------------------------------
DAPH_BACCR      ------------------------------------------------
DAPH_BACCQ      ------------------------------------------------
DAPH_BACC7      ------------------------------------------------
DAPH_BACC4      ------------------------------------------------
DAPH_BACC3      ------------------------------------------------
DAPH_BACC2      ------------------------------------------------
DAPH_BACC1      ------------------------------------------------
DAPH_BACC0      ------------------------------------------------
DAPH_BACAN      ------------------------------------------------
DAPH_BACAH      ------------------------------------------------
DAPH_BACAC      ------------------------------------------------
DAPH_BACAA      ------------------------------------------------
THGA_ECOLI      ------------------------------------------------
DAPH_LACH4      ------------------------------------------------
DAPH_LACF3      ------------------------------------------------
Y1064_METJA     ------------------------------------------------
LPXD_AGRT5      ------------------------------------------------
LPXD2_NITWN     ------------------------------------------------
LPXD2_LEGPA     ------------------------------------------------
LPXD_DESDG      ------------------------------------------------
DAPH_CLOBM      ------------------------------------------------
DAPH_CLOBL      ------------------------------------------------
DAPH_CLOB6      ------------------------------------------------
DAPH_CLOAB      ------------------------------------------------
ATRF2_STAAW     ------------------------------------------------
ATRF2_STAAS     ------------------------------------------------
ATRF2_STAAR     ------------------------------------------------
ATRF2_STAAN     ------------------------------------------------
ATRF2_STAAM     ------------------------------------------------
ATRF2_STAAC     ------------------------------------------------
ATRF2_STAA1     ------------------------------------------------
DAPH_CLOBK      ------------------------------------------------
DAPH_CLOBJ      ------------------------------------------------
LPXD_MYXXD      ------------------------------------------------
DAPH_CLOBH      ------------------------------------------------
DAPH_CLOB1      ------------------------------------------------
Y304_METJA      ------------------------------------------------
LPXD_RHOFD      ------------------------------------------------
LPXD_HAHCH      ------------------------------------------------
LPXA_PSEPW      IVYRQGLTVEEAVKELDELAGKHP------------------------