[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58185.1

[Show Plain Result]


## Summary of Sequence Search
    1::212
    1::212     6e-73  56%  215 aa  YCBL_ECOLI RecName: Full=Uncharacterized protein ycbL;       
    1::211     4e-56  47%  212 aa  Y1663_HAEIN RecName: Full=Uncharacterized protein HI1663;       
    1::207     6e-34  38%  211 aa  Y2135_AQUAE RecName: Full=Uncharacterized protein aq_2135;       
    1::206     4e-26  32%  211 aa  YQGX_BACSU RecName: Full=Uncharacterized protein yqgX;       
   14::219     2e-22  34%  224 aa  Y2612_MYCBO RecName: Full=Uncharacterized protein Mb2612c;       
   14::219     2e-22  34%  224 aa  Y2581_MYCTU RecName: Full=Uncharacterized protein Rv2581c/MT2658;  
    7::215     4e-22  38%  218 aa  Y493_MYCLE RecName: Full=Uncharacterized protein ML0493;       
   47::230     5e-20  30%  232 aa  Y554_STRP6 RecName: Full=Uncharacterized protein M6_Spy0554;
   32::213     4e-18  38%  254 aa  ETHE1_BOVIN RecName: Full=Protein ETHE1, mitochondrial;       
   33::213     4e-17  38%  254 aa  ETHE1_HUMAN RecName: Full=Protein ETHE1, mitochondrial;       
   32::213     5e-17  38%  254 aa  ETHE1_MOUSE RecName: Full=Protein ETHE1, mitochondrial;       
   20::144     1e-16  38%  251 aa  GLO2_BDEBA RecName: Full=Hydroxyacylglutathione hydrolase;       
   41::212     2e-16  37%  256 aa  GLO2O_ARATH RecName: Full=Hydroxyacylglutathione hydrolase 3,
   23::140     4e-15  40%  257 aa  GLO2_PSEMY RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::143     6e-15  40%  256 aa  GLO2_RHORT RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::140     8e-15  40%  257 aa  GLO2_HAHCH RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::137     2e-14  42%  250 aa  GLO2_METFK RecName: Full=Hydroxyacylglutathione hydrolase;       
   24::139     6e-14  44%  259 aa  GLO2_HERAR RecName: Full=Hydroxyacylglutathione hydrolase;       
   16::141     2e-13  41%  252 aa  GLO2_THEEB RecName: Full=Hydroxyacylglutathione hydrolase;       
   24::172     2e-13  36%  256 aa  GLO2_MARMM RecName: Full=Hydroxyacylglutathione hydrolase;       
   23::135     4e-13  42%  265 aa  GLO2_DECAR RecName: Full=Hydroxyacylglutathione hydrolase;       
   18::175     7e-13  36%  263 aa  GLO2_NITOC RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::136     7e-13  35%  251 aa  GLO2_KLEP3 RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::136     7e-13  35%  253 aa  GLO2_IDILO RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::137     9e-13  39%  252 aa  GLO2_VIBPA RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::137     9e-13  37%  252 aa  GLO2_VIBHB RecName: Full=Hydroxyacylglutathione hydrolase;       
   18::175     1e-12  35%  263 aa  GLO2_POLSJ RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::136     2e-12  35%  251 aa  GLO2_KLEP7 RecName: Full=Hydroxyacylglutathione hydrolase;       
  181::368     2e-12  36%  431 aa  BLH_XYLFA RecName: Full=Beta-lactamase hydrolase-like protein;     
   26::144     3e-12  39%  256 aa  GLO2_HYPNA RecName: Full=Hydroxyacylglutathione hydrolase;       
   17::164     4e-12  38%  256 aa  GLO2_PSYIN RecName: Full=Hydroxyacylglutathione hydrolase;       
   23::142     4e-12  39%  259 aa  GLO2_PSEU2 RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::165     4e-12  34%  249 aa  GLO2_HAMD5 RecName: Full=Hydroxyacylglutathione hydrolase;       
   26::136     4e-12  39%  250 aa  GLO2_BUCAP RecName: Full=Hydroxyacylglutathione hydrolase;       
   86::239     4e-12  32%  324 aa  GLO2N_ARATH RecName: Full=Hydroxyacylglutathione hydrolase 2,
   25::173     5e-12  34%  257 aa  GLO2_BRUSU RecName: Full=Hydroxyacylglutathione hydrolase;       
   28::176     5e-12  34%  260 aa  GLO2_BRUSI RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::173     5e-12  34%  257 aa  GLO2_BRUO2 RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::173     5e-12  34%  257 aa  GLO2_BRUME RecName: Full=Hydroxyacylglutathione hydrolase;       
   28::176     5e-12  34%  260 aa  GLO2_BRUMB RecName: Full=Hydroxyacylglutathione hydrolase;       
   28::176     5e-12  34%  260 aa  GLO2_BRUC2 RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::173     5e-12  34%  257 aa  GLO2_BRUAB RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::173     5e-12  34%  257 aa  GLO2_BRUA2 RecName: Full=Hydroxyacylglutathione hydrolase;       
   28::176     5e-12  34%  260 aa  GLO2_BRUA1 RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::142     6e-12  43%  259 aa  GLO2_PSEPK RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::142     6e-12  43%  259 aa  GLO2_PSEP1 RecName: Full=Hydroxyacylglutathione hydrolase;       
   17::160     6e-12  40%  255 aa  GLO2_PSEF5 RecName: Full=Hydroxyacylglutathione hydrolase;       
   23::142     6e-12  39%  259 aa  GLO2_PSE14 RecName: Full=Hydroxyacylglutathione hydrolase;       
   23::142     8e-12  37%  259 aa  GLO2_PSESM RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::149     1e-11  33%  251 aa  GLO2_PECCP RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::138     1e-11  35%  257 aa  GLO2_MARMS RecName: Full=Hydroxyacylglutathione hydrolase;       
   45::170     1e-11  33%  252 aa  GLO2_FRAP2 RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::172     1e-11  36%  256 aa  GLO2_RHIME RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     1e-11  38%  251 aa  GLO2_ECOL6 RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::142     2e-11  42%  259 aa  GLO2_PSEPW RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::136     2e-11  36%  251 aa  GLO2_BUCAI RecName: Full=Hydroxyacylglutathione hydrolase;       
   78::232     2e-11  31%  331 aa  GLO2M_ARATH RecName: Full=Hydroxyacylglutathione hydrolase 1,
   28::147     3e-11  39%  267 aa  GLO2_SHEPC RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     3e-11  38%  251 aa  GLO2_ECOLU RecName: Full=Hydroxyacylglutathione hydrolase;       
  122::313     4e-11  28%  377 aa  YRKH_BACSU RecName: Full=Uncharacterized protein yrkH;
   26::146     4e-11  38%  257 aa  GLO2_TRIEI RecName: Full=Hydroxyacylglutathione hydrolase;       
   17::141     4e-11  38%  258 aa  GLO2_PSEAE RecName: Full=Hydroxyacylglutathione hydrolase;       
   17::141     4e-11  38%  258 aa  GLO2_PSEA8 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     4e-11  38%  251 aa  GLO2_ESCF3 RecName: Full=Hydroxyacylglutathione hydrolase;       
   17::140     4e-11  35%  251 aa  GLO2_ERYLH RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     4e-11  38%  251 aa  GLO2_ECOSM RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     4e-11  38%  251 aa  GLO2_ECO7I RecName: Full=Hydroxyacylglutathione hydrolase;       
   22::136     5e-11  40%  255 aa  GLO2_XANAC RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::136     5e-11  31%  251 aa  GLO2_ERWCT RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     5e-11  38%  251 aa  GLO2_ECOUT RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     5e-11  38%  251 aa  GLO2_ECOL5 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     5e-11  38%  251 aa  GLO2_ECOK1 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     5e-11  38%  251 aa  GLO2_ECO81 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     5e-11  38%  251 aa  GLO2_ECO45 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     5e-11  38%  251 aa  GLO2_ECO27 RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::169     5e-11  33%  255 aa  GLO2_CHRSD RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::136     7e-11  33%  251 aa  GLO2_YERE8 RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::166     7e-11  34%  252 aa  GLO2_VIBCM RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::166     7e-11  34%  252 aa  GLO2_VIBCH RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::166     7e-11  34%  252 aa  GLO2_VIBC3 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_SHISS RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_SHIFL RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_SHIF8 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_SHIDS RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_SHIBS RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_SHIB3 RecName: Full=Hydroxyacylglutathione hydrolase;       
    1::171     7e-11  34%  255 aa  GLO2_RHOS4 RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::166     7e-11  33%  255 aa  GLO2_NITEC RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::136     7e-11  32%  251 aa  GLO2_ENT38 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECOSE RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECOLI RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECOLC RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECOHS RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECODH RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECOBW RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECO8A RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECO5E RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECO57 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECO55 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     7e-11  38%  251 aa  GLO2_ECO24 RecName: Full=Hydroxyacylglutathione hydrolase;       
  167::368     7e-11  37%  431 aa  BLH_AGRT5 RecName: Full=Beta-lactamase hydrolase-like protein;     
   22::136     9e-11  40%  255 aa  GLO2_XANC5 RecName: Full=Hydroxyacylglutathione hydrolase;       
    1::171     9e-11  34%  255 aa  GLO2_RHOS1 RecName: Full=Hydroxyacylglutathione hydrolase;       
   16::146     9e-11  37%  257 aa  GLO2_NOSP7 RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::166     9e-11  34%  262 aa  GLO2_NITEU RecName: Full=Hydroxyacylglutathione hydrolase;       
   20::174     9e-11  32%  258 aa  GLO2C_ARATH RecName: Full=Hydroxyacylglutathione hydrolase
   63::159     1e-10  35%  220 aa  YYBB_BACSU RecName: Full=Uncharacterized protein yybB;
  181::367     1e-10  36%  431 aa  BLH_XYLFT RecName: Full=Beta-lactamase hydrolase-like protein;     
   26::139     1e-10  41%  268 aa  GLO2_THICR RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::142     1e-10  41%  259 aa  GLO2_PSEPG RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::170     1e-10  28%  252 aa  GLO2_FRATN RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::166     1e-10  33%  252 aa  GLO2_ALISL RecName: Full=Hydroxyacylglutathione hydrolase;       
    1::178     1e-10  32%  256 aa  GLO22_SCHPO RecName: Full=Probable hydroxyacylglutathione hydrolase
    3::165     2e-10  31%  251 aa  GLO2_YERPY RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::165     2e-10  31%  251 aa  GLO2_YERPS RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::165     2e-10  31%  251 aa  GLO2_YERPP RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::165     2e-10  31%  251 aa  GLO2_YERPN RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::165     2e-10  31%  251 aa  GLO2_YERPE RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::165     2e-10  31%  251 aa  GLO2_YERPB RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::165     2e-10  31%  251 aa  GLO2_YERPA RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::165     2e-10  31%  251 aa  GLO2_YERP3 RecName: Full=Hydroxyacylglutathione hydrolase;       
   28::147     2e-10  39%  267 aa  GLO2_SHESW RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::142     2e-10  35%  260 aa  GLO2_SHELP RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::170     2e-10  28%  252 aa  GLO2_FRATW RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::170     2e-10  28%  252 aa  GLO2_FRATT RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::170     2e-10  28%  252 aa  GLO2_FRATO RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::170     2e-10  28%  252 aa  GLO2_FRATM RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::170     2e-10  28%  252 aa  GLO2_FRATH RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::170     2e-10  28%  252 aa  GLO2_FRATF RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::170     2e-10  28%  252 aa  GLO2_FRAT1 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::136     2e-10  36%  251 aa  GLO2_ERWT9 RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::139     2e-10  38%  256 aa  GLO2_ALHEH RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::151     2e-10  36%  247 aa  GLO21_VIBVY RecName: Full=Hydroxyacylglutathione hydrolase 1;      
   79::236     3e-10  33%  277 aa  MBLC2_CHICK RecName: Full=Metallo-beta-lactamase domain-containing
   25::169     3e-10  30%  239 aa  GLO2_PELUB RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     3e-10  35%  251 aa  GLO2_SALPK RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     3e-10  35%  251 aa  GLO2_SALPA RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::172     3e-10  34%  256 aa  GLO2_AGRT5 RecName: Full=Hydroxyacylglutathione hydrolase;       
   24::171     4e-10  30%  255 aa  GLO2_RHOPA RecName: Full=Hydroxyacylglutathione hydrolase;       
   23::142     4e-10  35%  255 aa  GLO2_RHILO RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::166     6e-10  33%  254 aa  GLO2_AERS4 RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::146     6e-10  38%  257 aa  GLO2_ACAM1 RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     7e-10  35%  251 aa  GLO2_SALPC RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::165     7e-10  32%  235 aa  GLO2_ACTPJ RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::165     7e-10  32%  235 aa  GLO2_ACTP7 RecName: Full=Hydroxyacylglutathione hydrolase;       
    7::166     1e-09  33%  252 aa  GLO2_VIBF1 RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::148     1e-09  32%  259 aa  GLO2_SYNP2 RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::135     1e-09  29%  250 aa  GLO2_SODGM RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  34%  251 aa  GLO2_SALTI RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  35%  251 aa  GLO2_SALSV RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  35%  251 aa  GLO2_SALPB RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  35%  251 aa  GLO2_SALNS RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  35%  251 aa  GLO2_SALHS RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  35%  251 aa  GLO2_SALEP RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  35%  251 aa  GLO2_SALDC RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  35%  251 aa  GLO2_SALCH RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  35%  251 aa  GLO2_SALA4 RecName: Full=Hydroxyacylglutathione hydrolase;       
   54::147     1e-09  36%  260 aa  GLO2_OCHA4 RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::237     1e-09  27%  292 aa  GLOB2_DICDI RecName: Full=Glyoxylase B2;         EC=3.-.-.-;
    7::166     1e-09  33%  252 aa  GLO2_VIBFM RecName: Full=Hydroxyacylglutathione hydrolase;       
   16::175     1e-09  37%  257 aa  GLO2_SYNY3 RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     1e-09  33%  251 aa  GLO2_SALG2 RecName: Full=Hydroxyacylglutathione hydrolase;       
   17::141     1e-09  38%  258 aa  GLO2_PSEA7 RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::146     1e-09  38%  257 aa  GLO2_MICAN RecName: Full=Hydroxyacylglutathione hydrolase;       
   23::170     1e-09  33%  255 aa  GLO2_METS4 RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::150     2e-09  38%  252 aa  GLO2_VIBSL RecName: Full=Hydroxyacylglutathione hydrolase;       
    1::171     2e-09  30%  255 aa  GLO2_SILPO RecName: Full=Hydroxyacylglutathione hydrolase;       
   20::141     2e-09  38%  252 aa  GLO2_GLOVI RecName: Full=Hydroxyacylglutathione hydrolase;       
   24::171     2e-09  33%  255 aa  GLO2_BRASO RecName: Full=Hydroxyacylglutathione hydrolase;       
  120::263     2e-09  29%  385 aa  PNKD_BOVIN RecName: Full=Probable hydrolase PNKD;       
   28::143     2e-09  38%  263 aa  GLO2_SHEB8 RecName: Full=Hydroxyacylglutathione hydrolase;       
   24::171     2e-09  30%  255 aa  GLO2_NITWN RecName: Full=Hydroxyacylglutathione hydrolase;       
   47::170     2e-09  33%  255 aa  GLO2_METNO RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     2e-09  34%  251 aa  GLO2_CITK8 RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::165     2e-09  31%  235 aa  GLO2_ACTP2 RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::156     3e-09  33%  258 aa  GLO2_SHEAM RecName: Full=Hydroxyacylglutathione hydrolase;       
   17::138     3e-09  37%  255 aa  GLO2_PSEPF RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::164     4e-09  33%  258 aa  GLO2_XYLFA RecName: Full=Hydroxyacylglutathione hydrolase;       
   22::136     4e-09  39%  255 aa  GLO2_XANOM RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     4e-09  33%  251 aa  GLO2_SALTY RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::149     4e-09  36%  266 aa  GLO2_RALME RecName: Full=Hydroxyacylglutathione hydrolase;       
   16::146     4e-09  35%  257 aa  GLO2_CYAP8 RecName: Full=Hydroxyacylglutathione hydrolase;       
   16::169     4e-09  31%  253 aa  GLO2_BARQU RecName: Full=Hydroxyacylglutathione hydrolase;       
  120::263     5e-09  32%  385 aa  PNKD_MOUSE RecName: Full=Probable hydrolase PNKD;       
    3::164     5e-09  32%  258 aa  GLO2_XYLFT RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::164     5e-09  32%  258 aa  GLO2_XYLFM RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::164     5e-09  32%  258 aa  GLO2_XYLF2 RecName: Full=Hydroxyacylglutathione hydrolase;       
   41::141     5e-09  38%  252 aa  GLO2_SYNJA RecName: Full=Hydroxyacylglutathione hydrolase;       
   52::171     5e-09  34%  255 aa  GLO2_RHOPB RecName: Full=Hydroxyacylglutathione hydrolase;       
   48::171     5e-09  32%  255 aa  GLO2_RHOP2 RecName: Full=Hydroxyacylglutathione hydrolase;       
   23::142     5e-09  34%  255 aa  GLO2_MESSB RecName: Full=Hydroxyacylglutathione hydrolase;       
   16::169     5e-09  31%  253 aa  GLO2_BARHE RecName: Full=Hydroxyacylglutathione hydrolase;       
   71::201     6e-09  34%  287 aa  LACB2_XENLA RecName: Full=Beta-lactamase-like protein 2;       
   28::143     6e-09  40%  263 aa  GLO2_SHEB9 RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::136     6e-09  34%  251 aa  GLO2_SALAR RecName: Full=Hydroxyacylglutathione hydrolase;       
   82::239     8e-09  32%  279 aa  MBLC2_MOUSE RecName: Full=Metallo-beta-lactamase domain-containing
    3::143     8e-09  36%  263 aa  GLO2_MARAV RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::175     8e-09  35%  257 aa  GLO2_CYAP7 RecName: Full=Hydroxyacylglutathione hydrolase;       
   82::239     1e-08  32%  279 aa  MBLC2_HUMAN RecName: Full=Metallo-beta-lactamase domain-containing
   82::239     1e-08  32%  279 aa  MBLC2_BOVIN RecName: Full=Metallo-beta-lactamase domain-containing
   22::165     1e-08  37%  255 aa  GLO2_XANCP RecName: Full=Hydroxyacylglutathione hydrolase;       
   22::165     1e-08  37%  255 aa  GLO2_XANCB RecName: Full=Hydroxyacylglutathione hydrolase;       
   22::165     1e-08  37%  255 aa  GLO2_XANC8 RecName: Full=Hydroxyacylglutathione hydrolase;       
   45::147     1e-08  38%  258 aa  GLO2_SYNP6 RecName: Full=Hydroxyacylglutathione hydrolase;       
   41::141     1e-08  36%  252 aa  GLO2_SYNJB RecName: Full=Hydroxyacylglutathione hydrolase;       
   45::147     1e-08  38%  258 aa  GLO2_SYNE7 RecName: Full=Hydroxyacylglutathione hydrolase;       
   28::143     1e-08  37%  263 aa  GLO2_SHEB5 RecName: Full=Hydroxyacylglutathione hydrolase;       
   28::143     1e-08  38%  263 aa  GLO2_SHEB2 RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::153     1e-08  35%  257 aa  GLO2_PSEHT RecName: Full=Hydroxyacylglutathione hydrolase;       
    1::178     1e-08  30%  256 aa  GLO21_SCHPO RecName: Full=Probable hydroxyacylglutathione hydrolase
  120::263     1e-08  29%  385 aa  PNKD_HUMAN RecName: Full=Probable hydrolase PNKD;       
    4::147     1e-08  30%  267 aa  GLO2_SHESA RecName: Full=Hydroxyacylglutathione hydrolase;       
   52::171     1e-08  34%  255 aa  GLO2_NITHX RecName: Full=Hydroxyacylglutathione hydrolase;       
   37::145     1e-08  35%  256 aa  GLO2_CYAP4 RecName: Full=Hydroxyacylglutathione hydrolase;       
   46::146     2e-08  38%  257 aa  GLO2_CYAA5 RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::149     2e-08  39%  266 aa  GLO2_CUPTR RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::168     2e-08  34%  256 aa  GLO2_TOLAT RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::136     2e-08  29%  251 aa  GLO2_SERP5 RecName: Full=Hydroxyacylglutathione hydrolase;       
   44::216     2e-08  30%  303 aa  GLO2_DANRE RecName: Full=Hydroxyacylglutathione hydrolase,
   47::203     4e-08  31%  289 aa  LACB2_XENTR RecName: Full=Beta-lactamase-like protein 2;       
    1::173     5e-08  31%  283 aa  HAGHL_MOUSE RecName: Full=Hydroxyacylglutathione hydrolase-like
    3::81      5e-08  40%  252 aa  GLO2_VIBVU RecName: Full=Hydroxyacylglutathione hydrolase;       
   35::155     5e-08  39%  272 aa  GLO2_SACD2 RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::139     5e-08  33%  255 aa  GLO2_RHOFD RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::136     5e-08  31%  250 aa  GLO2_PHOLL RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::81      5e-08  40%  252 aa  GLO22_VIBVY RecName: Full=Hydroxyacylglutathione hydrolase 2;    
   70::202     7e-08  31%  288 aa  LACB2_HUMAN RecName: Full=Beta-lactamase-like protein 2;       
   36::135     7e-08  44%  254 aa  GLO2_STRM5 RecName: Full=Hydroxyacylglutathione hydrolase;       
   43::163     7e-08  38%  236 aa  GLO2_MANSM RecName: Full=Hydroxyacylglutathione hydrolase;       
   46::202     9e-08  29%  288 aa  LACB2_RAT RecName: Full=Beta-lactamase-like protein 2;       
   17::138     9e-08  36%  255 aa  GLO2_PSEFS RecName: Full=Hydroxyacylglutathione hydrolase;       
    6::138     9e-08  32%  255 aa  GLO2_HALHL RecName: Full=Hydroxyacylglutathione hydrolase;       
   26::135     1e-07  34%  251 aa  GLO2_WIGBR RecName: Full=Hydroxyacylglutathione hydrolase;       
   90::142     1e-07  45%  255 aa  GLO2_RHOBL RecName: Full=Hydroxyacylglutathione hydrolase;       
   91::172     1e-07  39%  256 aa  GLO2_RHIL3 RecName: Full=Hydroxyacylglutathione hydrolase;       
   18::182     1e-07  30%  269 aa  GLO2_LEPBL RecName: Full=Hydroxyacylglutathione hydrolase;       
   18::182     1e-07  30%  269 aa  GLO2_LEPBJ RecName: Full=Hydroxyacylglutathione hydrolase;       
   38::171     1e-07  31%  255 aa  GLO2_BRAJA RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::135     1e-07  31%  257 aa  GLO2_BAUCH RecName: Full=Hydroxyacylglutathione hydrolase;       
   43::146     1e-07  38%  257 aa  GLO2_ANASP RecName: Full=Hydroxyacylglutathione hydrolase;       
   25::171     2e-07  32%  259 aa  GLO2_PSEE4 RecName: Full=Hydroxyacylglutathione hydrolase;       
   50::146     2e-07  39%  257 aa  GLO2_ANAVT RecName: Full=Hydroxyacylglutathione hydrolase;       
   70::202     2e-07  30%  289 aa  LACB2_DANRE RecName: Full=Beta-lactamase-like protein 2;       
   24::161     2e-07  29%  246 aa  GLO2_PROM9 RecName: Full=Hydroxyacylglutathione hydrolase;       
   69::166     2e-07  34%  254 aa  GLO2_AERHH RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::143     3e-07  33%  256 aa  GLO2_JANSC RecName: Full=Hydroxyacylglutathione hydrolase;       
   30::163     3e-07  36%  238 aa  GLO2_HAEIN RecName: Full=Hydroxyacylglutathione hydrolase;       
   26::136     3e-07  35%  251 aa  GLO2_EDWI9 RecName: Full=Hydroxyacylglutathione hydrolase;       
   70::202     3e-07  30%  288 aa  LACB2_BOVIN RecName: Full=Beta-lactamase-like protein 2;       
   69::172     3e-07  33%  256 aa  GLO2_RHIEC RecName: Full=Hydroxyacylglutathione hydrolase;       
   70::202     4e-07  32%  288 aa  LACB2_MOUSE RecName: Full=Beta-lactamase-like protein 2;       
    3::149     6e-07  34%  266 aa  GLO2_RALEJ RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::141     6e-07  32%  256 aa  GLO2_METCA RecName: Full=Hydroxyacylglutathione hydrolase;       
   51::223     6e-07  29%  310 aa  GLO2_CHICK RecName: Full=Hydroxyacylglutathione hydrolase,
   26::151     6e-07  31%  256 aa  GLO2_BLOFL RecName: Full=Hydroxyacylglutathione hydrolase;       
   31::161     8e-07  30%  246 aa  GLO2_PROM0 RecName: Full=Hydroxyacylglutathione hydrolase;       
  101::184     8e-07  36%  290 aa  BLA1_STEMA RecName: Full=Metallo-beta-lactamase L1;       
    3::165     1e-06  32%  235 aa  GLO2_HAEPS RecName: Full=Hydroxyacylglutathione hydrolase;       
   33::159     1e-06  35%  260 aa  GLO2_PROMM RecName: Full=Hydroxyacylglutathione hydrolase;       
   10::165     1e-06  28%  235 aa  GLO2_HAEDU RecName: Full=Hydroxyacylglutathione hydrolase;       
   88::169     1e-06  34%  253 aa  GLO2_BART1 RecName: Full=Hydroxyacylglutathione hydrolase;       
   31::161     2e-06  28%  246 aa  GLO2_PROMS RecName: Full=Hydroxyacylglutathione hydrolase;       
    4::163     2e-06  30%  233 aa  GLO2_ACTSZ RecName: Full=Hydroxyacylglutathione hydrolase;       
   21::191     2e-06  29%  206 aa  Y888_METJA RecName: Full=Uncharacterized protein MJ0888;
   45::147     2e-06  38%  249 aa  GLO2_SYNSC RecName: Full=Hydroxyacylglutathione hydrolase;       
   90::142     2e-06  43%  255 aa  GLO2_RHOS5 RecName: Full=Hydroxyacylglutathione hydrolase;       
   18::167     3e-06  39%  301 aa  RNZ_BRAJA RecName: Full=Ribonuclease Z;         Short=RNase Z;     
    8::142     3e-06  30%  253 aa  GLO2_PROMA RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::152     4e-06  26%  254 aa  GLO2_LEGPH RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::152     4e-06  26%  254 aa  GLO2_LEGPC RecName: Full=Hydroxyacylglutathione hydrolase;       
   90::171     5e-06  34%  255 aa  GLO2_RHOP5 RecName: Full=Hydroxyacylglutathione hydrolase;       
    8::76      6e-06  34%  241 aa  Y4333_HERA2 RecName: Full=UPF0173 metal-dependent hydrolase
   14::70      6e-06  45%  229 aa  Y1060_STAS1 RecName: Full=UPF0173 metal-dependent hydrolase
    3::152     6e-06  26%  254 aa  GLO2_LEGPL RecName: Full=Hydroxyacylglutathione hydrolase;       
    1::171     1e-05  26%  255 aa  GLO2_ROSDO RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::166     1e-05  29%  250 aa  GLO2_NEIG2 RecName: Full=Hydroxyacylglutathione hydrolase;       
    3::152     1e-05  26%  254 aa  GLO2_LEGPA RecName: Full=Hydroxyacylglutathione hydrolase;       
   43::67      1e-05  64%  220 aa  Y1118_PICTO RecName: Full=UPF0173 metal-dependent hydrolase
   48::198     1e-05  27%  295 aa  LACB2_CAEEL RecName: Full=Beta-lactamase-like protein 2 homolog;   
    8::150     1e-05  32%  251 aa  GLO2_PROMT RecName: Full=Hydroxyacylglutathione hydrolase;       
    8::150     1e-05  32%  251 aa  GLO2_PROM1 RecName: Full=Hydroxyacylglutathione hydrolase;       
   26::69      2e-05  39%  301 aa  RNZ_BRASO RecName: Full=Ribonuclease Z;         Short=RNase Z;   
   45::147     2e-05  37%  249 aa  GLO2_SYNPX RecName: Full=Hydroxyacylglutathione hydrolase;       
   14::71      2e-05  41%  227 aa  Y3294_BACCN RecName: Full=UPF0173 metal-dependent hydrolase
   46::161     2e-05  35%  267 aa  GLO2_SHEON RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::166     2e-05  29%  250 aa  GLO2_NEIG1 RecName: Full=Hydroxyacylglutathione hydrolase;       
   19::162     3e-05  24%  233 aa  YOBT_BACSU RecName: Full=Uncharacterized protein yobT;       
   42::149     3e-05  41%  251 aa  GLO2_SYNS9 RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::166     3e-05  29%  252 aa  GLO2_NEIMF RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::166     3e-05  29%  252 aa  GLO2_NEIMB RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::166     3e-05  29%  250 aa  GLO2_NEIMA RecName: Full=Hydroxyacylglutathione hydrolase;       
    2::166     3e-05  29%  252 aa  GLO2_NEIM0 RecName: Full=Hydroxyacylglutathione hydrolase;       
   14::71      4e-05  41%  227 aa  Y4741_BACC7 RecName: Full=UPF0173 metal-dependent hydrolase
   14::70      4e-05  43%  229 aa  Y1382_STAES RecName: Full=UPF0173 metal-dependent hydrolase
   14::70      4e-05  43%  229 aa  Y1270_STAEQ RecName: Full=UPF0173 metal-dependent hydrolase
    4::137     5e-05  33%  256 aa  GLO2_THIDA RecName: Full=Hydroxyacylglutathione hydrolase;       
   22::141     5e-05  32%  258 aa  GLO2_SHEDO RecName: Full=Hydroxyacylglutathione hydrolase;       
   14::71      7e-05  40%  226 aa  Y3178_BACHD RecName: Full=UPF0173 metal-dependent hydrolase
    4::76      7e-05  31%  226 aa  Y1373_MACCJ RecName: Full=UPF0173 metal-dependent hydrolase
   14::70      7e-05  43%  229 aa  Y1218_STAHJ RecName: Full=UPF0173 metal-dependent hydrolase
   50::153     7e-05  36%  255 aa  GLO2_SYNPW RecName: Full=Hydroxyacylglutathione hydrolase;       
   14::71      9e-05  39%  227 aa  Y515_BACC2 RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4892_BACAC RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4871_BACAA RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4860_BACAN RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4747_BACC1 RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4729_BACC0 RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4725_BACC3 RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4722_BACC4 RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4418_BACCQ RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4343_BACHK RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      9e-05  39%  227 aa  Y4194_BACAH RecName: Full=UPF0173 metal-dependent hydrolase
   14::63      9e-05  46%  226 aa  Y2750_GEOKA RecName: Full=UPF0173 metal-dependent hydrolase
   14::63      9e-05  46%  226 aa  Y2675_GEOTN RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      1e-04  38%  227 aa  Y4613_BACCR RecName: Full=UPF0173 metal-dependent hydrolase
   14::70      1e-04  37%  230 aa  Y1312_STACT RecName: Full=UPF0173 metal-dependent hydrolase
   37::64      2e-04  54%  217 aa  Y1163_METJA RecName: Full=UPF0173 metal-dependent hydrolase
   14::68      2e-04  35%  226 aa  Y1162_THEMA RecName: Full=UPF0173 metal-dependent hydrolase
   66::99      2e-04  41%  555 aa  RNJ1_BACSU RecName: Full=Ribonuclease J 1;         Short=RNase
   18::153     2e-04  26%  274 aa  GLO2_YEAST RecName: Full=Hydroxyacylglutathione hydrolase,
   47::73      2e-04  56%  230 aa  Y574_PARDP RecName: Full=UPF0173 metal-dependent hydrolase
   61::126     2e-04  45%  291 aa  Y5695_RALME RecName: Full=UPF0173 metal-dependent hydrolase
   46::104     3e-04  45%  273 aa  Y4324_POLSJ RecName: Full=UPF0173 metal-dependent hydrolase
   47::92      3e-04  41%  230 aa  Y1920_SILST RecName: Full=UPF0173 metal-dependent hydrolase
   38::67      3e-04  53%  231 aa  Y1265_ARCFU RecName: Full=UPF0173 metal-dependent hydrolase
   17::150     3e-04  32%  210 aa  Y119_PYRAB RecName: Full=UPF0173 protein PYRAB01190;
  626::725     3e-04  47%  810 aa  SYFB_BURPS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
  626::725     3e-04  47%  810 aa  SYFB_BURP1 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
  626::725     3e-04  47%  810 aa  SYFB_BURMA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   73::103     3e-04  45%  448 aa  RNJ_METJA RecName: Full=Ribonuclease J;         Short=RNase J;     
   56::99      3e-04  36%  555 aa  RNJ2_BACSU RecName: Full=Ribonuclease J 2;         Short=RNase
   14::71      4e-04  38%  227 aa  Y4354_BACCZ RecName: Full=UPF0173 metal-dependent hydrolase
    9::71      4e-04  36%  227 aa  Y4138_LYSSC RecName: Full=UPF0173 metal-dependent hydrolase
   14::92      4e-04  37%  230 aa  Y2976_SILPO RecName: Full=UPF0173 metal-dependent hydrolase
   39::70      4e-04  44%  229 aa  Y1785_STAAR RecName: Full=UPF0173 metal-dependent hydrolase
   31::79      4e-04  33%  314 aa  RNZ_KINRD RecName: Full=Ribonuclease Z;         Short=RNase Z;   
   66::96      4e-04  48%  620 aa  RNJ1_STAS1 RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  559 aa  RNJ1_STAHJ RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAAW RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAAS RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAAR RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAAN RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAAM RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAAC RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAAB RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAA8 RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      4e-04  48%  565 aa  RNJ1_STAA3 RecName: Full=Ribonuclease J 1;         Short=RNase
   41::129     5e-04  36%  266 aa  Y171_GEOLS RecName: Full=UPF0173 metal-dependent hydrolase
   73::101     5e-04  41%  569 aa  RNJ_MYCPN RecName: Full=Ribonuclease J;         Short=RNase J;     
   66::96      5e-04  48%  560 aa  RNJ1_STAES RecName: Full=Ribonuclease J 1;         Short=RNase
   66::96      5e-04  48%  560 aa  RNJ1_STAEQ RecName: Full=Ribonuclease J 1;         Short=RNase
   90::171     5e-04  34%  256 aa  GLO2_RHOCA RecName: Full=Hydroxyacylglutathione hydrolase;       
   23::70      6e-04  33%  233 aa  Y3437_ACIBL RecName: Full=UPF0173 metal-dependent hydrolase
   21::73      6e-04  41%  230 aa  Y2229_RHOS5 RecName: Full=UPF0173 metal-dependent hydrolase
   14::67      6e-04  35%  210 aa  Y020_PYRFU RecName: Full=UPF0173 protein PF0020;
  626::725     6e-04  45%  810 aa  SYFB_BURTA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   73::101     6e-04  38%  569 aa  RNJ_MYCGE RecName: Full=Ribonuclease J;         Short=RNase J;     
   37::87      6e-04  37%  492 aa  LIPB_PORGI RecName: Full=Octanoyltransferase;       
   50::153     6e-04  31%  254 aa  GLO2_SYNS3 RecName: Full=Hydroxyacylglutathione hydrolase;       
   84::166     6e-04  36%  255 aa  GLO2_ANADE RecName: Full=Hydroxyacylglutathione hydrolase;       
   32::69      8e-04  39%  223 aa  Y864_THEVO RecName: Full=UPF0173 metal-dependent hydrolase
   14::71      8e-04  34%  225 aa  Y488_ANOFW RecName: Full=UPF0173 metal-dependent hydrolase
    1::212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHIDHAGGAGELAR
YCBL_ECOLI      MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLDHVGAAAELAQ
Y1663_HAEIN     MNIEIIPVTAFQQNCSLIWDDEKN-AAIIDPGGEAERLIQRIEEXXXXXXXXXXTHGHLDHVGAAMQLKQ
Y2135_AQUAE     MIIKVIPVGPIAVNCSVVADEKSGEAIIIDPGAEAEKILEAVKD--FKVVGIVATHGHIDHVGQVGKLKE
YQGX_BACSU      MKWRRMPVGPIQANAYFLISDD--QCLIFDPGGEGHKINQYIKEKGLTPLAILLTHAHFDHIGALDEVRE
Y2612_MYCBO     -------------NCYVLAERPGTDAVIVDPGQGAMGTLRRIDKNRLTPAAVLLTHGHIDHIWSAQKVSD
Y2581_MYCTU     -------------NCYVLAERPGTDAVIVDPGQGAMGTLRRIDKNRLTPAAVLLTHGHIDHIWSAQKVSD
Y493_MYCLE      ------PAGMLQCNCYVLADRAGTDAVIVDPGGPLRRIL---DENRLTPSAVLLTHGHIDHMWSAQKVSD
Y554_STRP6      ---------------------------LIDPGSNGQEIISKIKSFEKPLVAILLTHTHYDHIFSLDLVRD
ETHE1_BOVIN     ------------KSCTLLGDRESREAVLIDPVLETAQRDAQLELG-LRLLYAVNTHCHADHITGSGLLRS
ETHE1_HUMAN     -------------SCTLLGDRESREAVLIDPVLETAPRDAQLELG-LRLLYAVNTHCHADHITGSGLLRS
ETHE1_MOUSE     ------------KSCTLLGDRESREAVLIDPVLETAHRDAQLELG-LKLLYAVNTHCHADHITGTGVLRS
GLO2_BDEBA      ----------------ILTDDATQKAVAVDPG-DAGPVIDFLRANKLDLAAILLTHHHSDHIGGVGELKA
GLO2O_ARATH     -------------------------ALLIDPDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKT
GLO2_PSEMY      ----------------------SRRCAVVDPG-DAAPVLAWLEAGDWTLSDILITHHHFDHVGGVEQLKK
GLO2_RHORT      ----------------LVRCRATGACAVIDPSL-AEPVLAAAESLGWTITHILNTHHHYDHTGGNEEI--
GLO2_HAHCH      ---EILPIPAFNDNYIWSIQSDQGDAWVVDPG-DAQPVLRHLAENHLTLRGILITHHHHDHTGGVNELLA
GLO2_METFK      --FEIIPILAFEDNYIWL-LHQHGHALVVDPG-DAHPVLEILDARGLQLRAILVTHHHQDHTGGVEELIQ
GLO2_HERAR      -------------------------AAVVDPG-DATPILAALEEHQLSLVAILLTHHHADHVGGVAKLLQ
GLO2_THEEB      ----------------LLHDPQTGTAAVVDPA-EPEPVLAKAELGAT-LRAIFNTHHHWDHVGANCALRS
GLO2_MARMM      ---------------------DSGETATIDTP-DADVILNEADQAGWSITQIWNTHHHFDHAGGNETIQA
GLO2_DECAR      ------------------------RAFVVDPG-DAAPVLARLEAGGLMLEGILITHHHADHQGGVAELKA
GLO2_NITOC      ----------------LIACPETGEALAIDPL-DHRQCLATAKRNGWRITQIFNTHEHGDHTGGNEAIIA
GLO2_KLEP3      ----LISIPAFQDNYIWVLSENNGRCIIVDPG-EAAPVLAAIEENQWQPEAILLTHHHQDHVGGVKQLRE
GLO2_IDILO      ---------------------DKDKVIIVDPG-EAQPVQQWLEQNSKSIETILVTHHHYDHTGGIAELIE
GLO2_VIBPA      ---EIKSIPAFNDNYIWLIQNSDKRCAVVDPG-DAQPVLDYLQANELTLEAILVTHHHNDHIGGVPDLVR
GLO2_VIBHB      ---EIKSIPAFNDNYIWLIQNSDKRCAVVDPG-DAKPVLEYLQANELTLEAILITHHHNDHIGGVSDLVR
GLO2_POLSJ      ----------------LIACPETGEALAIDPL-DHEKTLATARVKGWQITQVLNTHEHHDHTGGNAAV--
GLO2_KLEP7      ----LISIPAFQDNYIWVLSENNGRCIIVDPG-EAAPVLAAIEENQWQPEAILLTHHHQDHVGGVKQLRE
BLH_XYLFA       --------------------EKSGATATTN----ADAILAHVEQQGLTVEWILDTHPHADHFSAAQYLKQ
GLO2_HYPNA      ----------------------SGRTIAIDTP-DAAVYLAEAEKMSWTISEIWNTHWHPDHAGGNLKIKE
GLO2_PSYIN      ----------------LIKDSQSQHCIIVDPG-DAAPVLTILEDQKLIVDAILLTHHHYDHIGGVDAL--
GLO2_PSEU2      ----------------------SQQCAVVDPG-DAKPVLGLAQNPDYRLTDILITHHHNDHVGGVAELKQ
GLO2_HAMD5      ----LIHIPALESNYIWLLADSNQHCVIVDPGSPVESVLTYKG---LLPQAILLTHHHQDHLGGVPQLLR
GLO2_BUCAP      ---------------------------IIDPGVS-EDIIKKIEKKNWKLIAILLTHNHIDHVGGVEEIIR
GLO2N_ARATH     ----------------ILHDEDTGTVGVVDPS-EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKD
GLO2_BRUSU      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_BRUSI      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_BRUO2      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_BRUME      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_BRUMB      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_BRUC2      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_BRUAB      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_BRUA2      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_BRUA1      ---------------------ESALTATID-APDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKE
GLO2_PSEPK      ------------------------RCAVVDPGGPVERWLAANPEWVLS--DILVTHHHNDHVGGVERLRQ
GLO2_PSEP1      ------------------------RCAVVDPGGPVERWLAANPEWVLS--DILVTHHHNDHVGGVERLRQ
GLO2_PSEF5      ----------------LLQDHRSQRCAVVDPG-DAAPVLAWLEQGWV-LSDILITHHHHDHVGGVERLKQ
GLO2_PSE14      ----------------------SQQCAVVDPG-DAKPVLGLTEHPDYRLTDILITHHHNDHVGGVAELKQ
GLO2_PSESM      ----------------------SQQCVVVDPGDAAPVLEWLAQNPHCRLTDILITHHHNDHVGGVVELKQ
GLO2_PECCP      ----LISIPALQDNYIWLLSNKENRCVIVDPG-EASPVLDALAQHALFPEAILLTHHHNDHVGGVHELLK
GLO2_MARMS      ----IFPLPAFNDNYIIIQDKDSSGIWAVDPG-KADVVLNFCHEYQKTLTGILITHHHKDHTGGVAELKQ
GLO2_FRAP2      ----------------------------------------------LKLEAILITHRHGDHIAGVKKLL-
GLO2_RHIME      ----------------------SGATASID-APEERPILDALERRGWQLTHILTTHHHGDHVAANASLKE
GLO2_ECOL6      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVK
GLO2_PSEPW      ------------------------RCAVVDPGAPVEAWLAANPDWVL--EDILVTHHHNDHVGGVERLKK
GLO2_BUCAI      ----------------------SGSCIIIDPGLS-EPIIQEIERKKWRLRAILLTHNHIDHTGGTRKI--
GLO2M_ARATH     LKIELVPCSKD-NYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNW-NLTYILNTHHHDDHIGGNAELKE
GLO2_SHEPC      ---------------------------VVDPG-DAKVVIAYLVSHQLALAGILLTHHHQDHTGGVGELKR
GLO2_ECOLU      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVK
YRKH_BACSU      ---EMYQFVRIGKGCLSYMVISNGEAAIIDATRMVNFFIDFAKGKGATITHVFDTHLHADHISGGRVIAE
GLO2_TRIEI      --------------------------AVVDPA-EVRPVIDKLESLGAELVTIFNTHHHFDHVGANKQLIQ
GLO2_PSEAE      ----------------LLQDATSRRCAVVDPG-DAKPVEAWLAAHPWRLSDILVTXXXXXXVGGVAALKE
GLO2_PSEA8      ----------------LLQDATSRRCAVVDPG-DAKPVEAWLAAHPWRLSDILVTXXXXXXVGGVAALKE
GLO2_ESCF3      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVK
GLO2_ERYLH      ----------------LLHDPDSGETAAIDTP-DGKEYLKQAKAKGWTITHIWNTHWHPDHAGGNKDIVE
GLO2_ECOSM      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVK
GLO2_ECO7I      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVK
GLO2_XANAC      -----------------------GRAIIVDPG-QAEPVLAAAQRQGLVPSAVLLTHHHGDHIGGVAELQQ
GLO2_ERWCT      ----LISIPALQDNYIWLLSNKANRCVIVDPG-EASPVLNALDQNALLPEAILLTHHHNDHVGGVSEILN
GLO2_ECOUT      --------------------DEAGRCLIVDPG-DAEPVLNAISANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECOL5      --------------------DEAGRCLIVDPG-DAEPVLNAISANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECOK1      --------------------DEAGRCLIVDPG-DAEPVLNAISANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECO81      --------------------DEAGRCLIVDPG-DAEPVLNAISANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECO45      --------------------DEAGRCLIVDPG-DAEPVLNAISANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECO27      --------------------DEAGRCLIVDPG-DAEPVLNAISANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_CHRSD      ----VIPIPAFQDNIWLLRQDASDKVVIVDP-GDAQPVIEYLEREGLSLAAILVTXXXXXXTGGIDALVK
GLO2_YERE8      ----LISIPAFQDNYIWLLADEQKHCVIVDPG-ESAPVLAALSQGQYLPQAILLTHHHNDHVGGVADLRR
GLO2_VIBCM      ---QIKSIPAFDDNYIWLIQNRDRDCAVVDPGS-AEPVLAYLKQHDLNLKAVLITHHHHDHIGGVAELVH
GLO2_VIBCH      ---QIKSIPAFDDNYIWLIQNRDRDCAVVDPGS-AEPVLAYLKQHDLNLKAVLITHHHHDHIGGVAELVH
GLO2_VIBC3      ---QIKSIPAFDDNYIWLIQNRDRDCAVVDPGS-AEPVLAYLKQHDLNLKAVLITHHHHDHIGGVAELVH
GLO2_SHISS      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_SHIFL      --------------------DEAGRCLIVDPG-DAEPVLNAITANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_SHIF8      --------------------DEAGRCLIVDPG-DAEPVLNAITANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_SHIDS      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_SHIBS      --------------------DEAGRCLIVDPG-DAEPVLNAITANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_SHIB3      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_RHOS4      MPLELVTVPCLSDNYAFLVHDATGETSVVDVP-EAGPILKALEERGWHLSQILLTHHHSDHVAGVEELXX
GLO2_NITEC      ---DVFPVRAFKDNYIWI-VHNQQFALIIDPG-DATPVLAWISQQNLQPIAILCTHHHHDHTGGIPSLVQ
GLO2_ENT38      ----LISIPAFQDNYIWVLADDKDRCVIVDPG-EAAPVLKAIEENGWQPEAILLTHHHNDHVGGVPALCA
GLO2_ECOSE      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECOLI      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECOLC      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECOHS      --------------------DEAGRCLIVDPG-DAEPVLNAITANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECODH      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECOBW      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECO8A      --------------------DEAGRCLIVDPG-DAEPVLNAITANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECO5E      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECO57      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECO55      --------------------DEAGRCLIVDPG-DAEPVLNAITANNWQPEAIFLTHHHHDHVGGVKELVE
GLO2_ECO24      --------------------DEAGRCLIVDPG-DAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVE
BLH_AGRT5       ----------------------TGGCAIIDPVYDFDEILDYVKRHGLSVEWILDTHPHADHFSAADYLKQ
GLO2_XANC5      -----------------------GRAIIVDPG-QAEPVLAAAQHQGLVPSAVLLTHHHGDHIGGVAELQQ
GLO2_RHOS1      MPLELVTVPCLSDNYAFLVHDATGETSVVDVP-EAGPVLKALEERGWHLSQILLTHHHSDHVAGVEELXX
GLO2_NOSP7      ----------------LLYDDKRNIAAVVDPA-EAQPVLKKLAELKADLVAIFNTHHHNDHVGGNKQL--
GLO2_NITEU      ----VFPVRAFRDNYIWI-VHNQQFALIIDPG-DATPVLTWLRQQKLQPIAILCTHHHHDHTGGISLLVQ
GLO2C_ARATH     --------------------ESTGDAAVVDPV-DPEKVIASAEKHQAKIKFVLTTHHHWDHAGGNEKIKQ
YYBB_BACSU      ---------------------------------------------------ILLTHGHSDHIGGASKWLE
BLH_XYLFT       --------------------EKSGATATTN----ADAILAHVEQQGLTVEWILDTHPHADHFSAAQYLKQ
GLO2_THICR      ------------------------RAWIVDPG-ESQKVIHYFEENQLQLDGILLTHHHYDHTDGIGVMDA
GLO2_PSEPG      ------------------------RCAVVDPGAPVERWLAANPEWVLS--DILVTHHHNDHVGGVERLKQ
GLO2_FRATN      ---------------------DKSHAIVIDPKSDIAEFIAKNK---LQLEAILITHKHGDHIAGVKKLL-
GLO2_ALISL      ----IKSIPAFNDNYIWLIHNNDNHCVVVDPG-EAAPVLACLKEHGLILDAILITHHHHDHIGGVPELVR
GLO22_SCHPO     MSFQILPIPMWVGTAYLLLCEETRQAAIVDPA-EVNVVMPKLKNKEIDLQAILTTHHHADHSGG------
GLO2_YERPY      ----LISIPAFQDNYIWLLANRQKHCVIVDPG-ESAPVLATLAQGQYVPQAILLTHHHNDHVGGVADLRH
GLO2_YERPS      ----LISIPAFQDNYIWLLANRQKHCVIVDPG-ESAPVLATLAQGQYVPQAILLTHHHNDHVGGVADLRH
GLO2_YERPP      ----LISIPAFQDNYIWLLANRQKHCVIVDPG-ESAPVLATLAQGQYVPQAILLTHHHNDHVGGVADLRH
GLO2_YERPN      ----LISIPAFQDNYIWLLANRQKHCVIVDPG-ESAPVLATLAQGQYVPQAILLTHHHNDHVGGVADLRH
GLO2_YERPE      ----LISIPAFQDNYIWLLANRQKHCVIVDPG-ESAPVLATLAQGQYVPQAILLTHHHNDHVGGVADLRH
GLO2_YERPB      ----LISIPAFQDNYIWLLANRQKHCVIVDPG-ESAPVLATLAQGQYVPQAILLTHHHNDHVGGVADLRH
GLO2_YERPA      ----LISIPAFQDNYIWLLANRQKHCVIVDPG-ESAPVLATLAQGQYVPQAILLTHHHNDHVGGVADLRH
GLO2_YERP3      ----LISIPAFQDNYIWLLANRQKHCVIVDPG-ESAPVLATLAQGQYVPQAILLTHHHNDHVGGVADLRH
GLO2_SHESW      ---------------------------VVDPG-DAKVVIAYLVSHQLALAGILLTHHHQDHTGGVGELKR
GLO2_SHELP      ----VTPIPAFNDNYILIHAKDSGGHYVVDPG-DAKAVLDYLEQHQIVLDGILITHHHSDHTGGIAELSH
GLO2_FRATW      ---------------------DKSHAIVIDPKSDIAEFIAKNK---LQLEAILITHKHGDHIAGVKKLL-
GLO2_FRATT      ---------------------DKSHAIVIDPKSDIAEFIAKNK---LQLEAILITHKHGDHIAGVKKLL-
GLO2_FRATO      ---------------------DKSHAIVIDPKSDIAEFIAKNK---LQLEAILITHKHGDHIAGVKKLL-
GLO2_FRATM      ---------------------DKSHAIVIDPKSDIAEFIAKNK---LQLEAILITHKHGDHIAGVKKLL-
GLO2_FRATH      ---------------------DKSHAIVIDPKSDIAEFIAKNK---LQLEAILITHKHGDHIAGVKKLL-
GLO2_FRATF      ---------------------DKSHAIVIDPKSDIAEFIAKNK---LQLEAILITHKHGDHIAGVKKLL-
GLO2_FRAT1      ---------------------DKSHAIVIDPKSDIAEFIAKNK---LQLEAILITHKHGDHIAGVKKLL-
GLO2_ERWT9      --------------------DDSGRCLIVDPG-EAAPVLRAITENQWQPQAILLTHHHHDHVGGVAELLS
GLO2_ALHEH      ---EIVAIPAFADNYIWLAVDRNRRAAVVDPG-DAEPVEXXXXXXXXXXXXXXITHHHHDHTGGVEELLA
GLO21_VIBVY     ---------------------DKSKAIVIDPG-ESEKIINFLDKNNLTLEFIFLTHGHCDHTKGVFSLKE
MBLC2_CHICK     ------------------------------------------------------THVHFDHSGGLQHFXX
GLO2_PELUB      -------------------------ACVIDPS-EAKPVIKYLEDKNIHLKYILNTHHHYDHVGGNKELKE
GLO2_SALPK      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_SALPA      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_AGRT5      ----------------LLHDPESGATAAID-APEEGPILRALDGHGWKLTHIFTTHHHQDHVEANLVLKD
GLO2_RHOPA      ----------------------TGATASID-APEAAPLIAALDKEGWKLTDILVTHHHGDHVGGIAELKK
GLO2_RHILO      ---------------------KSGQTAIIDAPEEAPILAAIKRTGWTPT-MILTTHHHMDHVEANLALKE
GLO2_AERS4      --YTVITVPAFTDNYIWLIRHEN-HCLVVDPG-DAGPVXXXXXXXXXXXXXXXXTHHHQDHVGGVTALLK
GLO2_ACAM1      -------------------------AAVVDPADPQPVLKKLAELGA-ELVAIFNTHHHSDHVGGNRTL--
GLO2_SALPC      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_ACTPJ      ----ITPIPALSDNY-IWAIQKDNDVIIVDPS-DAVPVLAFIAKNQLNLTAILLTHNHHDHTDGMPELLS
GLO2_ACTP7      ----ITPIPALSDNY-IWAIQKDNDVIIVDPS-DAVPVLAFIAKNQLNLTAILLTHNHHDHTDGMPELLS
GLO2_VIBF1      -------IPAFNDNYIWLIHNNDNHCVVVDPG-DATPVLECIKEHDFILDAILITHHHHDHIGGVPELVR
GLO2_SYNP2      ---EIIRLPAFNDNYIFLLVDRAGDCAVVDPG-DAKVVLEYLSKEDLTLKTILITHHHADHVGGNRQLLS
GLO2_SODGM      ----LISIPALADNYIWLLHNDDRRCLVVDPGDATPVLQALADHRLTPVA-VLLTHHHQDHVGGVSELLQ
GLO2_SALTI      -------IPAFQDNYIWVLTNDEGRCVIVDPG-EAAPVLKAIAAHKWMPEAIFLTHHHYDHVGGVKELLQ
GLO2_SALSV      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_SALPB      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_SALNS      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_SALHS      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_SALEP      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_SALDC      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_SALCH      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_SALA4      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_OCHA4      ------------------------------------------------LDFIFTTHHHLDHVEGNEALKA
GLOB2_DICDI     -KIEVFPELESATGQMIIIDEQTKKCAILDSTKDADKLIAYIKENQLEPEWILETHIHADHLSGAGIYPN
GLO2_VIBFM      -------IPAFNDNYIWLIHNNDNHCVVVDPG-DATPVLECIKEHDFILDAILITHHHHDHIGGVPELVR
GLO2_SYNY3      ----------------LLHDRQRNQAAVVDPA-EAKPVLDCLETLGADLVTIYNTHHHGDHVGANRELAK
GLO2_SALG2      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_PSEA7      ----------------LLQDATSRRCAVVDPGDPVEAWLAAHPDW--RLSDILVTXXXXXXVGGVAALKE
GLO2_MICAN      -------------------------AAVVDPA-EPEPVFRRLEALQVDLVAIFNTHHHGDHVGANQALIN
GLO2_METS4      ----------------------TGACAAIDEAGAVLRVLG--ETGW-SLTDILVTHRHFDHVEGTPEVKA
GLO2_VIBSL      ----IKSIPAFNDNYIWLIQNSDRRCAVVDPG-DAAPVLEYLAHHELTLDAILITHHHHDHIGGVPELVR
GLO2_SILPO      MPLEIVTVPCLSDNYALIHDADAGKTALVD-APEAAPIQSELDRRGWSLDQVWLTHHHWDHVDGLAALRD
GLO2_GLOVI      --------------------EAARTAAVVDPAEARPVLEALVRLG-LKLVAIFNTHHHHDHVGGNREL--
GLO2_BRASO      ----------------------TGATASVD-APEAGPIVRQLEANGWTLTDILITHHHYDHVGGVAELKQ
PNKD_BOVIN      ---KVLPIPVLSDNYSYLIIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGNRDLSR
GLO2_SHEB8      ---------------------------VVDPG-DASVVIDYLEANKLTLAGILLTHHHNDHTGGVAELQS
GLO2_NITWN      ----------------------TGATAAID-APEAEPVIQALDREGWVLTDILITHHHSDHVGGVAELKR
GLO2_METNO      -----------------------------------------------RLTDILVTHRHFDHVEGIPEVKA
GLO2_CITK8      -------IPAFQDNYIWVLSNNEGRCLIVDPG-EAAPVLNAIKEKNWQPEAIFLTHHHHDHVGGVKELLQ
GLO2_ACTP2      ----ITPIPALSDNY-IWAIQKDNDVIIVDPS-DAVPVLAFIAKNQLNLTAILLTHNHHDHTDGMPELLS
GLO2_SHEAM      ---DIRPIPAFADNYIWMIVLPDGGAVVVDPG-DAMPVINTLQRLNLQLTAVLLTHHHRDHNGGINQL--
GLO2_PSEPF      ----------------LLQDHATQRCAVVDPGDAAPQAWLDAHPGWV-LGDILITHHHHDHVGGVETLKK
GLO2_XYLFA      ----LTPLPAFDNNYIWTLIAPDGRAIIVDPGQALPILEAHSKG--LIPTAILLTHHHADHIGGVPELLE
GLO2_XANOM      -----------------------GRAIIVDPG-QAAPVIATAEREGLVPSAILLTHHHGDHIDGVAELQQ
GLO2_SALTY      -------IPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMP-EAIFLTHHHHDHVGGVKELLQ
GLO2_RALME      ---KVEPIPAFQDNY-IWAIHDGHSAAVVDPGAPVEQFLAQRG---LALGAIVITHHHGDHQGGVSDLLA
GLO2_CYAP8      ----------------LLYDADTQTAAVVDPAEPTPVLECLNKLGA-QLVAIFNTHHHYDHVGANNQLQQ
GLO2_BARQU      ----------------LIHDERSGYTAAID-APESKAICSALKRRNWTLQTIFVTHHHHDHIEALAELKQ
PNKD_MOUSE      ---KVLPIPVLSDNYSYLIIDQAGLAVAVDPS-DPRAVQASIEKERVNLVAILCTHKHWDHSGGNRDLSR
GLO2_XYLFT      ----LTPLPAFDNNYIWTLIAPDGRAIIVDPGQALPILEAHSKG--LIPTAILLTHHHADHIGGVPELLE
GLO2_XYLFM      ----LTPLPAFDNNYIWTLIAPDGRAIIVDPGQALPILEAHSKG--LIPTAILLTHHHADHIGGVPELLE
GLO2_XYLF2      ----LTPLPAFDNNYIWTLIAPDGRAIIVDPGQALPILEAHSKG--LIPTAILLTHHHADHIGGVPELLE
GLO2_SYNJA      -----------------------------------------AELGA-ELVAIFNTHHHHDHVGGNLQLLA
GLO2_RHOPB      ---------------------------------------------------ILVTHHHADHIGGIAELKQ
GLO2_RHOP2      -----------------------------------------------KLTDILVTHHHGDHVGGIAELKA
GLO2_MESSB      ---------------------ETGITALVD-APEEQAILEAIKRTGWTPSLLLITHHHADHVEANLALKE
GLO2_BARHE      ----------------LIHDETSGYTAAIDASNAIQNALKRRN---WTLQTIFLTHHHHDHVEALAELKQ
LACB2_XENLA     ------------------------------------------------IQEIIVTHWHVDHVGGIADISR
GLO2_SHEB9      ---------------------------VVDPG-DASVVIDYLEANQLTLVGILLTHHHNDHTGGVAELQA
GLO2_SALAR      -------IPAFQDNYIWVLNNDEGRCVIVDPG-EAAPVLKAIDDHKWIPEAIFLTHHHHDHVGGVKELLQ
MBLC2_MOUSE     ------------------------------------------------------THVHFDHSGGLYQFDQ
GLO2_MARAV      ----IHPVPAFSDNYICLTNLESGKTLIVDPG-QAKPVLDYLSDSGFSADTILITHHHPDHTGGVKELQQ
GLO2_CYAP7      -------------------------AAVVDPA-EPEPVLTCLKKLGAELVTIFNTHHHGDHVGANRAL--
MBLC2_HUMAN     ------------------------------------------------------THVHFDHSGGLYQFXX
MBLC2_BOVIN     ------------------------------------------------------THVHFDHSGGLYQFXX
GLO2_XANCP      -----------------------GRAVIVDPGQAAPVLEAAQREGFTPVAA-LLTHHHADHIGGVAELQQ
GLO2_XANCB      -----------------------GRAVIVDPGQAAPVLEAAQREGFTPVAA-LLTHHHADHIGGVAELQQ
GLO2_XANC8      -----------------------GRAVIVDPGQAAPVLEAAQREGFTPVAA-LLTHHHADHIGGVAELQQ
GLO2_SYNP6      ----------------------------------------------LTLTAILNTHHHGDHVGGNRRLLR
GLO2_SYNJB      -----------------------------------------AELGA-ELVAIFNTHHHHDHVGGNRQLLE
GLO2_SYNE7      ----------------------------------------------LTLTAILNTHHHGDHVGGNRRLLR
GLO2_SHEB5      ---------------------------VVDPG-DASVVIDYLEANQLTLAGILLTHHHNDHTGGVAELQS
GLO2_SHEB2      ---------------------------VVDPG-DASVVIDYLEANQLTLAGILLTHHHNDHTGGVAELQA
GLO2_PSEHT      ------------------------QAWVVDPG-QAEPVLDYLAQHNLTLAGILITHHHYDHTDGVAKLVS
GLO21_SCHPO     MSFHITPIWMWKGTAYLLTCDKTKITAIVDPAEPESVIPVIKEKTAKKLQYILTTHHHYDHAGGNEDILS
PNKD_HUMAN      ---KVLPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSR
GLO2_SHESA      ----ITAINAFNDNYIWVLRQDSQQAVYVVDPGDANVVLDYLHAQRLSLAGILITHHHRDHTGGIAALTD
GLO2_NITHX      ---------------------------------------------------ILVTHHHADHIGGIAELKQ
GLO2_CYAP4      --------------------------------------LERLRSLQFQLVAIFNTHHHHDHVGGNQELLQ
GLO2_CYAA5      -----------------------------------------------KLIAIFNTHHHADHVGGNKKLME
GLO2_CUPTR      ---KVEPIPAFQDNY-IWAIHDGHCAAVVDPGAPVERFLAQSG---LALGAIVITHHHGDHQGGAGLLAA
GLO2_TOLAT      --------------------KQGNQAIVVDPG-ESAPVIERLRQQSLNLKAIFVTXXXXXXVDGVAELAL
GLO2_SERP5      ----LISIPAFQDNYIWLLDNQQGHCIIVDPG-EAQPVLETLDRLNLTPDAIVLTHHHHDHVGGVAQIAR
GLO2_DANRE      MKVELLPALTDNYMYLLID-EETKEAAIVDPV-EPQKVVDAVKKHGVKLKTVLTTHHHWDHAGG------
LACB2_XENTR     ---------------------DTGEPAVPEYISCLKQALTEFNTS---IQEIIVTHWHVDHVGGIADICT
HAGHL_MOUSE     MKVKVIPVLE--DNYMYLIIEEHTREAVAIDVAVAERLLEIAGREGVSLTMVLSTHHHWDHTRGNAELAH
GLO2_VIBVU      ---EIKSIPAFNDNYIWLIQNSDQRCAVVDPG-DAKPVLHYIEQHQLTLEAILITHHHNDHIGGVADLVR
GLO2_SACD2      ---------------------------VVDPGS-ASEVIEYITQHELTIASIIITHSHWDHVTGIAELCA
GLO2_RHOFD      ---QLIPLPAFTDNYIWMVHDER-HALVVDPG-DAQPVLEAXXXXXXXXETILVTHHHPDHTGGVAALRA
GLO2_PHOLL      ---ELISIPALSDNYIWLLCDENRHVVIVDPA-ESQPVLDTLESRGWIPDAILLTXXXXXXVGGVGIIDR
GLO22_VIBVY     ---EIKSIPAFNDNYIWLIQNSDQRCAVVDPG-DAKPVLHYIEQHQLTLEAILITHHHNDHIGGVADLVR
LACB2_HUMAN     ------------------------------------------------IQEIVVTHWHRDHSGGIGDICK
GLO2_STRM5      --------------------------------------LALADQG-LRVDSILLTHHHDDHIGGVPALQA
GLO2_MANSM      ----------------------------------------------LQLEAVLLTHYHDDHTGGVEELKR
LACB2_RAT       ---------------------DTGEPSVPEYISCLKQALAEFDTA---IQEILVTHWHRDHSGGIVDICK
GLO2_PSEFS      ----------------LLQDPHTQRCAVVDPG-DAAPVLDWLEQNPWALSDILVTXXXXXXVGGVEQLKG
GLO2_HALHL      ------PLAALADNYIWMARDASGTTAFAVDPGDAAVVEAWLHDHQLRLAAVLVXXXXXXXXXXVAELAE
GLO2_WIGBR      ---------------------------IVDPGESIHNICKKKK---LTPVAIFLTHHHHDHVDGVESLKT
GLO2_RHOBL      ----------------------------------------------------------------------
GLO2_RHIL3      ----------------------------------------------------------------------
GLO2_LEPBL      ----------------ILRNSETSETLSIDPY-DSEQIEKFLDSKGWTLDFLLNTHEHEDHTSGNTGLVQ
GLO2_LEPBJ      ----------------ILRNSETSETLSIDPY-DSEQIEKFLDSKGWTLDFLLNTHEHEDHTSGNTGLVQ
GLO2_BRAJA      -------------------------------------ILKALEREGWQLTDILITHHHGDHVGGVAELKH
GLO2_BAUCH      ----LIAIPALIDNYIWLLHNKKGECLIVDPG-DATPVLHILSNYQLKLTSILLTHHHPDHVKGVKLLSQ
GLO2_ANASP      ----------------------------------------------LKAELVAITHHHNDHVGGNQKLIQ
GLO2_PSEE4      ------------------------RCAVVDPGDDAPVLAWLGKHPGWVLEAILVTXXXXXXVGGVEALKH
GLO2_ANAVT      ---------------------------------------------------IFNTHHHNDHVGGNQQL--
LACB2_DANRE     ------------------------------------------------IQHIIVTHWHHDHTGGVQDILA
GLO2_PROM9      --------------------EKDKSVVVIDPAIH-EPVIRYIDENNLYIKAILQTHHHSDHIGGTKYLIE
GLO2_AERHH      ----------------------------------------------------------------------
GLO2_JANSC      ----------------LLHDPSTGATACIDVP-DAAPIQAALGAQGWTLTDILLTHHHWDHIDGVPALVE
GLO2_HAEIN      ---------------------------------ETDKLFAWLEKQNATIEAVLLTHEHDDHTQGVSAFKK
GLO2_EDWI9      ---------------------------IVDPGV-AAPVLHYLTENRITPKAILLTHHHNDHVGGVAEIVQ
LACB2_BOVIN     ------------------------------------------------IQEIIVTHWHRDHTGGIGDICK
GLO2_RHIEC      ----------------------------------------------------------------------
LACB2_MOUSE     ------------------------------------------------IQEILVTHWHSDHSGGIVDICK
GLO2_RALEJ      ---KVEPIPAFQDNY-IWAIHDGRNAAVVDPGAPVERFLK--DKG-LALGAIVITHHHGDHQGGVAELLS
GLO2_METCA      ---EILQIPVLEDNYVYLLHEPSGATAAVDPAV-AGPVLEALDARGWRLGHVLNTHHHGDHVGGNLEL-K
GLO2_CHICK      MKVEVLPALTDNYMYLLID-EETKEAAIVDPV-QPQKVLDAVKKHGVKLTSVLTTHHHWDHAGGNEKLVK
GLO2_BLOFL      ---------------------------IIDPGESLKVIKMLNHLQLIP-EAILLTHNHRDHTNGVFTLIQ
GLO2_PROM0      ---------------------------VIDPSVH-EPVIRYIDENNLHLKAILQTHHHSDHIGGTKPLIE
BLA1_STEMA      ---------------------------------------------------ILLSHAHADHAGPVAELKR
GLO2_HAEPS      ---QITPIPALSDNYIWI-LQKECQAIIVDPA-EAQAVFAFLAKHQLNPTAILLTHNHHDHTDGAGLVAQ
GLO2_PROMM      ---------------------KGNQAVVVDPA-IAEPVKTWLRTRKLSLAAVLQTHHHADHIGGTLELLR
GLO2_HAEDU      -----------LQDNYIWAIQQGQEVMIVDPA-QADPVFHFLAKNKLNLTTILITHYHQDHIGGAGLQAT
GLO2_BART1      ----------------------------------------------------------------------
GLO2_PROMS      ---------------------------VIDPSVH-EPVIRYINENNFHLEAILQTHHHSDHIGGTKSLIE
GLO2_ACTSZ      ------PISALNDNYIWVYGRENCPVIVVDIT-EIEPLLPFLRENKFAVEAVLLTHKHDDHVGGVAAFKR
Y888_METJA      ------------------------KNILIDPGGTFNILMEELERNGIKIDLIINTHCHFDHTSADYLIEE
GLO2_SYNSC      ----------------------------------------------LSLAAVLQTHHHADHIGGTPELLQ
GLO2_RHOS5      ----------------------------------------------------------------------
RNZ_BRAJA       ------------RNHPALLVEAAGKRILIDCGEGTQRQLLRSGAGFRRLDRILLTHAHLDHVGGPGTLAG
GLO2_PROMA      --FIIHPIPVLMDNIIWIWVKEK-QAIVVDPAIS-EPVINLLKGNGLSLHSVLQTHHHEDHIGGTQEL--
GLO2_LEGPH      ----ILPISAFSDNYIWTFIDKAGVLDCVDPG-EAAPIIRFAQSNQXXXXXXXXXXXXYDHIGGVDSLIK
GLO2_LEGPC      ----ILPISAFSDNYIWAFIDKAGVLDCVDPG-EAAPIIRFAQSNQXXXXXXXXXXXXYDHIGGVDSLIK
GLO2_RHOP5      ----------------------------------------------------------------------
Y4333_HERA2     ----------WLGHASFLFVTPEGKRIVLDPWYEGNPSFPEAKAELEHVDAILLTHGHMDHTGNAITLAQ
Y1060_STAS1     --------------------EANGKKVIVDPTGNGQSDL---DASTLKVDYIILTHGHGDHFGDTIELAN
GLO2_LEGPL      ----ILPISAFSDNYIWTFIDKAGVLDCVDPG-ESAPIIRFAQSNQXXXXXXXXXXXXYDHIGGVDSLIK
GLO2_ROSDO      MPIEILTIPCLNDNYAFLVHDTAGQTALIDVP-EAAPILKVLAERTWQLSEVWITHHHADHVQGLGDI--
GLO2_NEIG2      ---KITPVKALTDNYIWM-IQHGNHAVCVDPS-EPSPVLEFLVRNRLMLAQTWVTHPHPDHEGGAAALWR
GLO2_LEGPA      ----ILPISAFSDNYIWTFIDKAGVLDCVDPG-EAGPIIRFAQSNQXXXXXXXXXXXXYDHIGGVDLLIK
Y1118_PICTO     ---------------------------------------------------ILLTHGHFDHAGDAVNIAQ
LACB2_CAEEL     ---------------------DTGEPNVTEYISALKSVLASTNS---HIEYIVITHWHGDHVGGTDEILD
GLO2_PROMT      --FTIHPINVLQDNIVWVWVHNCN-AVVVDPSGPVEKWLLEKN---LSLKAILQTHHHDDHIGGTQKLIK
GLO2_PROM1      --FTIHPINVLQDNIVWVWVHNCN-AVVVDPSGPVEKWLLEKN---LSLKAILQTHHHDDHIGGTQKLIK
RNZ_BRASO       --------------------QAGGQRILVDCGEGIQRQLLASGAGFRRLDRILLTHGHLDHVLG------
GLO2_SYNPX      ----------------------------------------------LQLSAVLQTHHHADHIGGTPGLLE
Y3294_BACCN     --------------------ETNGKVIVIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVEIAK
GLO2_SHEON      ----------------------------------------------LTLAGILITHHHRDHTGGIAALVA
GLO2_NEIG1      ---KITPVKALTDNYIWM-IQHGNHAVCVDPS-EPSPVLEFLVRNRLMLAQTWVTHPHPDHEGGAAALWR
YOBT_BACSU      ----------FPVNCYLV--EEENEVTLIDAAGSYKGIIQAVNQLGKPLQHILLTHAHGDHVGSLDTLAQ
GLO2_SYNS9      -----------------------------------------AHGMCLRA--ILQTHHHADHIGGTPDLLR
GLO2_NEIMF      ---KITPVKALTDNYIWM-IQHGNHAVCVDPS-EPSPVLEFLVRNRLMLAQTWVTHPHPDHEGGAAALWR
GLO2_NEIMB      ---KITPVKALTDNYIWM-IQHGNHAVCVDPS-EPSPVLEFLVRNRLMLAQTWVTHPHPDHEGGAAALWR
GLO2_NEIMA      ---KITPVKALTDNYIWM-IQHGNHAVCVDPS-EPSPVLEFLVRNRLMLAQTWVTHPHPDHEGGAAALWR
GLO2_NEIM0      ---KITPVKALTDNYIWM-IQHGNHAVCVDPS-EPSPVLEFLVRNRLMLAQTWVTHPHPDHEGGAAALWR
Y4741_BACC7     --------------------ETNGKVIVIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y1382_STAES     --------------------EGNGKKVIVDPGNDKCDL----DEQTLEVDYIILTHGHADHFGDVVELAN
Y1270_STAEQ     --------------------EGNGKKVIVDPGNDKCDL----DEQTLEVDYIILTHGHADHFGDVVELAN
GLO2_THIDA      ----LIPLPAFEDNYIWVW-HDAKYAVAVDPG-DPAVLSTYLDSRGLALAAVLVTHHHRDHTGGNTWLRQ
GLO2_SHEDO      ---------------------DSNFAYVVDPGV-AQPVIDYILAHDLILAGVLITHKHADHVGGIQGLQY
Y3178_BACHD     --------------------ETEGKTIVIDPGNGLTDL----SVDDLKVDVILLTHGHNDHVGDTLQLAK
Y1373_MACCJ     ----------FFHGQSCITFEHNGKKVIVDPFINGNK-LSDLDSETVEVDYIVLTHGHGDHLGDTEAIAK
Y1218_STAHJ     --------------------EGNGKKVIVDPGNDKCDL----DEQTLDVDYIILTHGHADHFGDVVELAN
GLO2_SYNPW      ----------------------------------------------LTLIAVLQTHHHADHIGGTPDLLR
Y515_BACC2      --------------------EANGKVILIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4892_BACAC     --------------------ETNGKVILIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4871_BACAA     --------------------ETNGKVILIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4860_BACAN     --------------------ETNGKVILIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4747_BACC1     --------------------ETNGKVILIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4729_BACC0     --------------------ETNGKVILIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4725_BACC3     --------------------ETNGKVILIDPTGNSKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4722_BACC4     --------------------EANGKVILIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4418_BACCQ     --------------------ETNGKVMLIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4343_BACHK     --------------------ETNGKVILIDPTGNPKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y4194_BACAH     --------------------ETNGKVILIDPTGNSKTDL---KAEDVKVDAILLSHGHGDHVGDTVELAK
Y2750_GEOKA     --------------------ETNGKTILIDPTGNTTTDLNAAD---VKADVILLTHGHGDHVGDTVEIAK
Y2675_GEOTN     --------------------ETNGKTILIDPTGNTTTDLNAAD---VKADVILLTHGHGDHVGDTVEIAK
Y4613_BACCR     --------------------EANGKVILIDPTGNPKTDLKTED---VKVDAILLSHGHGDHVGDTVELAK
Y1312_STACT     --------------------EANGKKVIVDPGNELSDLNAED----VEVDYIVLTHGHGDHFGDTVEIAK
Y1163_METJA     ------------------------------------------------VEVIAVTHGHADHLGNAEELAK
Y1162_THEMA     ---------------------EGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAK
RNJ1_BACSU      -----------------------------------------------KIKGLFITHGHEDHIGGIPYLLR
GLO2_YEAST      --------------CYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHHHYDHADGNADILK
Y574_PARDP      ---------------------------------------------------ILLTHGHGDHTGDTLSIAR
Y5695_RALME     -----------------------GKVIVIDPWGNPKTPPAFKQLSALKVDMILLTHAHGDHLGDAPAIAT
Y4324_POLSJ     -----------------------GKVIVTDPWLKLNP-LTPAEYKNLKVDVILVTHGHWDHFADAPELAL
Y1920_SILST     ---------------------------------------------------ILLTHAHFDHVADVLELAK
Y1265_ARCFU     ----------------------------------------------VKADYILVTHGHGDHLGDAVEIAK
Y119_PYRAB      -----------------------GVSILIDPYPDVDE--DRME----KVDYILITHEHMDHYGKTPLIAK
SYFB_BURPS      -----------------------------DVKGDLEALLAPVPARFVKAEHPALHPGRVDHAGWIGELHP
SYFB_BURP1      -----------------------------DVKGDLEALLAPVPARFVKAEHPALHPGRVDHAGWIGELHP
SYFB_BURMA      -----------------------------DVKGDLEALLAPVPARFVKAEHPALHPGRVDHAGWIGELHP
RNJ_METJA       -----------------------------------------------EVKAIVLSHGHLDHIGAVPKLAH
RNJ2_BACSU      ---------------------------------DISYLIERAD----RVKAIFLTHGHDENIGGVFYLLN
Y4354_BACCZ     --------------------ETNGKVILIDPTGNPKTDL---KAEDVNVDAILLSHGHGDHVGDTVELAK
Y4138_LYSSC     ---------------SIVKIQTNGKTILIDPNGNGQTDLKVAEEAP---DIILLTHGHNDHVGDTIELAK
Y2976_SILPO     ---------------------ESGEAVLVDPNGNPTLPEDQHDAAVIGATHILLTHTHFDHVVDVLPLAR
Y1785_STAAR     ----------------------------------------------VQVDYIVLTHGHFDHFGDVVELAK
RNZ_KINRD       -----------------------GTSVLFDPGEGTQRQMLHAEVSAPRIERICVTHRHNDHCLGVPGVLN
RNJ1_STAS1      -----------------------------------------------KIVGLFITHGHEDHIGGVPYLLK
RNJ1_STAHJ      -----------------------------------------------KIVGLFITHGHEDHIGGVPYLLK
RNJ1_STAAW      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAAS      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAAR      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAAN      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAAM      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAAC      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAAB      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAA8      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAA3      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
Y171_GEOLS      ----------------------NGKVLLVDPSNPSNPNAEKDLAALTKVDLIFLTHGHGDHIGDAVEIAK
RNJ_MYCPN       -----------------------------------------------KVKALFITHGHEDHIGGVPYLLK
RNJ1_STAES      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
RNJ1_STAEQ      -----------------------------------------------KIVGLFITHGHEDHIGGVPFLLK
GLO2_RHOCA      ----------------------------------------------------------------------
Y3437_ACIBL     -----------------------GTHILIDPWVMGNPACPETEKQVKKVDVMLITHGHFDHIGDAVEIAK
Y2229_RHOS5     ---------------------------LVDPSGNPMFPIERRDEAIAGATHILLTHGHGDHSGDAVAIAS
Y020_PYRFU      --------------------EDRGTKILIDPYPDVD------EDRIGKVDYILVTHEHMDHYGKTPLIAK
SYFB_BURTA      -----------------------------DVKGDLEALLAPVVARFVKAEHSALHPGRVDGVGWIGELHP
RNJ_MYCGE       -----------------------------------------------KVKALFITHGHEDHIGGVPYLLK
LIPB_PORGI      ---------------SLLIITDAGKRILIDCSPDFRQ--QALFAGIDSLDAVLLTHEHFDHVGGLDDL--
GLO2_SYNS3      ----------------------------------------------LQLVAVLQTHHHSDHIGGTPGLLQ
GLO2_ANADE      ----------------------------------------------------------------------
Y864_THEVO      --------------------------------------MAKVKAEDLNPDIILVTHGHYDHAADAVSISK
Y488_ANOFW      --------------------ETNGKTIFIDPF-ITGNPLTDLKAEDVHVDVILLTHGHNDHVGDTVSLAK


                         .         .         *         .         .         .         .:140
query           RLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFGKVVLNVYHCPGHTPGHVIFF
YCBL_ECOLI      HYGVPVFGPEKEDEFWLQGLPAQSRMFGLEECQPLTPDRWLNEGDTISIGNVTLQVLHCPGHTPGHVVFF
Y1663_HAEIN     HFGVEIWGSNEKDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQGEILKLDGFNFEILHLPGHTPGHIGFI
Y2135_AQUAE     LFDVPLDKFLINDEIW----SGFASYIGAVPCPE--PDVEISEGDVIRVGDVEFKVLHTPGHTPGLCCLY
YQGX_BACSU      KWDIPVYLHQNEKNWLADASLNGSGMLRGIEVTAKPADHLIEGDGELNIGPFHLETLFTPGHSPGSVSYY
Y2612_MYCBO     TFGCPTYVHPADRFMLTDPIYGLGPRIAQLVAGAFFPKQVVEDGDKIDLGGISVNIDHTPGHTRGSVVFT
Y2581_MYCTU     TFGCPTYVHPADRFMLTDPIYGLGPRIAQLVAGAFFPKQVVEDGDKIDLGGISVNIDHTPGHTRGSVVFT
Y493_MYCLE      TYGCPTY-IHPEDRFMLTD-----PLFGFGPRVAQVPKQVVEDGDKLDLGSVTVNVDHTPGHTRGSVCFW
Y554_STRP6      AFDHPPVYVSEKEAAWLDNLSGLGRHDDIINVIARPAENFFKLKQPYQLNGFEFTVLPTPGHSWGGVSFV
ETHE1_BOVIN     LLP-----------------GCQSVISRLSGAQA---DWHIEDGDSIQFGRFALETRASPGHTPGCVTFV
ETHE1_HUMAN     LLP-----------------GCQSVISRLSGAQA---DLHIEDGDSIRFGRFALETRASPGHTPGCVTFV
ETHE1_MOUSE     LLP-----------------GCQSVISRLSGAQA---DLHIGEGDSIRFGRFALETRASPGHTPGCVTFV
GLO2_BDEBA      AFDCPVYAPQKNQK----QIP--------------VADQWLKEGDSVTCGPWDFTVMELPGHTLGHIAYW
GLO2O_ARATH     KL------PGVKS---VISKASGSKA-----------DLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYV
GLO2_PSEMY      ATGARVAGPAAE------KIPARDVDLG--------------DNDLIEVLGLRFQIMAVPGHTLGHIAYY
GLO2_RHORT      ------------------KAATGCEIIGFAGDAHRLPDRTVVEGDRVAIGQAEARVIETPGHTLGHIAYW
GLO2_HAHCH      NHPVPVYG------FMRSAIKAIT-----------VP---LQEGDRVDLGDFSLEVLETPGHTLDHISYF
GLO2_METFK      ATSAQVFAP-------------AKEQFSFPPVTA---------GDRLDIPGIALSVLDVPGHTVGHVAYY
GLO2_HERAR      HFNVPVFAPR-KDPIANVSHP-------------------LDDGDTVHIPELHLSVLAVPGHTLGHIAYV
GLO2_THEEB      RF------PDIA-------------VYGSSEDQGRIPEQFLKAGDRVPFGQTYFDVLFVPGHTRGHIAYY
GLO2_MARMM      LTGAKVVAPRY-DRHRIPGISME-----------------VEDGDVISLGDHKAKVFYTPGHTMGHVCYH
GLO2_DECAR      RWQAEVYAPGNESITGC-SCP-------------------LSGGESIDVLGQKVTVMAVPGHTLGHLAYY
GLO2_NITOC      QTKGKL----------LAHHKARDKIRGI--------DEGLAAGDTVKVGNVALKVLDTPGHTMSHLCLF
GLO2_KLEP3      KFSIVVYG------------PAETQDKGVTQV--------LGDGDRLSILGHDFSIFSTPGHTLGHICYY
GLO2_IDILO      QSPCPVIGPE------------------NPEIKTLT--KTVTEGDELTVGGIQWQVLTTPGHTLDHISFY
GLO2_VIBPA      AFHVTVVGPKAE------------------PIPTLTTP--MEEGDKLEFGEIFL-VLGLPGHTLGHIGYV
GLO2_VIBHB      AFHVSVVGPKAE------PIPTLTNA--------------MEEGDKLELFGEIFMVLGLPGHTLGHIGYV
GLO2_POLSJ      ---IAATGAKL-----IAHHKAGGRIAGV--------DRGVKAGDVIKVGKTVLECLDTPGHTMCHICLS
GLO2_KLEP7      KFSIVVYG------------PAETQDKGVTQV--------VGDGDRLSILGHDFSIFSTPGHTLGHICYY
BLH_XYLFA       RTGAPTAGTHVTERLW-------REIYNWPTLSANGSDHLFADGDVFNVGSIKGRVMFSPGHTLASVTYV
GLO2_HYPNA      ATGCKIIGPAGE----ADKIPGI--------------DRRVKGGDTVELGGATATVIDVPGHTLGHIAFH
GLO2_PSYIN      -------------------LSARDEKISYSKKKLFDRCRLVNESDTLSFGKLSLQVMEVPGHTLDHVAFY
GLO2_PSEU2      STAARVLGPAAE------TIPAR--------------DIALVDNDRMTVLGLEFVVHAVPGHTLGHIAFY
GLO2_HAMD5      RFDIPVYGPKETNKKGATIL--------------------LKEGDQLFICSQTFSVIEVPGHTLGHIAYY
GLO2_BUCAP      RY------PNV-------------TVFGPEETKTRNVNKIVKQGDVIKLLKSEIHVFLTPGHTLGHVSYY
GLO2N_ARATH     RYGAKVIGSAMDK----DRIPGI--------------DMALKDGDKWMFAGHEVHVMDTPGHTKGHISLY
GLO2_BRUSU      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_BRUSI      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_BRUO2      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_BRUME      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_BRUMB      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_BRUC2      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_BRUAB      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_BRUA2      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_BRUA1      KFGVSIIGPEAE--------------------KAKIPDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYY
GLO2_PSEPK      LTGARVCGPANE------RIPGR--------------DLALDEGDRVDVLGVTFQVMAVPGHTLGHIAFF
GLO2_PSEP1      LTGARVCGPANE------RIPGR--------------DLALDEGDRVDVLGVTFQVLAVPGHTLGHIAFF
GLO2_PSEF5      HSAATVHGPARE------KIPAR--------------DIGLEDNQRVSILGWEFEVFAVPGHTLGHIAYY
GLO2_PSE14      ATRARVLGPAAE------TIPAR--------------DVALVDHDRLTVLGLEFVVHAVPGHTLGHIAFY
GLO2_PSESM      ATRARVLGPAAE------SIPAR--------------DVALADHDRLTVLGLEFVVHAVPGHTLGHIAFY
GLO2_PECCP      HYNLPVFGPKETAKCGATSL--------------------LEEGNTVSLLNSEFSVIEVPGHTSGHIAYY
GLO2_MARMS      HSNCPVYGPE-----------HLTELVTHP----------VDDGDRILVFSKVFTVIATPGHTLDHLCYF
GLO2_FRAP2      -------------EIYPDAL-----VYAYADNELFKPNIYVADGDFVDFGFTSCKVMYTPGHIDDHVCFL
GLO2_RHIME      RFGLTIIGPKNE----------ASKIPGI--------DRTVGHGDRFDFAGHPVDVIETPGHTSGHVCYH
GLO2_ECOL6      KFQIVVYGPQETQDKGTTQVVKDSE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_PSEPW      LTGARVSGPANE------RIPCR--------------DLALDEGDEVTAVGVTFQVLAVPGHTLGHIAFF
GLO2_BUCAI      ----------------IEYFPKIS-VFGPKETRQHGVNKIVSHGDRIILLDKIFYVFFTPGHTSGHVSYY
GLO2M_ARATH     RYGAKVIGSAVDK----DRIPGI--------------DILLKDSDKWMFAGHEVRILDTPGHTQGHISFY
GLO2_SHEPC      YVELQVYGPQKENIAHV-NVPLNPEM---------------RTELTLPFLNAQIQVLNVPGHTAGHIAYF
GLO2_ECOLU      KFQIVVYGPQETQDKGTTRVVKDGEI-------AFVLGH-------------EFSVIATPGHTLGHICYF
YRKH_BACSU      KTKA---------TYWLPPKDAEEVEFDYQP---------LEEGNDIIIGNTTIKIIYSPGHTIGSTSFI
GLO2_TRIEI      KF------PQLK-------------VYGGVEDRGRIPGQFLQEGDRVHFADRVGEVLFVPGHTIGHIAYY
GLO2_PSEAE      LTGARVLGPANE------KIPAR--------------DLALEDGERVEVLGLVFEIFHVPGHTLGHIAYY
GLO2_PSEA8      LTGARVLGPANE------KIPAR--------------DLALEDGERVEVLGLVFEIFHVPGHTLGHIAYY
GLO2_ESCF3      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ERYLH      ATGAKVIAPQEVEK-----------LSGI--------DRVVGHGDTVDIGDFTADVIDVSGHTNGHIAYH
GLO2_ECOSM      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO7I      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_XANAC      RWDLALFGPADE------RIPTNAHHVG--------------RGERLRLLDVEFQVIKVPGHTRSHIAFL
GLO2_ERWCT      HYNLPVFGPKETAKCGATYL--------------------VEEGNTVSLLNSEFSVIEVPGHTSGHIAYY
GLO2_ECOUT      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECOL5      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECOK1      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO81      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO45      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO27      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_CHRSD      RYSPRVIGPD------NSAIPAIDEVVG-------DEDECRVQGRR-------FEVFAVPGHTLDHIAFY
GLO2_YERE8      HFEIPVYGPQETANKGATIM--------------------VTGGDHLSIGGQNYQVIAVPGHTLEHIAYY
GLO2_VIBCM      QFEIHVVGPAQE------PIPTLTH-----PV---------EDGDQIELFDERFMVLGLPGHTLGHIGYV
GLO2_VIBCH      QFEIHVVGPAQE------PIPTLTH-----PV---------EDGDQIELFDERFMVLGLPGHTLGHIGYV
GLO2_VIBC3      QFEIHVVGPAQE------PIPTLTH-----PV---------EDGDQIELFDERFMVLGLPGHTLGHIGYV
GLO2_SHISS      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_SHIFL      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVITTPGHTLGHICYF
GLO2_SHIF8      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVITTPGHTLGHICYF
GLO2_SHIDS      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_SHIBS      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVITTPGHTLGHICYF
GLO2_SHIB3      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_RHOS4      XXXXXXXXXXXXXH-------------RLPPL-----DLELAEGDLVRVGASEGRVIEVPGHTVGHIAFH
GLO2_NITEC      EFAIPVYGPANE------KIPGMTHP--------------LTGGDTLSFPELSLSVLDIPGHTAGHIAYY
GLO2_ENT38      KFHLEVYGPQ------------ETQNKGTTCV--------VDEGQNVLILEWEFSVFATPGHTSGHICFY
GLO2_ECOSE      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECOLI      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECOLC      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECOHS      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECODH      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECOBW      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO8A      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO5E      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO57      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO55      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
GLO2_ECO24      KFQIVVYGPQETQDKGTTQVVKDGE-------TAFVLGH-------------EFSVIATPGHTLGHICYF
BLH_AGRT5       KIGAKVTGVQKEKYNWSDFKTDGSQW-----------DQLFEAGDRFSIGSLEARVLFSPGHTLASVTYV
GLO2_XANC5      RWDLELFGPADE------RIPADAHQVG--------------HGERLRLLDVEFQVLQVPGHTRSHIAFV
GLO2_RHOS1      XXXXXXXXXXXXXH-------------RLPPL-----DLELAEGDLVRVGASEGRVIEVPGHTVGHIAFH
GLO2_NOSP7      ----------------IEKFP-QLIVYGGAEDRGRIPGQFLQQGDRVEFADRIAEVIFVPGHTRAHIAYY
GLO2_NITEU      KFEIPVYGPASE------KIPGMTHP--------------LAEGDTLVFPELELSILDVPGHTAGH-IAC
GLO2C_ARATH     LVDIKVYGGS------LDKVKGCTDA--------------VDNGDKLTLGQINILALHTPCHTKGHISYY
YYBB_BACSU      RFDIPIFAHQKELKYINGEEPYPNKNEVENTGVAHIVQPLTEQ----TLAHLPLKYYLTPGHSPGHVVYY
BLH_XYLFT       RTGAPTAGTHVTQRLWIYNLPTLS-------TNGSQWDHLFADGDVFNVGSIKGRVMFSPGHTLASVTYV
GLO2_THICR      LGEVAIQGP-------------------FKPVTHPV-----KEGDQVQVLNETFQVIETPGHTDEHICFY
GLO2_PSEPG      LSGARVCGPANE------RIPGR--------------DLALDEGDKVDVLGVTFQVLAVPGHTLGHIAFF
GLO2_FRATN      ------------------AIYPNAKVYAYTENDLFKPDIYVKDGSFINLGFTSFRVMYTPGHIDDHVCFL
GLO2_ALISL      QFNINVVGPENE------PIPTLTHPVG--------------DGDFVELFNEKFMVLGVEGHTKGHIAYI
GLO22_SCHPO     NLNLKKEFPHV-------TIYGGSDQNGVSHV--------LQDKETLRIGNVQIEALHTPCHTRDSICFY
GLO2_YERPY      HFDIPVYGPQ------------ETAKKGATVI--------VNDGDSLTIAGQNYTIIAVPGHTLGHIAYY
GLO2_YERPS      HFDIPVYGPQ------------ETAKKGATVI--------VNDGDSLTIAGQNYTIIAVPGHTLGHIAYY
GLO2_YERPP      HFDIPVYGPQ------------ETAKKGATVI--------VNDGDSLTIAGQNYTIIAVPGHTLGHIAYY
GLO2_YERPN      HFDIPVYGPQ------------ETAKKGATVI--------VNDGDSLTIAGQNYTIIAVPGHTLGHIAYY
GLO2_YERPE      HFDIPVYGPQ------------ETAKKGATVI--------VNDGDSLTIAGQNYTIIAVPGHTLGHIAYY
GLO2_YERPB      HFDIPVYGPQ------------ETAKKGATVI--------VNDGDSLTIAGQNYTIIAVPGHTLGHIAYY
GLO2_YERPA      HFDIPVYGPQ------------ETAKKGATVI--------VNDGDSLTIAGQNYTIIAVPGHTLGHIAYY
GLO2_YERP3      HFDIPVYGPQ------------ETAKKGATVI--------VNDGDSLTIAGQNYTIIAVPGHTLGHIAYY
GLO2_SHESW      YVELQVYGPQKENIAHV-NVPLNPEM---------------RTELTLPFLNAQIQVLNVPGHTAGHIAYV
GLO2_SHELP      DHKLTVYGPDNENIKGINH-PISGQTESVKPEKL--------DSDAA--------VFHLPGHTLGHIAYL
GLO2_FRATW      ------------------AIYLNAKVYAYTGNDLFKPDIYVKDGSFINLGFTSFRVMYIPGHIDDHVCFL
GLO2_FRATT      ------------------AIYLNAKVYAYTGNDLFKPDIYVKDGSFINLGFTSFRVMYIPGHIDDHVCFL
GLO2_FRATO      ------------------AIYPNAKVYAYTGNDLFKPDIYVKDGSFINLGFTSFRVMYIPGHIDDHVCFL
GLO2_FRATM      ------------------AIYLNAKVYAYTGNDLFKPDIYVKDGSFINLGFTSFRVMYIPGHIDDHVCFL
GLO2_FRATH      ------------------AIYPNAKVYAYTGNDLFKPDIYVKDGSFINLGFTSFRVMYIPGHIDDHVCFL
GLO2_FRATF      ------------------AIYPNAKVYAYTGNDLFKPDIYVKDGSFINLGFTSFRVMYIPGHIDDHVCFL
GLO2_FRAT1      ------------------AIYLNAKVYAYTGNDLFKPDIYVKDGSFINLGFTSFRVMYIPGHIDDHVCFL
GLO2_ERWT9      HYDLTVYGPQETSHKGANSL--------------------VGDGDRIHVLGLDFTIIATPGHTLGHISYF
GLO2_ALHEH      AHPVPVYGPADE------SVPGVSQ-----PLRE--PDAFEVPG----LG-LPLRVLDVPGHTAGHIALV
GLO21_VIBVY     K---------------------------FPNASLFVPESIIKEGDELNLLNSTFNVLELPGHTDNHIGIM
MBLC2_CHICK     XXXXXLRGDNYEAVTWLSDREVRARHFCVPPVR---PSRLLQEGDVISLGDRQLTVMHMPGHSRGSICLH
GLO2_PELUB      KYGASVIGYKGDK----DRIPEIDILVGDQ-------DIWHEENFQAK-------IFHIPGHTLGHICFY
GLO2_SALPK      HFQMTVYG------------PAETQDKG--------ATHLVDDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALPA      HFQMTVYG------------PAETQDKG--------ATHLVDDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_AGRT5      KFRCEVHGPY-------------DEAIAIPGL-----DRSQADGDEFEFAGRRVQVIATPGHTAGHICYY
GLO2_RHOPA      KYQCRVHAPHDANAKIADA------------------DVRLQEGDVVRVGDLTARVLETPGHTLDHLSYV
GLO2_RHILO      RFKLRIVGPEAE--------------------KAKIPDETVEEGSVLHLGDERIEVIATPGHTAGHVSYH
GLO2_AERS4      HFP-------------------HARLYG--PKHDPMPDQWLDDGDQINWHGLSLDVIHVPGHTHGH-IAY
GLO2_ACAM1      ----------------LQAFP-NTVVYGGEQDRGRIPGQFLKEGDQVSFAHRRAEVYFVPGHTRAHIAYY
GLO2_SALPC      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVFYF
GLO2_ACTPJ      RYQLSVYGPQEVAQF---------------------ANRIVQPEDHLTLFDYDVRVIESAGHTAQHVSYL
GLO2_ACTP7      RYQLSVYGPQEVAQF---------------------ANRIVQPEDHLTLFDYDVRVIESAGHTAQHVSYL
GLO2_VIBF1      QFNVNVVGPENE------PIPTLTHPVG--------------DGDFVELFDEQFMVLGVPGHTNGHVAYI
GLO2_SYNP2      HFAAAVYGSEI--DLQKRRIPGQTVS--------------LKAGNHLDLFNRTVEILFVPGHTQGHIAYY
GLO2_SODGM      HFPVPVYGPE--------------------ETRSKGATQIVNEGDSLTLLDHTFSIMALPGHTLGHIGFY
GLO2_SALTI      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALSV      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALPB      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALNS      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALHS      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALEP      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALDC      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALCH      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_SALA4      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_OCHA4      KYGVSIIGPKAEET-------------KIPGI-----DRTVKDGDEFTFGLFRVKVIATPGHTAGEVSYY
GLOB2_DICDI     AKTAIGEGAKIVQKTFKTIYNLEHTF----PTDGSQFDKLFTDDERFTIGSLQVRVISTPGHTPA-CVSY
GLO2_VIBFM      QFSVNVVGPENE------PIPTLTHPVG--------------DGDFVELFDEQFMVLGVPGHTNGHVAYV
GLO2_SYNY3      YPNLEVYGG-VEDQ---GRIPGQTV--------------FLRDGDRLSFADREATVYFVPGHTRGHIYYF
GLO2_SALG2      HFP-------------------QMTVYGPAETKDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_PSEA7      LSGARVLGPANE------KIPAR--------------DLALEDGERVEVLGLVFEIFHVPGHTLGHIAYY
GLO2_MICAN      RY------PHLC-------------VYGGKEDRGRIPGQFLEEGDRVEFAGRWAEVFFVPGHTRAHIAYY
GLO2_METS4      RTGARVTAPAKAG----DAVPEV--------------DATVREGDAVRLGSLVAAVWETPGHCADHVTYW
GLO2_VIBSL      QFPVDVVGPKNE------PIPTLTH-----PV---------DDGDQLEFGEVFL-VLGLSGHTAGHIGYV
GLO2_SILPO      RYKPTVIG-------------AEADAHRLPPL-----DLAVSEGDRFDLGGAPVEVLDVSGHTVGHIAFH
GLO2_GLOVI      ----------------LEAYPGIA-VYASRRDRGRIPGQTLEDGDTVAFGCERARVIFVPGHTHGHIAYH
GLO2_BRASO      RYGCRVIGPH-------DRKAAIADV-----------DLRVAHGDVVKVGELLARVLETPGHTLDHVSYX
PNKD_BOVIN      RHQ-------------------DCRVYGSPQDSIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYL
GLO2_SHEB8      QNRLSVYGPDNEK---IEGIT--------HPLHATAQPRFI-----LDYMSGELQVLDVPGHTAGHIAYV
GLO2_NITWN      KYACRVVAPH----------DRSAEIANV--------DLRVGQGDIIKVGTLLGRVLETPGHTLDHVSYV
GLO2_METNO      RTGARVTAPAKAG----DAVPEV--------------DATVREGDVVKVGSLVGTVWETPGHCADHVTYW
GLO2_CITK8      HFHVVVYG------------PAETQDKG--------TTRVVKDGDSALVLGHEFSIFATPGHTLGHICYF
GLO2_ACTP2      RYQLSVYGPQEVAQF---------------------ANRIVQPEDHLTLFDYDVRVIESAGHTAQHVSYL
GLO2_SHEAM      -------------RDWAKSNGQSFTVYG--AVTSDYSDVLCRDGDTVDISGLTVRVLSVPGHTLDHLAFV
GLO2_PSEPF      ATGATVYGPASE------NIPGR--------------DVALKDNDTVRVLGWDFDVYAVPGHTLGHIAYY
GLO2_XYLFA      RWTLPIYAPH--------------------DTRIALNYHRIGEGDSLNILGLRFQVIHTPGHTHSHLTFI
GLO2_XANOM      R--------------W-----PGLELFSPADERIPTTAHHVSHGERLSLLAVDFQVIEVPGHTRTHIAFV
GLO2_SALTY      HFQMTVYG------------PAETQDKG--------ATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF
GLO2_RALME      RHP---SGPNGEP---LPVIGPQGERIGH-------RTQAVREGDTVTLPAVTFRVLDVPGHTAGHVAYL
GLO2_CYAP8      YF------PNLC-------------IYGGSEDRGRIPGQFLKEGDRVEFGQRVGEVLFVPGHTRAHIAYY
GLO2_BARQU      IYKAVVIGPE-----------AEKEKIGHL-------DQALQPDESLFFGTHTLLALSTPGHTLGSLSYY
PNKD_MOUSE      RHR-------------------DCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYL
GLO2_XYLFT      RWTLPVYAPH--------------------DTRIALNYHRIGEGDSLNILGMRFQVIHTPGHTHSHLTFI
GLO2_XYLFM      RWTLPVYAPH--------------------DTRIALNYHRIGEGDSLNILGLRFQVIHTPGHTHSHLTFI
GLO2_XYLF2      RWTLPVYAPH--------------------DTRIALNYHRIGEGDSLNILGMRFQVIHTPGHTHSHLTFI
GLO2_SYNJA      RYP-------------------RAVVYGSQADRGRIPGQTVEAGETVAFAGRQAKVLFVPGHTRGHVAYY
GLO2_RHOPB      ATNCRVVAPHDNGA----AIP--------------LVDLRVRQGDVVKIGGLLARVLETPGHTLDHVAYV
GLO2_RHOP2      KYHCRVVAPHDANAKIADA------------------DLRVEEGDVVKVGGLEARVLETPGHTLDHISYV
GLO2_MESSB      RFGLTIIGPAKE----------ASKIPGI--------DRQVNEGDVVRVGNQEARVIETPGHTAGHITFY
GLO2_BARHE      IYKAIVIGPEAEKE------------------KISHIDQTLKPDESFLFGTHTILALSTPGHTLGALSYY
LACB2_XENLA     DI---MKG----CNFSINKLPRNPHQ---EEVIADHKYNYLKDGDIITTEGATLRVLYTPGHTDDHMALE
GLO2_SHEB9      YSQLTVYGPDNEK---IEGIT--------HPLHATAQPRFTL--DYISGELQVLDV---PGHTAGHIAYV
GLO2_SALAR      HFQMTVYGPETQDK-------GATHLVG--------------DGDTVLVLGYNFSIFATPGHTLGHICYF
MBLC2_MOUSE     EAEALARGDNFETVTWLDSEVVRAPSPGWRAMQAVQPTLILPDGDVINLGDRQLTVMHMPGHSRGSICLH
GLO2_MARAV      QYDLRIVGPT-------DS-----------PFKGAT--NTVHAGDEVVWEGITFNVLAVPGHTLDHIAYY
GLO2_CYAP7      ----------------IEHFPNLT-VYGGEEDRGRIPGQFLKEGDRVQFGDRSGEVFFVPGHTRAHIAYY
MBLC2_HUMAN     XXXXXXXGDNFETVTWLDSEVVRAPSPGWRAVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLH
MBLC2_BOVIN     XXXXXXXGDNFETVTWLDSEVVRAPSPGWRAVQAVQPTLVLQDGDVINLGDRQLTVMHMPGHSRGSICLH
GLO2_XANCP      H------------------FPA-LELYGPDDERMPSATRHVAHGDTVTALGIDFAVLEVPGHTRSHVAYV
GLO2_XANCB      H------------------FPA-LELYGPDDERMPSATRHVAHGDTVTALGIDFAVLEVPGHTRSHVAYV
GLO2_XANC8      H------------------FPA-LELYGPDDERMPSATRHVAHGDTVTALGIDFAVLEVPGHTRSHVAYV
GLO2_SYNP6      QFPEAAVSASAVDR---DRIPGQTVL--------------LEAGDRLQICGQTAEVLFVPGHTRGHIAYY
GLO2_SYNJB      RYP-------------------RARVYGSQVDRGRIPGQTVEAGETVEFAGRLAKVLFVPGHTRGHIAYY
GLO2_SYNE7      QFPEAAVSASAVDR---DRIPGQTVL--------------LEAGDRLQICGQTAEVLFVPGHTRGHIAYY
GLO2_SHEB5      QNRLTVYGPDNEK---IEGIT--------HPLNATAQPRFI-----LDYMSGELQVLDVPGHTAGHIAYV
GLO2_SHEB2      YSQLTVYGPDNEK---IEGIT--------HPLNATAQPRL-----TLDYMSGELQVLDVPGHTAGHIAYV
GLO2_PSEHT      ------ENPNIAVYG-----PTNSPFKGI--------TQQLTDGQSITVLNTAFNIIATPGHTLDHICYV
GLO21_SCHPO     YFSLKVYGG--KNASGVTYTPKDKEIF--------------------KVGEVQVEALHTPCHTQDSICYY
PNKD_HUMAN      RHR-------------------DCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYL
GLO2_SHESA      HVDLAVYGPQSEDIQGINQ-----------PIEPTLSDSL-----TLPFIDAPVRILSVPGHTAGHIAYL
GLO2_NITHX      KYKCRVVAPHDKKA----------------PIANV--DLRVGQGDIVKVGTLLGRVLETPGHTLDHISYV
GLO2_CYAP4      HFPTAVVYGGAEDR---GRIPGQQV--------------FLQPGDRVNFAQRTAEVLFVPGHTRAHIAYY
GLO2_CYAA5      QFDLCVYGSK-EDQ---GRIPGQQV--------------FLEEGDTVEFAGKTGKVYFVPGHTRGHIAYY
GLO2_CUPTR      HPRAPSGGP----------LP----VLGPAGERIGGRTQALREGDTLEAPALTLRVLDVPGHTAGHIAYV
GLO2_TOLAT      YPQCAVYGPQIT----LTDVPQLQTM---------------RDQDLISFPDLDLTVWHTPGHTAEHIVF-
GLO2_SERP5      YSGLKVYGPQETADKGANHI--------------------VHDGETIEINGQKFATIAVPGHTLGHVAFY
GLO2_DANRE      ------------NEKLVKLMPGLTVYGGDDRVGALT--QKVTHYNTFKVGSLNVKCLFTPCHTSGHICYF
LACB2_XENTR     DI---MNG----CNFSVSKLPRQEEVIGAVEHKY----NYLKDGDIITTEGATLRVLYTPGHTDDHMALE
HAGHL_MOUSE     ------------------ILPGLAVLGADERICALT--RRLEHGEGLQFGAIHVRCLLTPGHTSGHMSYF
GLO2_VIBVU      AFNVNVVGPKAE----------------------------------------------------------
GLO2_SACD2      NLQL-----------WRDEEPV---VYG-PSVIQDVTHP-VEDGDRIELCKGVLQVIATPGHMPEHLSYL
GLO2_RHOFD      ATGAQVFGPARE------PMP--------EPLIRLTGDQQLQ-----ALG-LNFQVIDVPGHTACHIAYF
GLO2_PHOLL      FPELLVYGP------------AETQSKGATIIVC--------GGDSINFGHFSFQIIDVPGHTLGHIAFY
GLO22_VIBVY     AFNVNVVGPKAE----------------------------------------------------------
LACB2_HUMAN     SI-------NNDTTYCIKKLPQREEIIGNGEQQYV----YLKDGDVIKTEGATLRVLYTPGHTDDHMALL
GLO2_STRM5      RFPAPVE----------ERIPTATERVG--------------EGERVQALGRMFHVLSVPGHTRSH-IAF
GLO2_MANSM      YYDIPVYG------------PAETADKGATHI--------VNEGN-IQTAHYRIEVVPSGGHTANHVSYL
LACB2_RAT       NISN-------DATYCIKKLPQKEEIIGSGEQQYV----YIEDGDLIKTEGATLRVLYTPGHTDDHMALL
GLO2_PSEFS      ATNAKVYGPANE------KIPAR--------------DVALNDNDRITVLGWDFDIYTVPGHTLGHITFY
GLO2_HALHL      RHRVPVFGPATETIPTVDHPITGGEHFSLE-----------------GFGE--FRVLDCPGHTAGHIAYL
GLO2_WIGBR      YFNTPVYGPK------------ETIKYGTTKI--------VKEGDEIFLLNKCFKVFELPGHTLGHVGFY
GLO2_RHOBL      -------------------------------------DHALREGDRVAIGAESAVVIDVPGHTRGHIAFH
GLO2_RHIL3      -------------------------------------DRAMADGDSFLFGDHTVNVIETPGHTAGHICYH
GLO2_LEPBL      RYGCTVY--------------SHPEGIGKIP-HATHP---LKKGDLLRSSKEYLEILDTPGHTFCHVCLL
GLO2_LEPBJ      RYGCTVY--------------SHPEGIGKIP-HATHP---LKKGDLLRSSKEYLEILDTPGHTFCHVCLL
GLO2_BRAJA      KYNCRVVAPH-------DKTTAIANV-----------DLRVANADVVKVGNLLARVVETPGHTLDHISYV
GLO2_BAUCH      YFPVTIYGPQETFKQCANII--------------------VKKGDFLVLLEKKFAVLSFPGHTLGHIGFY
GLO2_ANASP      KF------PQVK-------------VYGGAKDQGRIPGQFLQPGDRVQFADRVAEVIFVPGHTRAHIAYY
GLO2_PSEE4      ATGAQVFGPANE------RIPAR--------------DIALEDGAQVHVLGLAFDVLAMPGHTLGHIAYY
GLO2_ANAVT      ----------------IQNFP-QLKVYGGAEDKGRIPGQFLQPGDRVQFTDRVAEVIFVPGHTRAHIAYY
LACB2_DANRE     HFNT-------DAELRVSKLPR------CPPQEEIIGDSYLNDGDVIQTEGATLRVLFTPGHTDDHMALL
GLO2_PROM9      R------WPNVQ----VIASSKDKKRIPFQNIS-------VEDGETLNILGEEIKIIEVLGHTNSHIAFF
GLO2_AERHH      ----------------------------FPHARLYGPKQWLDDGDQINWHGLSLEVIHVPGHTHGHIAYY
GLO2_JANSC      ATGAKVWG-------------AAADAHRLPPL-----DHALAEGDTIRIGALEGDVMDVSGHTVGHVAFH
GLO2_HAEIN      RYTVPIYGPQ------------ECEKKGATQI--------VNEG-KILTANYQIDVIPTGGHTKQHVSFL
GLO2_EDWI9      AYEMPVYG------------PAETQGQGCTQVVA--------DNDTLSLLGCQISIMALPGHTLGHMAYY
LACB2_BOVIN     SI-------NNDTTYCVKKLPERKEIIGNGEQQYV----YVKDGDIIKTEGATLRVVYTPGHTDDHMALV
GLO2_RHIEC      ----------LKEQFGCEIIGPINEAIAIPGL-----DRTMADGDSFLFGDHTVKVIETPGHTAGHICYH
LACB2_MOUSE     NINN-------DTTYCIKKLPQREEIIGNGE-QQFI---YIENGDVVKTEGATLRVLYTPGHTDDHMALL
GLO2_RALEJ      AYPTTHDG-------------APMPVIGPAGERIGGRTQAVREGDTVTLPAPALRVLDVPGHTAGHVAYL
GLO2_METCA      XXXXXXXXXXXXDRHRIPGI-----------------DVALKDGEEFRLGSASARMLDVPGHTSGHVAFW
GLO2_CHICK      -------------------LETGLRVYG-GDSRVGALTQKVSHLTSLKVGSLNVKCLCTPCHTSGHICYY
GLO2_BLOFL      HFKIKIYGP----------IETQNQNFATITV---------SEGDTLQILNQEIKVLNFPGHTPHHIGFY
GLO2_PROM0      RWQVKVIASSKEKK----RIPFQNVS--------------VEDGETLNILGEEVKIIEVLGHTSSHIAFF
BLA1_STEMA      RTGAKV-AANAESAVLLARGGSDDLHFGYPPANA---DRIVMDGEVITVGGIVFTAHFMAGHTPG-----
GLO2_HAEPS      FPDMLIYGSEEVSQFQIVYPEQQFELLG-----------------------LKVRVIESAGHTAQHISYL
GLO2_PROMM      DWPNXXXXXXXEDR---DRIPFQT---------ISVRDR-----DKVSLLNSSVEVLAVAGHTRAHIAYY
GLO2_HAEDU      YPDLTI--------------------YGSHEVAQYV-NHIVQAGDHLHLLNSDVEVINSAGHTAQHISFL
GLO2_BART1      -------------------------------------DQTLQSDEKLLFGSQSLLALSTPGHTLGALSYY
GLO2_PROMS      K------WPNVK----VIASSKEKKRIPFQNVS-------VEDGETLNILGEEVKIIEVLGHTSSHIAFF
GLO2_ACTSZ      YFDVPVYGPQ--------------------ECADKGATRIVNEGEIVT-ANYRIRVIPTGGHTAQHVSYV
Y888_METJA      YFNCPIEDKEVKDEVTVSSL--------FGAKLNXXXXXXXXXXXXXXXXXYGLEIIRTPGHTYGSISII
GLO2_SYNSC      RWP---EAEVIASADDRERIPFQT-----MPVRG---------GDHVTVLGETVEVMDVAAHTRAHIAFF
GLO2_RHOS5      -------------------------------------DLALAEGDRVRIGSEDGTVLEVPGHTVGHIAFH
RNZ_BRAJA       RAPIPVEFAALSEGFTIDCFPVRTDSFGFPARRHLLPDRLASLG--------------------------
GLO2_PROMA      -INVWPSASVIAAKSDLDRIQFQTKS--------------VVDNEELDILGQKIKVIEVPGHTSNHICFF
GLO2_LEGPH      Q--------------W-----PSCKVYGPIDERINNVTHPIKQGQSVQVGSLHFHILFNPGHTSTHISYY
GLO2_LEGPC      Q--------------W-----PSCKVYGPIDERINNVTHPIKQGQSVQVGSLHFHILFNPGHTSTHISYY
GLO2_RHOP5      -------------------------------------DLRVAQGDVVKVGGLLARVLETPGHTLDHLAYV
Y4333_HERA2     QTKAPVAG--------------------------------------------------------------
Y1060_STAS1     RNHATVIG--------------------------------------------------------------
GLO2_LEGPL      Q--------------W-----PSCKVYGPIDERISNLTHPIKQGQSVQVGSLHFHILFNPGHTSTHISYY
GLO2_ROSDO      ----------------LSAHPAQVRGAARDAHRLPALDVELRDGESFDFAGHKVDVMDVSGHTVGHIAYY
GLO2_NEIG2      GY-------------------MESPVYGESDIEAAT--HTVTAGTRFTFGNGQVTVWATPGHTDRHTSYL
GLO2_LEGPA      Q--------------W-----PSCKVYGPIDERINNVTHPIKQGQSVQVGSLHFHILFNPGHTSTHISYY
Y1118_PICTO     RLKIPV----------------------------------------------------------------
LACB2_CAEEL     KKKIPIYKMKRDKDEGVERF------------------HYVDDGFEVAVDGATLKLIATPGHTADHFSLW
GLO2_PROMT      T--------------WPEAVVASKKEHKRIPFQTFSVD----DNDIFNLMDAEIKVIEVHGHTDNHIAFY
GLO2_PROM1      T--------------WPEAVVASKKEHKRIPFQTFSVD----DNDIFNLMDAEIKVIEVHGHTDNHIAFY
RNZ_BRASO       ----------------------------------------------------------------------
GLO2_SYNPX      R--------------WPDAVAAGADRSRIPFQTISVSD-----GDQVTVLGRSLQVLDVAAHTSAHIAFV
Y3294_BACCN     RNDAIVVAP-------------------------------------------------------------
GLO2_SHEON      YVELAVYGPQSE--------AIQGVNIAIEPQ--------ITQILHLPFLNSPVQVLSVPGHTAGHIAYL
GLO2_NEIG1      GY-------------------MESPVYGESDIEAAT--HTVTAGTRFTFGNGQVTVWATPGHTDRHTSYL
YOBT_BACSU      TFPHAKVMISERDSFLLQGDTSLRQDEPQTPIKGGIPKHIQTKPHQLLTGGETIGAIPTPGHTPGSMSFL
GLO2_SYNS9      ------EWPQAE------VVAATADRLRIP-----LQTRGVADGDVINLLGRRLEVIDVAAHTSAHIAFF
GLO2_NEIMF      GY-------------------MESPVYGESDIEAAT--HTVTAGTQFTFGDGQVTVWATPGHTDRHTSYL
GLO2_NEIMB      GY-------------------MESPVYGESDIEAAT--HTVTAGTQFTFGDGQVTVWATPGHTDRHTSYL
GLO2_NEIMA      GY-------------------MESPVYGESDIEAAT--HTVTAGTQFTFGDGQVTVWATPGHTDRHTSYL
GLO2_NEIM0      GY-------------------MESPVYGESDIEAAT--HTVTAGTQFTFGDGQVTVWATPGHTDRHTSYL
Y4741_BACC7     KNNAVVVAP-------------------------------------------------------------
Y1382_STAES     RNHATVIG--------------------------------------------------------------
Y1270_STAEQ     RNHATVIG--------------------------------------------------------------
GLO2_THIDA      RYNCAIYAPD------NPRIPAVSHV--------------VRGGDSVAVPELALAVLATPGHTLDHVSYV
GLO2_SHEDO      QNSLPVYGPKAEGIAGITHEIIDERTLCLPHLEANV------------------EIIPVPGHTLGHHAYL
Y3178_BACHD     QNDALVIAP-------------------------------------------------------------
Y1373_MACCJ     RTGAKVIGPELCD---------------------------------------------------------
Y1218_STAHJ     RNHATVIG--------------------------------------------------------------
GLO2_SYNPW      QWPDAAVIASGQDR---GRIPFQTQ-----PVAA---------GTRFTLLGVPVDVIDVRAHTSAHLAFF
Y515_BACC2      KNNAVVVAP-------------------------------------------------------------
Y4892_BACAC     KNNAVVVAP-------------------------------------------------------------
Y4871_BACAA     KNNAVVVAP-------------------------------------------------------------
Y4860_BACAN     KNNAVVVAP-------------------------------------------------------------
Y4747_BACC1     KNNAVVVAP-------------------------------------------------------------
Y4729_BACC0     KNNAVVVAP-------------------------------------------------------------
Y4725_BACC3     KNNAVVVAP-------------------------------------------------------------
Y4722_BACC4     KNNAVVVAP-------------------------------------------------------------
Y4418_BACCQ     KNNAVVVAP-------------------------------------------------------------
Y4343_BACHK     KNNAVVVAP-------------------------------------------------------------
Y4194_BACAH     KNNAVVVAP-------------------------------------------------------------
Y2750_GEOKA     R---------------------------------------------------------------------
Y2675_GEOTN     R---------------------------------------------------------------------
Y4613_BACCR     KNNAVVVAP-------------------------------------------------------------
Y1312_STACT     KNNATVVG--------------------------------------------------------------
Y1163_METJA     TYNVPV----------------------------------------------------------------
Y1162_THEMA     KNDATV----------------------------------------------------------------
RNJ1_BACSU      QVNIPVYGGKL-----------------------------------------------------------
GLO2_YEAST      YLKE--KNPTSKVEVIGGSKDC--------PKVTIIP----ENLKKLHLGDLEITCIRTPCHTRDSICYY
Y574_PARDP      ELKIPVVG--------------------------------------------------------------
Y5695_RALME     TQHVPIMGPQL-----------------------------------------------------------
Y4324_POLSJ     LNQVPMHAP-------------------------------------------------------------
Y1920_SILST     HLSVPIVGQYDLMGYWGETEGVQTVGF-------------------------------------------
Y1265_ARCFU     RNNAPI----------------------------------------------------------------
Y119_PYRAB      LNDAEVIGPKTV------YLMAISD--GLTKVRE------IEAGQEIQLGDVTVKAFYTEHPTSGYLII-
SYFB_BURPS      RLMQKYELPHAPVMFEIDTLPAPSEVSKFPPVRAVVVDQKVE----------------------------
SYFB_BURP1      RLMQKYELPHAPVMFEIDTLPAPSEVSKFPPVRAVVVDQKVE----------------------------
SYFB_BURMA      RLMQKYELPHAPVMFEIDTLPAPSEVSKFPPVRAVVVDQKVE----------------------------
RNJ_METJA       RYNAPIIG--------------------------------------------------------------
RNJ2_BACSU      KLSVPVYGTKL-----------------------------------------------------------
Y4354_BACCZ     KNNAVVVAP-------------------------------------------------------------
Y4138_LYSSC     KKDALVIAP-------------------------------------------------------------
Y2976_SILPO     LLKVPVVGQYDLMGYWSEA--EEIETVGF-----------------------------------------
Y1785_STAAR     KTEATVIG--------------------------------------------------------------
RNZ_KINRD       RM--------------------------------------------------------------------
RNJ1_STAS1      QINVPIYG--------------------------------------------------------------
RNJ1_STAHJ      QINVPIYG--------------------------------------------------------------
RNJ1_STAAW      QLNIPIYG--------------------------------------------------------------
RNJ1_STAAS      QLNIPIYG--------------------------------------------------------------
RNJ1_STAAR      QLNIPIYG--------------------------------------------------------------
RNJ1_STAAN      QLNIPIYG--------------------------------------------------------------
RNJ1_STAAM      QLNIPIYG--------------------------------------------------------------
RNJ1_STAAC      QLNIPIYG--------------------------------------------------------------
RNJ1_STAAB      QLNIPIYG--------------------------------------------------------------
RNJ1_STAA8      QLNIPIYG--------------------------------------------------------------
RNJ1_STAA3      QLNIPIYG--------------------------------------------------------------
Y171_GEOLS      K-----TGAKLVATF--DLQKAMVAYKGFPAKQA-------ERAETGSFGGTI-----------------
RNJ_MYCPN       QVDVPV----------------------------------------------------------------
RNJ1_STAES      QINVPIYG--------------------------------------------------------------
RNJ1_STAEQ      QINVPIYG--------------------------------------------------------------
GLO2_RHOCA      -------------------------------------DHPVAPGDVLHLGMEAAQVIAADGHTLGHIAWY
Y3437_ACIBL     K---------------------------------------------------------------------
Y2229_RHOS5     ELGLPIVG--------------------------------------------------------------
Y020_PYRFU      LSDAEVIGPK------------------------------------------------------------
SYFB_BURTA      RLMQKYELPHAPVMFEIDALPAPSEVSKFPPVRAVVVDQKVE----------------------------
RNJ_MYCGE       QVDIPV----------------------------------------------------------------
LIPB_PORGI      ----------------------------------------------------------------------
GLO2_SYNS3      R--------------W-----SSAEVIAAADDKERIPFQTLRDGDEIELLGRPVRVMDVRAHTRAHIAYW
GLO2_ANADE      ------------------------------------PDVDLAGRAEVALGALALRVHPVPGHTPGSVL-L
Y864_THEVO      RTGAPV----------------------------------------------------------------
Y488_ANOFW      KNDALVIAP-------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLFPLGDEVRFIPGHGPMSTFGEERQSNPFVGE
YCBL_ECOLI      DDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKLLPLGDDVIFIPGHGPLSTLGYERLHNPFLQD
Y1663_HAEIN     EHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKLLPLNDDIIIIAGHGSYTTIGQEKRSNPFLNS
Y2135_AQUAE     EEKRRVLIAGDLLFKGSVGRWDLPGGNLVELKKSVKRVLTELPQDTLVICGHYDETTIGQERAFNPFAGE
YQGX_BACSU      VKDADLVISGDVLFQGGIGRTDLIGGNQETLLTSIHEKLLTLPEHTLVLSGHGPETDVLTEQDQNPFL--
Y2612_MYCBO     NNDKDIVFTGDTLFERAIGRTDLAGGSGRDLLRSIVDKLLVLDDSTVVLPGHGNSTTIGAERRFNPFL--
Y2581_MYCTU     NNDKDIVFTGDTLFERAIGRTDLAGGSGRDLLRSIVDKLLVLDDSTVVLPGHGNSTTIGAERRFNPFL--
Y493_MYCLE      AADTDVVLTGDTLFERTIGRTDLFGGSGRDLYRSIXXXXXXXXXXXXXXPGHGNSTTIGAERRFNPFL--
Y554_STRP6      FHSDELVVTGDALFRETIGRTDLPTSNFEDLITGIRQELFTLPNHYRVYPGHGPSTTICHEKNANPF---
ETHE1_BOVIN     LNDHSMAFTGDALLIRGCGRTDFQQGCAETLYHSVHEKIFTLPGNCLIYPAHDTVSTVEEERTLNP----
ETHE1_HUMAN     LNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDTVSTVEEERTLNP----
ETHE1_MOUSE     LNDQSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGNCLIYPAHDTVSTVEEERTLNP----
GLO2_BDEBA      NQKHKWLFSGDVIFGLGCGR--------------------------------------------------
GLO2O_ARATH     QPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDEVSTVGEEMQHNP----
GLO2_PSEMY      HAEQNLLLCGDTLFAGGCGR--------------------------------------------------
GLO2_RHORT      FAESSALFCGDTLFSAGCGR--------------------------------------------------
GLO2_HAHCH      GAGAPRLFCGDTLFSAGCGR--------------------------------------------------
GLO2_METFK      --GDGMLFSGDTLFGAGCGR--------------------------------------------------
GLO2_HERAR      AAEQGWLFCGDTLFAGGCGR--------------------------------------------------
GLO2_THEEB      APTTGDLFCGDTLFGGGCGR--------------------------------------------------
GLO2_MARMM      MPMDGIAFVGDTLFALGCGR--LFEGTPAEMWHSL-SRLAALPDETRIYCAH------------------
GLO2_DECAR      APGA--LLCGDTLFGAGCGR--------------------------------------------------
GLO2_NITOC      APSNPPALCGDTLFNAGAGNC-HNGGDPNALYATFTQQLALLPCNTRIYPGH------------------
GLO2_KLEP3      -SEPYL-FCGDTMFSGGCGR--------------------------------------------------
GLO2_IDILO      TP--GFLFCGDTLFSGGCGR--------------------------------------------------
GLO2_VIBPA      GDSK--LFCGDVLFSAGCGR--------------------------------------------------
GLO2_VIBHB      GDGK--LFCGDVLFSAGCGR--------------------------------------------------
GLO2_POLSJ      HTEQPALFSGDTLFNAGAGNVH-NGGDVNALYATFAEQLARLPDDTLVYPGH------------------
GLO2_KLEP7      -SEPYL-FCGDTMFSGGCGR--------------------------------------------------
BLH_XYLFA       IGDT--AFVHDTIFMPDAGRADFPGGSARALWSSI-QTILSLPDETRLFTGHDYQSTVGEQKKANP----
GLO2_HYPNA      FPDQEAAFVGDAVFALGCGR--------------------------------------------------
GLO2_PSYIN      NDE--LLFCGDTLFSGGCGRVF--EGSFEQMFKAVRLALLPENTKV------------------------
GLO2_PSEU2      HEDATTPLLGDTLFAAGCGR--------------------------------------------------
GLO2_HAMD5      --SAPYLFCGDTLFSAGCGR--LFEGTADQMYDSIQK-LIQLPDETLICAGH------------------
GLO2_BUCAP      --LKPYIFCGDTLFSGGCGR--------------------------------------------------
GLO2N_ARATH     FPGSRAIFTGDTMFSLSCGK--LFEGTPKQMLASLQK-ITSLPDDTSIYCGH------------------
GLO2_BRUSU      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_BRUSI      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_BRUO2      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_BRUME      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_BRUMB      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_BRUC2      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_BRUAB      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_BRUA2      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_BRUA1      LPDAKVVFTGDTLFALGCGR--LFEGTPATMFHSLEKLVALPGDTALYC-GH------------------
GLO2_PSEPK      QPATPILFSGDTLFAAGCGR--------------------------------------------------
GLO2_PSEP1      QPATPILFSGDTLFAAGCGR--------------------------------------------------
GLO2_PSEF5      H--HGLLFCGDTLFAAGCGR--LFEGTPEQMHHSL-GRLAALPDD-------------------------
GLO2_PSE14      HEDATTPLLGDTLFAAGCGR--------------------------------------------------
GLO2_PSESM      HEDAAAPLLGDTLFAAGCGR--------------------------------------------------
GLO2_PECCP      N--APFLFCGDTLFSAGCGREGTPRQMYESI---------------------------------------
GLO2_MARMS      EQETPILLSGDTLFKGGCGR--------------------------------------------------
GLO2_FRAP2      FEKEKALFCGDTLFNAGVGGVHAASADVNQLYDSVVK-ISSLDGDIKPYPAH------------------
GLO2_RHIME      LPEDKLLFAADTLFALGCGR--LFEGTADTMWQSL-SRLMALPDDTAIYFGH------------------
GLO2_ECOL6      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_PSEPW      QPATPVLFSGDTLFAAGCGR--------------------------------------------------
GLO2_BUCAI      --SQPYIFCGDTLFSAGCGR--------------------------------------------------
GLO2M_ARATH     FPGSATIFTGDLIYSLSCG--TLSEGTPEQMLSSLQK---------------------------------
GLO2_SHEPC      IEDA--LFCGDTLFSAGCGR--------------------------------------------------
GLO2_ECOLU      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
YRKH_BACSU      VDDQYL-LSGDILFIDSIGRPDL-AGMAEDWVGDLRKTLYALSKDLIVLPAHFMII---DELNENGSVGK
GLO2_TRIEI      FPETGELFCGDTLFAGGCGR--------------------------------------------------
GLO2_PSEAE      HPETPLLFCGDTLFAAGCGR--------------------------------------------------
GLO2_PSEA8      HPETPLLFCGDTLFAAGCGR--------------------------------------------------
GLO2_ESCF3      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ERYLH      LPEAGIAFVGDSVFALGCGR--------------------------------------------------
GLO2_ECOSM      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO7I      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_XANAC      -ADGHL-FSGDTLFSLGCGR--------------------------------------------------
GLO2_ERWCT      N--APFLFCGDTLFSAGCGR--------------------------------------------------
GLO2_ECOUT      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECOL5      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECOK1      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO81      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO45      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO27      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_CHRSD      APGTGLLFCGDTLFSGGCGRLFEGTAEQ---MHRSLARLAALPDDTLVFAGH------------------
GLO2_YERE8      --SKPYLFCGDTLFSAGCGR--------------------------------------------------
GLO2_VIBCM      GDGK--LFCGDVLFSAGCGRVF--EGTMEQMFSSLNK-LLSLPEETQVYSAH------------------
GLO2_VIBCH      GDGK--LFCGDVLFSAGCGRVF--EGTMEQMFSSLNK-LLSLPEETQVYSAH------------------
GLO2_VIBC3      GDGK--LFCGDVLFSAGCGRVF--EGTMEQMFSSLNK-LLSLPEETQVYSAH------------------
GLO2_SHISS      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SHIFL      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SHIF8      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SHIDS      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SHIBS      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SHIB3      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_RHOS4      FPDSSLAFTGDSLMAMGCGR--LFEGTAEAMWQSLRK-LSALPPETMICSGH------------------
GLO2_NITEC      --GQNYLFCGDTLFACGCGR--IFEGSAQQMLASLQK-LASLPDETLVYCAH------------------
GLO2_ENT38      --SSPYLFCGDTMFSGGCGR--------------------------------------------------
GLO2_ECOSE      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECOLI      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECOLC      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECOHS      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECODH      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECOBW      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO8A      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO5E      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO57      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO55      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ECO24      --SKPYLFCGDTLFSGGCGR--------------------------------------------------
BLH_AGRT5       --VGNAAFVHDTLFMPDSGRADFPGGSAKQLWASIQD-ILALPDDTRLFTGHDYQSTVGEQTRSNP----
GLO2_XANC5      -ADGYL-FSGDTLFSLGCGR--------------------------------------------------
GLO2_RHOS1      FPDSSLAFTGDSLMAMGCGR--LFEGTAEAMWQSLRK-LSALPPETMICSGH------------------
GLO2_NOSP7      FPETGDLFCGDTLFSGGCGR--------------------------------------------------
GLO2_NITEU      HGQNRL-FCGDTLFACGCGR--IFEGNAQQMFDSLQK-LTDLPDETQVYCAH------------------
GLO2C_ARATH     EGENPAVFTGDTLFVAGCGK--FFEGTAEQMYQSLCVTLAALPKPTQVYCGH------------------
YYBB_BACSU      HKIDRTLLTGDL----------------------------------------------------------
BLH_XYLFT       IGDT--AFVHDTIFMPDSGRADFPGGSARALWSSI-QAILSLPDETRLFTGHDYQSTVGEQKKAN-----
GLO2_THICR      HPEALFS--GDTLFTGGCGK--------------------------------------------------
GLO2_PSEPG      SPPTPVLFSGDTLFAAGCGR--------------------------------------------------
GLO2_FRATN      FEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVK-ITKLDGDIKPYPAH------------------
GLO2_ALISL      GDEK--LFCGDTLFSAGCGR--LFEGTAEQMFHSLQK-LAALPDETEVYCAH------------------
GLO22_SCHPO     AHSSHAVFTGDTLFNAGCGR--FFEGTAAEMHIALNAVLSSLPNNTVIYPGH------------------
GLO2_YERPY      --SSPYLFCGDTLFSAGCGR--LLEGTPEQMYASI-QRLAQLPDETLICCAH------------------
GLO2_YERPS      --SSPYLFCGDTLFSAGCGR--LLEGTPEQMYASI-QRLAQLPDETLICCAH------------------
GLO2_YERPP      --SSPYLFCGDTLFSAGCGR--LLEGTPEQMYASI-QRLAQLPDETLICCAH------------------
GLO2_YERPN      --SSPYLFCGDTLFSAGCGR--LLEGTPEQMYASI-QRLAQLPDETLICCAH------------------
GLO2_YERPE      --SSPYLFCGDTLFSAGCGR--LLEGTPEQMYASI-QRLAQLPDETLICCAH------------------
GLO2_YERPB      --SSPYLFCGDTLFSAGCGR--LLEGTPEQMYASI-QRLAQLPDETLICCAH------------------
GLO2_YERPA      --SSPYLFCGDTLFSAGCGR--LLEGTPEQMYASI-QRLAQLPDETLICCAH------------------
GLO2_YERP3      --SSPYLFCGDTLFSAGCGR--LLEGTPEQMYASI-QRLAQLPDETLICCAH------------------
GLO2_SHESW      IEDA--LFCGDTLFSAGCGR--------------------------------------------------
GLO2_SHELP      -IDDHL-FCGDTLFSAGCGR--------------------------------------------------
GLO2_FRATW      FEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVK-ITKLDGDIKPYPAH------------------
GLO2_FRATT      FEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVK-ITKLDGDIKPYPAH------------------
GLO2_FRATO      FEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVK-ITKLDGDIKPYPAH------------------
GLO2_FRATM      FEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVK-ITKLDGDIKPYPAH------------------
GLO2_FRATH      FEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVK-ITKLDGDIKPYPAH------------------
GLO2_FRATF      FEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVK-ITKLDGDIKPYPAH------------------
GLO2_FRAT1      FEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVK-ITKLDGDIKPYPAH------------------
GLO2_ERWT9      HP---YLFCGDTLFSAGCGR--------------------------------------------------
GLO2_ALHEH      ADGALFS--GDALFAGGCGR--------------------------------------------------
GLO21_VIBVY     YKDN--LFCGDVLFSAGCGRVG---SNYKDMYLSLKK---------------------------------
MBLC2_CHICK     DREHKILFSGDVVYDGSM--IDWPYSNVSDYVVSCQRELVDRGLVEKVLPGH--FNMFGAER--------
GLO2_PELUB      FYNEESVFTGDTLF--SLGCGKIFEGTYSQMYNSLMK-IKALPEKTKIYCGH------------------
GLO2_SALPK      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALPA      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_AGRT5      LPDDGLLFAADTLFAMGCGRL-FERPAAD-MWHSFQK-LMALPDDTRVYFGH------------------
GLO2_RHOPA      FDDDRALFAADTLFSIGCGRVF--EGTYPMMWESLLK-LRALPDDFKLYCGH------------------
GLO2_RHILO      LPASKVAFTADTLFALGCGR--------------------------------------------------
GLO2_AERS4      HGHGML-FCGDTLFSGGCGRL---FEGTPAQMHDSLQRLAALPDDTLIYCAH------------------
GLO2_ACAM1      FPEWGELFCGDTLFAGGCGR--------------------------------------------------
GLO2_SALPC      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ACTPJ      FGNEYL-FCGDVLFSGGCGRVF--TGNYQAQFDAL-QRFKALPEFVEIFPAH------------------
GLO2_ACTP7      FGNEYL-FCGDVLFSGGCGRVF--TGNYQAQFDAL-QRFKALPEFVEIFPAH------------------
GLO2_VIBF1      GDEK--LFCGDALFSAGCGR--LFEGTAEQMFNSLQK-MAALPDETEVYCAH------------------
GLO2_SYNP2      FPDSGDLFCGDTLFANGCGR--------------------------------------------------
GLO2_SODGM      --SAPWLFCGDTVFSAGSGR--------------------------------------------------
GLO2_SALTI      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALSV      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALPB      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALNS      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALHS      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALEP      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALDC      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALCH      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALA4      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_OCHA4      LPDAKAVFTGDTLFALGCGR--------------------------------------------------
GLOB2_DICDI     YIENDSVFVGDTMFMPDVGRCDFPNGSAETLWTSM-KKILELPETVKVYVCHDYFTTIAEQRLSNKHIKD
GLO2_VIBFM      GDEK--LFCGDALFSAGCGR--LFEGTAEQMFNSLQK-MAALPDETEVYCAH------------------
GLO2_SYNY3      APGSGETICGDTIFAGGCGR--LFEGTPAQMVQSIGK-LRQLPDQTRLWCAH------------------
GLO2_SALG2      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_PSEA7      HAQTPLLFCGDTLFAAGCGR--------------------------------------------------
GLO2_MICAN      FPPVNPGFCGDTLFSGGCGR--------------------------------------------------
GLO2_METS4      FERERIAFAGDTLFTLGCGRV--MESPPEVLWRSL-SRFLALPDETAIYSGH------------------
GLO2_VIBSL      GDAK--LFCGDVLFSAGCGREGTPQQMFDAL---------------------------------------
GLO2_SILPO      LPTGKAVFTADSLMALGCGR--LFEGTPDQMWASLSK-LAALPDDTLVCSGH------------------
GLO2_GLOVI      FAGCGHLFCGDTLFAGGCGR--------------------------------------------------
GLO2_BRASO      XXXXXXXXXXXTLFSIGCGRVF--EGTYPMMWDSLLK-LRTLPDDFRLYCGH------------------
PNKD_BOVIN      YEGPSCLFSGDLLFLSGCGRT-------------------------------------------------
GLO2_SHEB8      IADA--LFCGDTLFSGGCGR--------------------------------------------------
GLO2_NITWN      FDDEKVVFAADTLFSIGCGRVF--EGTYPMMWDSLLK-LRALPDSFRLYCGH------------------
GLO2_METNO      FERERLAFAGDTLFTLGCGRV--MESPPEVLWRSL-SRFLALPDETAIYSGH------------------
GLO2_CITK8      HP---YLFCGDTLFSGGCGR--------------------------------------------------
GLO2_ACTP2      FGNEYL-FCGDALFSGGCGRVF--TGNYQAQFDAL-QRFKALPEFVEIFPAH------------------
GLO2_SHEAM      --VDNALFCGDTLFSGGCGR--LFEGDAGQLYDSLAK---------------------------------
GLO2_PSEPF      H--HGLLFCGDTLFAAGCGR--------------------------------------------------
GLO2_XYLFA      --GNDLLFCGDTLF--SLGCGQIFEGTPTQMLASL-QRLAALPIQTRVCCGH------------------
GLO2_XANOM      -TDRHL-FSGDTLFSLGCGR--------------------------------------------------
GLO2_SALTY      --SRPYLFCGDTLFSGGCGR--------------------------------------------------
GLO2_RALME      PGAGPVVFCGDTLFASGCGR--------------------------------------------------
GLO2_CYAP8      FPETGELFCGDTLFGGGCGR--------------------------------------------------
GLO2_BARQU      FPQENLLFSGDTLFSLGCGR--LFEGTPAQMLNSF-KKLRQLPDETLLYCGH------------------
PNKD_MOUSE      YKGPSCLFSGDLLFLSGCGRT-------------------------------------------------
GLO2_XYLFT      --GNDLLFCGDTLF--SLGCGQIFEGTPTQMLASL-QRLAALPIQTRVCCGH------------------
GLO2_XYLFM      --GNDLLFCGDTLF--SLGCGQIFEGTPTQMLASL-QRLAALPIQTRVCCGH------------------
GLO2_XYLF2      --GNDLLFCGDTLF--SLGCGQIFEGTPTQMLASL-QRLAALPIQTRVCCGH------------------
GLO2_SYNJA      FPESGDLFCGDTLFAGGCGR--------------------------------------------------
GLO2_RHOPB      FDDDKALFAADTLFSIGCGRVF--EGTYPMMWESLLK-LRVLPDDMRLYCGH------------------
GLO2_RHOP2      FADDRALFAADTLFSIGCGRVF--EGTYPMMWESLLK-LRALPDDYKLYCGH------------------
GLO2_MESSB      FAKAGIAFTADTLFALGCGR--------------------------------------------------
GLO2_BARHE      FPQENLLFAGDTLFSLGCGR--LFEGTPAQMLNSL-KKLRQLPDETLLYCGH------------------
LACB2_XENLA     LLEENAIFSGDILGEGTAVFEDL----YD-YMKSLEKLLEMKADKI--YPGHGPV---------------
GLO2_SHEB9      IADA--LFCGDTLFSGGCGR--------------------------------------------------
GLO2_SALAR      HP---YLFCGDTLFSGGCGR--------------------------------------------------
MBLC2_MOUSE     DKDRKVLFSGDVVYDGSLSRISDYVGTCERLIELVDRGLVE-----KVLPGH--FNTFGAER--------
GLO2_MARAV      SDDKPVLFCGDTLFVCGCGR--------------------------------------------------
GLO2_CYAP7      FPETGELFCGDTIFAGGCGR--LFEGTPAQMVNSLSK-LRALPDNTRIWCAH------------------
MBLC2_HUMAN     DKDRKILFSGDVVYDGSLSRISDYVGTCERLIELVDRGLVE-----KVLPGH--FNTFGAER--------
MBLC2_BOVIN     DKDRKILFSGDVVYDGSLSRISDYVGTCERLIELVDRGLVE-----KVLPGH--FNTFGAER--------
GLO2_XANCP      -GDGHL-FSGDTLFSLGCGREGTPPQMFDAL-----QRLASLPGETLVCCGH------------------
GLO2_XANCB      -GDGHL-FSGDTLFSLGCGREGTPPQMFDAL-----QRLASLPGETLVCCGH------------------
GLO2_XANC8      -GDGHL-FSGDTLFSLGCGREGTPPQMFDAL-----QRLASLPGETLVCCGH------------------
GLO2_SYNP6      FPERGALFCGDTLFAGGCGR--------------------------------------------------
GLO2_SYNJB      FSESGDLFCGDTLFAGGCGR--------------------------------------------------
GLO2_SYNE7      FPERGALFCGDTLFAGGCGR--------------------------------------------------
GLO2_SHEB5      IADA--LFCGDTLFSAGCGR--------------------------------------------------
GLO2_SHEB2      IADA--LFCGDTLFSGGCGR--------------------------------------------------
GLO2_PSEHT      NEQ--LAFTGDTLFSGGCGR--LFEGSAEQMWHSFNK---------------------------------
GLO21_SCHPO     SPSKRAVFTGDTLFTSGCGR--FFEGDAKQMDYALNHVLAALPDDTVTYPGH------------------
PNKD_HUMAN      YKGPSCLFSGDLLFLSGCGRT-------------------------------------------------
GLO2_SHESA      VDDA--LFCGDTLFSAGCGR--------------------------------------------------
GLO2_NITHX      FDDEKVVFAADTLF--SIGCGRVIEGTYPMMWDSLLK-LRALPDDFRLYCGH------------------
GLO2_CYAP4      FPSSGELFCGDTLFAGGCGR--------------------------------------------------
GLO2_CYAA5      FPPNENEEIGDLIFAGGCGR--------------------------------------------------
GLO2_CUPTR      ADEAGPALCGDTLFASGCGR--------------------------------------------------
GLO2_TOLAT      --HGHGALCGDTLFSGGCGR--LFSGTAEQMYHSL-QRLASLPEDTLVYPAH------------------
GLO2_SERP5      --SAPYLFCGDTIFSAGCGR--------------------------------------------------
GLO2_DANRE      STEAPAVFTGDTLFVAGCGK--FFEGTADEMYKALIEVLGRLPPETRVYCGH------------------
LACB2_XENTR     LLEENAIFSGDILGEGTAVFEDL----YD-YMKSLEKLLEMKADKI--YPGHGPV---------------
HAGHL_MOUSE     CPDSPALFSGDALSVAGCGW--HLEDTAQQMYQSLAKTLGTLPPETKVFCGH------------------
GLO2_VIBVU      ----------------------------------------------------------------------
GLO2_SACD2      LPLTTPKLCGDTLFSCGCGR--------------------------------------------------
GLO2_RHOFD      CADAPLLFCGDTLFSAGCGR--------------------------------------------------
GLO2_PHOLL      --QAPYLFCGDTLFSGGCGR--------------------------------------------------
GLO22_VIBVY     ----------------------------------------------------------------------
LACB2_HUMAN     LEEENAIFSGDCIL--GEGTTVFE--DLYDYMNSLKELLKIKADII--YPGHGPV---------------
GLO2_STRM5      HTAEHL-FSGDSLFSLGCGR--------------------------------------------------
GLO2_MANSM      -IDNHL-FCGDTLFSAGCGRVF--TGDYGQMFESI-TRLKQLPDKTVICPAH------------------
LACB2_RAT       LEEENAIFSGDCIL--GEGTTIFE--DLSDYMNSLKDLLKVKANII--YPGHGPV---------------
GLO2_PSEFS      H--SGVLLCGDTLFAAGCGR--------------------------------------------------
GLO2_HALHL      W-EGHL-FSGDALFAGGCGR--------------------------------------------------
GLO2_WIGBR      SPPWFFC--GDTLFSAGCGR--------------------------------------------------
GLO2_RHOBL      FPGSALAFTGDSLMAAGCGR--------------------------------------------------
GLO2_RHIL3      FVDDKLLFAADTLFALGCGRL-FERPAAD-MWHSLQK-LAVLPDETAVYFGH------------------
GLO2_LEPBL      LVENQAIFTGDTIFNAGVGNCHHG-GDPEVLAKTILEQFYPLEEEILLYPGHDYLET-------------
GLO2_LEPBJ      LVENQAIFTGDTIFNAGVGNCHHG-GDPEVLAKTILEQFYPLEEEILLYPGHDYLET-------------
GLO2_BRAJA      FDTEKTVFAADTLFSIGCGRVF--EGTYPMMWDSLLK-LRALPDDFKLYCGH------------------
GLO2_BAUCH      --SYPWLFCGDTVFSAGCGR--------------------------------------------------
GLO2_ANASP      FPPQGELFCGDTLFAGGCGR--------------------------------------------------
GLO2_PSEE4      TAQSPTPLLGDTLFAAGCGR--LFEGTPEQMHHSL-QRLAALPEQTQVYCAH------------------
GLO2_ANAVT      FPPQTALFCGDTLFAGGCGR--------------------------------------------------
LACB2_DANRE     LEEEQAVFSGDCI----LGEGTAVFEDLHDYMKSLQKLLSIKADLI--YPGHGPV---------------
GLO2_PROM9      NGESPVLFIGDTLFSGGCGR--IFEGTYQQMYSSLER---------------------------------
GLO2_AERHH      --GHGMLFCGDTLFSAGCGRL---FEGTPAQMHASLQRLAALPDDTLIYCAH------------------
GLO2_JANSC      FPAATAVFTADSLMALGCGR--------------------------------------------------
GLO2_HAEIN      -VDNHL-FCGDALFSAGCGRVF--TGNY-ALMFEGLQRLNTLPDETIVCPAH------------------
GLO2_EDWI9      --SAPYLFCGDTLFSAGCGR--------------------------------------------------
LACB2_BOVIN     LEEENALFSGDILGEGTTVFEDL----YDYM--NSLKELLKIKAKVIY-PGHGPV---------------
GLO2_RHIEC      FVDDKLLFAADTLFALGCGRL-FERPAAD-MWHSLQK-LAVLPDETAVYFGH------------------
LACB2_MOUSE     LEEENAIFSGDILGEGTTIFEDL--YDYMNSLNNLLKIKANI-----IYPGHGPV---------------
GLO2_RALEJ      PGVGPVVFCGDTLFATGCGR--------------------------------------------------
GLO2_METCA      FEDDAALFCGDTLFALGCGR--------------------------------------------------
GLO2_CHICK      SSEPPAVFTGDTLFVAGCGK--FFEGTPEEMYRALIEILGSLDPETRVYCGH------------------
GLO2_BLOFL      Y--KSWLFSGDTIFSAGCGQTGYTQAMYKSLL--------------------------------------
GLO2_PROM0      NGENPVLFIGDTLFSGGCGR--IFEGTYQQMYSSLER---------------------------------
BLA1_STEMA      ----------------------------------------------------------------------
GLO2_HAEPS      VDNEYL-FCGDALFSGGCGRVF--TGDYQAQFDAL-QRFKALPDFVKVYAGH------------------
GLO2_PROMM      LPEDPAVFCGDTLFGAGCGR--------------------------------------------------
GLO2_HAEDU      FAQQYL-FCGDALFSAGCGRVF--TGDYQAQFNTL-QRFKTLPESTLVFPAH------------------
GLO2_BART1      FPEKKLLFAGDTLFSLGCGR--LFEGTAVQMLNSL-KKLCKLPDETLLYCGH------------------
GLO2_PROMS      NGENPVLFIGDTLFSGGCGR--IFEGTYQQMYSSLER---------------------------------
GLO2_ACTSZ      --TDGCLFCGDTLFSAGCGRVF--TGNYGQMYDSV-QRLKTLPDDTLVCPAH------------------
Y888_METJA      YENS--LITGDTIFAYGVGRWDLPTGDVIQLRNSINERIANERNIDKLYPGHG-----------------
GLO2_SYNSC      LPNPKLLFCGDTLFSGGCGR--------------------------------------------------
GLO2_RHOS5      FADSGLAFTGDSLMAMGCGR--------------------------------------------------
RNZ_BRAJA       ----------------------------------------------------------------------
GLO2_PROMA      LQGSKESKIDPVLFCG------------------------------------------------------
GLO2_LEGPH      EPQQGWLFCGDTLFSAGCGRV------FDGTIEELHESL-------------------------------
GLO2_LEGPC      EPQKGWLFCGDTLFSAGCGRV------FDGTIEELHESL-------------------------------
GLO2_RHOP5      FDDDKAVFAGDTLFSIGCGRVF--EGTYPMMWDSLLK-LRVLPDDMRLYCGH------------------
Y4333_HERA2     ----------------------------------------------------------------------
Y1060_STAS1     ----------------------------------------------------------------------
GLO2_LEGPL      EPQQGWLFCGDTLFSAGCGRV------FDGTIEELHESL-------------------------------
GLO2_ROSDO      CADAKAVFTADSLMALGCGR--LFEGTADQMWDSLSK-LAALPSETQVYSGH------------------
GLO2_NEIG2      LETSDHVFCGDTLFSAGCGRVF--TGTVEQLYDSF-QRFNQLPEGTLFYPAH------------------
GLO2_LEGPA      EPQQGWLFCGDTLFSAGCGRV------FDGTIEELHESL-------------------------------
Y1118_PICTO     ----------------------------------------------------------------------
LACB2_CAEEL     LQEERALFSGDILGEGTTVFEDL--HDYMTSLQKIKDL-----NATRIYPGHGPV---------------
GLO2_PROMT      NAKCNILFPGDTLFGGGCGR--------------------------------------------------
GLO2_PROM1      NAKCNILFPGDTLFGGGCGR--------------------------------------------------
RNZ_BRASO       ----------------------------------------------------------------------
GLO2_SYNPX      IPEQEVVFCGDTLFSGGCGR--------------------------------------------------
Y3294_BACCN     ----------------------------------------------------------------------
GLO2_SHEON      --VDGALFCGDTLFSGGCGR--LFEGTPAQMCHSLR----------------------------------
GLO2_NEIG1      LETSDHVFCGDTLFSAGCGRVF--TGTVEQLYDNF-QRFNQLPEGTLFYPAH------------------
YOBT_BACSU      DTRNGTLIAGD-----------------------------------------------------------
GLO2_SYNS9      GP---LAFCGDTLFAGGCGR--------------------------------------------------
GLO2_NEIMF      LETSDHVFCGDTLFSAGCGRVF--TGTIEQLYDSF-QRFNRLPENTLFYPAH------------------
GLO2_NEIMB      LETSDHVFCGDTLFSAGCGRVF--TGTIEQLYDSF-QRFNRLPENTLFYPAH------------------
GLO2_NEIMA      LETSDHVFCGDTLFSAGCGRVF--TGTIEQLYDSF-QRFNRLPENTLFYPAH------------------
GLO2_NEIM0      LETSDHVFCGDTLFSAGCGRVF--TGTIEQLYDSF-QRFNRLPENTLFYPAH------------------
Y4741_BACC7     ----------------------------------------------------------------------
Y1382_STAES     ----------------------------------------------------------------------
Y1270_STAEQ     ----------------------------------------------------------------------
GLO2_THIDA      -GNGHL-FCGDTLFGCGCGK--------------------------------------------------
GLO2_SHEDO      IEDA--IFCGDTLFSVGCGR--------------------------------------------------
Y3178_BACHD     ----------------------------------------------------------------------
Y1373_MACCJ     ----------------------------------------------------------------------
Y1218_STAHJ     ----------------------------------------------------------------------
GLO2_SYNPW      LPEGPALFCGDTLFSGGCGR--------------------------------------------------
Y515_BACC2      ----------------------------------------------------------------------
Y4892_BACAC     ----------------------------------------------------------------------
Y4871_BACAA     ----------------------------------------------------------------------
Y4860_BACAN     ----------------------------------------------------------------------
Y4747_BACC1     ----------------------------------------------------------------------
Y4729_BACC0     ----------------------------------------------------------------------
Y4725_BACC3     ----------------------------------------------------------------------
Y4722_BACC4     ----------------------------------------------------------------------
Y4418_BACCQ     ----------------------------------------------------------------------
Y4343_BACHK     ----------------------------------------------------------------------
Y4194_BACAH     ----------------------------------------------------------------------
Y2750_GEOKA     ----------------------------------------------------------------------
Y2675_GEOTN     ----------------------------------------------------------------------
Y4613_BACCR     ----------------------------------------------------------------------
Y1312_STACT     ----------------------------------------------------------------------
Y1163_METJA     ----------------------------------------------------------------------
Y1162_THEMA     ----------------------------------------------------------------------
RNJ1_BACSU      ----------------------------------------------------------------------
GLO2_YEAST      TTDERCIFTGDTLFTAGCGR--------------------------------------------------
Y574_PARDP      ----------------------------------------------------------------------
Y5695_RALME     ----------------------------------------------------------------------
Y4324_POLSJ     ----------------------------------------------------------------------
Y1920_SILST     ----------------------------------------------------------------------
Y1265_ARCFU     ----------------------------------------------------------------------
Y119_PYRAB      -GDKRVAHLGDTYYSPSFKNL---RGQVDILLVPIGGR--------------------------------
SYFB_BURPS      ----------------------------------------------------------------------
SYFB_BURP1      ----------------------------------------------------------------------
SYFB_BURMA      ----------------------------------------------------------------------
RNJ_METJA       ----------------------------------------------------------------------
RNJ2_BACSU      ----------------------------------------------------------------------
Y4354_BACCZ     ----------------------------------------------------------------------
Y4138_LYSSC     ----------------------------------------------------------------------
Y2976_SILPO     ----------------------------------------------------------------------
Y1785_STAAR     ----------------------------------------------------------------------
RNZ_KINRD       ----------------------------------------------------------------------
RNJ1_STAS1      ----------------------------------------------------------------------
RNJ1_STAHJ      ----------------------------------------------------------------------
RNJ1_STAAW      ----------------------------------------------------------------------
RNJ1_STAAS      ----------------------------------------------------------------------
RNJ1_STAAR      ----------------------------------------------------------------------
RNJ1_STAAN      ----------------------------------------------------------------------
RNJ1_STAAM      ----------------------------------------------------------------------
RNJ1_STAAC      ----------------------------------------------------------------------
RNJ1_STAAB      ----------------------------------------------------------------------
RNJ1_STAA8      ----------------------------------------------------------------------
RNJ1_STAA3      ----------------------------------------------------------------------
Y171_GEOLS      ----------------------------------------------------------------------
RNJ_MYCPN       ----------------------------------------------------------------------
RNJ1_STAES      ----------------------------------------------------------------------
RNJ1_STAEQ      ----------------------------------------------------------------------
GLO2_RHOCA      LPGAGLLFSGDSLMSWGCGREGTPAQMFDTL-----TRLAALPPETRVCSGH------------------
Y3437_ACIBL     ----------------------------------------------------------------------
Y2229_RHOS5     ----------------------------------------------------------------------
Y020_PYRFU      ----------------------------------------------------------------------
SYFB_BURTA      ----------------------------------------------------------------------
RNJ_MYCGE       ----------------------------------------------------------------------
LIPB_PORGI      ----------------------------------------------------------------------
GLO2_SYNS3      LPQGEISFCGDTLFSGGCGR--------------------------------------------------
GLO2_ANADE      EWEGRL-LTGDTLFWAGCGNCRH-GGDPARLAESFLGPIARLDGGLEVHPGH------------------
Y864_THEVO      ----------------------------------------------------------------------
Y488_ANOFW      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KI
YCBL_ECOLI      EM
Y1663_HAEIN     K-
Y2135_AQUAE     --
YQGX_BACSU      --
Y2612_MYCBO     --
Y2581_MYCTU     --
Y493_MYCLE      --
Y554_STRP6      --
ETHE1_BOVIN     --
ETHE1_HUMAN     --
ETHE1_MOUSE     --
GLO2_BDEBA      --
GLO2O_ARATH     --
GLO2_PSEMY      --
GLO2_RHORT      --
GLO2_HAHCH      --
GLO2_METFK      --
GLO2_HERAR      --
GLO2_THEEB      --
GLO2_MARMM      --
GLO2_DECAR      --
GLO2_NITOC      --
GLO2_KLEP3      --
GLO2_IDILO      --
GLO2_VIBPA      --
GLO2_VIBHB      --
GLO2_POLSJ      --
GLO2_KLEP7      --
BLH_XYLFA       --
GLO2_HYPNA      --
GLO2_PSYIN      --
GLO2_PSEU2      --
GLO2_HAMD5      --
GLO2_BUCAP      --
GLO2N_ARATH     --
GLO2_BRUSU      --
GLO2_BRUSI      --
GLO2_BRUO2      --
GLO2_BRUME      --
GLO2_BRUMB      --
GLO2_BRUC2      --
GLO2_BRUAB      --
GLO2_BRUA2      --
GLO2_BRUA1      --
GLO2_PSEPK      --
GLO2_PSEP1      --
GLO2_PSEF5      --
GLO2_PSE14      --
GLO2_PSESM      --
GLO2_PECCP      --
GLO2_MARMS      --
GLO2_FRAP2      --
GLO2_RHIME      --
GLO2_ECOL6      --
GLO2_PSEPW      --
GLO2_BUCAI      --
GLO2M_ARATH     --
GLO2_SHEPC      --
GLO2_ECOLU      --
YRKH_BACSU      QL
GLO2_TRIEI      --
GLO2_PSEAE      --
GLO2_PSEA8      --
GLO2_ESCF3      --
GLO2_ERYLH      --
GLO2_ECOSM      --
GLO2_ECO7I      --
GLO2_XANAC      --
GLO2_ERWCT      --
GLO2_ECOUT      --
GLO2_ECOL5      --
GLO2_ECOK1      --
GLO2_ECO81      --
GLO2_ECO45      --
GLO2_ECO27      --
GLO2_CHRSD      --
GLO2_YERE8      --
GLO2_VIBCM      --
GLO2_VIBCH      --
GLO2_VIBC3      --
GLO2_SHISS      --
GLO2_SHIFL      --
GLO2_SHIF8      --
GLO2_SHIDS      --
GLO2_SHIBS      --
GLO2_SHIB3      --
GLO2_RHOS4      --
GLO2_NITEC      --
GLO2_ENT38      --
GLO2_ECOSE      --
GLO2_ECOLI      --
GLO2_ECOLC      --
GLO2_ECOHS      --
GLO2_ECODH      --
GLO2_ECOBW      --
GLO2_ECO8A      --
GLO2_ECO5E      --
GLO2_ECO57      --
GLO2_ECO55      --
GLO2_ECO24      --
BLH_AGRT5       --
GLO2_XANC5      --
GLO2_RHOS1      --
GLO2_NOSP7      --
GLO2_NITEU      --
GLO2C_ARATH     --
YYBB_BACSU      --
BLH_XYLFT       --
GLO2_THICR      --
GLO2_PSEPG      --
GLO2_FRATN      --
GLO2_ALISL      --
GLO22_SCHPO     --
GLO2_YERPY      --
GLO2_YERPS      --
GLO2_YERPP      --
GLO2_YERPN      --
GLO2_YERPE      --
GLO2_YERPB      --
GLO2_YERPA      --
GLO2_YERP3      --
GLO2_SHESW      --
GLO2_SHELP      --
GLO2_FRATW      --
GLO2_FRATT      --
GLO2_FRATO      --
GLO2_FRATM      --
GLO2_FRATH      --
GLO2_FRATF      --
GLO2_FRAT1      --
GLO2_ERWT9      --
GLO2_ALHEH      --
GLO21_VIBVY     --
MBLC2_CHICK     --
GLO2_PELUB      --
GLO2_SALPK      --
GLO2_SALPA      --
GLO2_AGRT5      --
GLO2_RHOPA      --
GLO2_RHILO      --
GLO2_AERS4      --
GLO2_ACAM1      --
GLO2_SALPC      --
GLO2_ACTPJ      --
GLO2_ACTP7      --
GLO2_VIBF1      --
GLO2_SYNP2      --
GLO2_SODGM      --
GLO2_SALTI      --
GLO2_SALSV      --
GLO2_SALPB      --
GLO2_SALNS      --
GLO2_SALHS      --
GLO2_SALEP      --
GLO2_SALDC      --
GLO2_SALCH      --
GLO2_SALA4      --
GLO2_OCHA4      --
GLOB2_DICDI     SV
GLO2_VIBFM      --
GLO2_SYNY3      --
GLO2_SALG2      --
GLO2_PSEA7      --
GLO2_MICAN      --
GLO2_METS4      --
GLO2_VIBSL      --
GLO2_SILPO      --
GLO2_GLOVI      --
GLO2_BRASO      --
PNKD_BOVIN      --
GLO2_SHEB8      --
GLO2_NITWN      --
GLO2_METNO      --
GLO2_CITK8      --
GLO2_ACTP2      --
GLO2_SHEAM      --
GLO2_PSEPF      --
GLO2_XYLFA      --
GLO2_XANOM      --
GLO2_SALTY      --
GLO2_RALME      --
GLO2_CYAP8      --
GLO2_BARQU      --
PNKD_MOUSE      --
GLO2_XYLFT      --
GLO2_XYLFM      --
GLO2_XYLF2      --
GLO2_SYNJA      --
GLO2_RHOPB      --
GLO2_RHOP2      --
GLO2_MESSB      --
GLO2_BARHE      --
LACB2_XENLA     --
GLO2_SHEB9      --
GLO2_SALAR      --
MBLC2_MOUSE     --
GLO2_MARAV      --
GLO2_CYAP7      --
MBLC2_HUMAN     --
MBLC2_BOVIN     --
GLO2_XANCP      --
GLO2_XANCB      --
GLO2_XANC8      --
GLO2_SYNP6      --
GLO2_SYNJB      --
GLO2_SYNE7      --
GLO2_SHEB5      --
GLO2_SHEB2      --
GLO2_PSEHT      --
GLO21_SCHPO     --
PNKD_HUMAN      --
GLO2_SHESA      --
GLO2_NITHX      --
GLO2_CYAP4      --
GLO2_CYAA5      --
GLO2_CUPTR      --
GLO2_TOLAT      --
GLO2_SERP5      --
GLO2_DANRE      --
LACB2_XENTR     --
HAGHL_MOUSE     --
GLO2_VIBVU      --
GLO2_SACD2      --
GLO2_RHOFD      --
GLO2_PHOLL      --
GLO22_VIBVY     --
LACB2_HUMAN     --
GLO2_STRM5      --
GLO2_MANSM      --
LACB2_RAT       --
GLO2_PSEFS      --
GLO2_HALHL      --
GLO2_WIGBR      --
GLO2_RHOBL      --
GLO2_RHIL3      --
GLO2_LEPBL      --
GLO2_LEPBJ      --
GLO2_BRAJA      --
GLO2_BAUCH      --
GLO2_ANASP      --
GLO2_PSEE4      --
GLO2_ANAVT      --
LACB2_DANRE     --
GLO2_PROM9      --
GLO2_AERHH      --
GLO2_JANSC      --
GLO2_HAEIN      --
GLO2_EDWI9      --
LACB2_BOVIN     --
GLO2_RHIEC      --
LACB2_MOUSE     --
GLO2_RALEJ      --
GLO2_METCA      --
GLO2_CHICK      --
GLO2_BLOFL      --
GLO2_PROM0      --
BLA1_STEMA      --
GLO2_HAEPS      --
GLO2_PROMM      --
GLO2_HAEDU      --
GLO2_BART1      --
GLO2_PROMS      --
GLO2_ACTSZ      --
Y888_METJA      --
GLO2_SYNSC      --
GLO2_RHOS5      --
RNZ_BRAJA       --
GLO2_PROMA      --
GLO2_LEGPH      --
GLO2_LEGPC      --
GLO2_RHOP5      --
Y4333_HERA2     --
Y1060_STAS1     --
GLO2_LEGPL      --
GLO2_ROSDO      --
GLO2_NEIG2      --
GLO2_LEGPA      --
Y1118_PICTO     --
LACB2_CAEEL     --
GLO2_PROMT      --
GLO2_PROM1      --
RNZ_BRASO       --
GLO2_SYNPX      --
Y3294_BACCN     --
GLO2_SHEON      --
GLO2_NEIG1      --
YOBT_BACSU      --
GLO2_SYNS9      --
GLO2_NEIMF      --
GLO2_NEIMB      --
GLO2_NEIMA      --
GLO2_NEIM0      --
Y4741_BACC7     --
Y1382_STAES     --
Y1270_STAEQ     --
GLO2_THIDA      --
GLO2_SHEDO      --
Y3178_BACHD     --
Y1373_MACCJ     --
Y1218_STAHJ     --
GLO2_SYNPW      --
Y515_BACC2      --
Y4892_BACAC     --
Y4871_BACAA     --
Y4860_BACAN     --
Y4747_BACC1     --
Y4729_BACC0     --
Y4725_BACC3     --
Y4722_BACC4     --
Y4418_BACCQ     --
Y4343_BACHK     --
Y4194_BACAH     --
Y2750_GEOKA     --
Y2675_GEOTN     --
Y4613_BACCR     --
Y1312_STACT     --
Y1163_METJA     --
Y1162_THEMA     --
RNJ1_BACSU      --
GLO2_YEAST      --
Y574_PARDP      --
Y5695_RALME     --
Y4324_POLSJ     --
Y1920_SILST     --
Y1265_ARCFU     --
Y119_PYRAB      --
SYFB_BURPS      --
SYFB_BURP1      --
SYFB_BURMA      --
RNJ_METJA       --
RNJ2_BACSU      --
Y4354_BACCZ     --
Y4138_LYSSC     --
Y2976_SILPO     --
Y1785_STAAR     --
RNZ_KINRD       --
RNJ1_STAS1      --
RNJ1_STAHJ      --
RNJ1_STAAW      --
RNJ1_STAAS      --
RNJ1_STAAR      --
RNJ1_STAAN      --
RNJ1_STAAM      --
RNJ1_STAAC      --
RNJ1_STAAB      --
RNJ1_STAA8      --
RNJ1_STAA3      --
Y171_GEOLS      --
RNJ_MYCPN       --
RNJ1_STAES      --
RNJ1_STAEQ      --
GLO2_RHOCA      --
Y3437_ACIBL     --
Y2229_RHOS5     --
Y020_PYRFU      --
SYFB_BURTA      --
RNJ_MYCGE       --
LIPB_PORGI      --
GLO2_SYNS3      --
GLO2_ANADE      --
Y864_THEVO      --
Y488_ANOFW      --