[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58208.1

[Show Plain Result]


## Summary of Sequence Search
    1::728
  151::256     1e-11  33%  429 aa  CAT2_CLOK5 RecName: Full=4-hydroxybutyrate coenzyme A transferase; 
  396::513     2e-07  32%  538 aa  CAT1_CLOK5 RecName: Full=Succinyl-CoA:coenzyme A transferase;      
    1::728

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CAT2_CLOK5      ----------------------------------------------------------------------
CAT1_CLOK5      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CAT2_CLOK5      ----------------------------------------------------------------------
CAT1_CLOK5      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILGQINPELPFMYGD
CAT2_CLOK5      -------------------------------------------------------VIAEVNKNMPRTLGD
CAT1_CLOK5      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AQVPSENFDAIVDHPQYAFKLFGPPNMAINPSDYMIGLHASALIKDGGTIQLGIGSLSDAVTYLIKMRHQ
CAT2_CLOK5      SFIHVSDIDYIVEHPLLELQ---PPKLG--DVEKAIGENCASLIEDGATLQLGIGAIPDAVLLFLKN---
CAT1_CLOK5      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YNAVYCALLSEANVLGKFEKMIHNVGGNEPFKEGLYATSEMFVDGFMQLYRSGILKRKxxxxxxxxxxxx
CAT2_CLOK5      -------------------------------KKNLGIHSEMISDGVMELVKAGVINNK------------
CAT1_CLOK5      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CAT2_CLOK5      ----------------------------------------------------------------------
CAT1_CLOK5      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxSFFLGPQRFYNFLRGLKKEEREQFCMKRVAYVNQLYGSEELKRLQRKDARF
CAT2_CLOK5      -------------------TFLMGTKKLYDFVNNNPMVETYS-----VDYVNN-----PLVIMKNDNMVS
CAT1_CLOK5      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LNSALMVTLNGAIISDKLEDGRTVSGVGGQYNFVAMAHALVDARSIIMLRSVREKHGEIHSNIIWNYGHT
CAT2_CLOK5      INSCVQVDLMGQVCSESI-GLKQISGVGGQVDFIRGANLSKGGKAIIAIPSTAGKGKVSRITPLLDTGAA
CAT1_CLOK5      INTALEVDIYGNVNSTHVMGSKMMNGIGGSGDFARNAYL-----TIFTTESIAKK-GDI-SSIVPMVSHV


                         .         .         .         *         .         .         .:630
query           TIPCHLRDMVVTEYGIANLRGKNDREIIIALLNITDSRFQDFLLREAQKAGKISxxxxxxxxxxxxxxxx
CAT2_CLOK5      TTSRNEVDYVVTEYGVAHLKGKTLRNRARALINIAHPKFRESLMNEFKK---------------------
CAT1_CLOK5      DHTEHDVMVIVTEQGVADLRGLSPREKAVAIINCVHPDYKDMLMEYFEEACKSS----------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CAT2_CLOK5      ----------------------------------------------------------------------
CAT1_CLOK5      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
CAT2_CLOK5      ----------------------------
CAT1_CLOK5      ----------------------------