[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58418.1

[Show Plain Result]


## Summary of Sequence Search
    1::538
    9::507     4e-54  30%  513 aa  LCFB_BACSU RecName: Full=Long-chain-fatty-acid--CoA ligase;        
 1508::1991    4e-44  32% 4451 aa  GRSB_ANEMI RecName: Full=Gramicidin S synthetase 2;AltName:
 1506::1990    7e-44  30% 3583 aa  SRFAB_BACSU RecName: Full=Surfactin synthetase subunit 2;
 3046::3530    1e-43  28% 5085 aa  LGRD_BREPA RecName: Full=Linear gramicidin synthetase subunit
 5644::6125    2e-43  30% 7756 aa  LGRC_BREPA RecName: Full=Linear gramicidin synthetase subunit
 1508::1991    2e-43  31% 4450 aa  GRSB_BREBE RecName: Full=Gramicidin S synthetase 2;AltName:
 2999::3483    2e-43  29% 6359 aa  BACC_BACLI RecName: Full=Bacitracin synthetase 3;       
 1219::1709    2e-42  29% 2273 aa  LGRA_BREPA RecName: Full=Linear gramicidin synthetase subunit
   77::552     3e-41  30%  561 aa  LCFA_SALTY RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   77::552     3e-41  30%  561 aa  LCFA_SALTI RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   77::552     4e-41  30%  561 aa  LCFA_ECO57 RecName: Full=Long-chain-fatty-acid--CoA ligase;        
  468::948     9e-41  32% 2378 aa  DHBF_BACSU RecName: Full=Dimodular nonribosomal peptide synthetase;
   77::552     2e-40  30%  561 aa  LCFA_ECOLI RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   77::552     2e-40  30%  561 aa  LCFA_ECOL6 RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   23::544     2e-40  28%  560 aa  LCFA_BACSU RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   33::552     2e-40  30%  562 aa  LCFA_YERPE RecName: Full=Long-chain-fatty-acid--CoA ligase;        
 3577::4060    5e-40  32% 6486 aa  TYCC_BREPA RecName: Full=Tyrocidine synthetase 3;AltName:
 2538::3025    6e-40  31% 3587 aa  TYCB_BREPA RecName: Full=Tyrocidine synthetase 2;AltName:
  263::772     4e-39  30% 2609 aa  MYCC_BACSU RecName: Full=Mycosubtilin synthetase subunit C;        
 2535::3019    5e-39  28% 3603 aa  PPSD_BACSU RecName: Full=Plipastatin synthetase subunit D;       
 2127::2601    7e-39  28% 5255 aa  BACA_BACLI RecName: Full=Bacitracin synthetase 1;       
  453::950     1e-38  26% 5162 aa  LGRB_BREPA RecName: Full=Linear gramicidin synthetase subunit
 1513::1995    1e-37  28% 3587 aa  SRFAA_BACSU RecName: Full=Surfactin synthetase subunit 1;
   41::523     2e-35  29% 1098 aa  GRSA_BREBE RecName: Full=Gramicidin S synthetase 1;AltName:
   41::523     6e-35  29% 1098 aa  GRSA_ANEMI RecName: Full=Gramicidin S synthetase 1;AltName:
   11::501     2e-34  26%  504 aa  DLTA_BACCN RecName: Full=D-alanine--poly(phosphoribitol) ligase
  466::953     2e-34  29% 2555 aa  PPSC_BACSU RecName: Full=Plipastatin synthetase subunit C;       
 2954::3427    2e-34  27% 3971 aa  MYCA_BACSU RecName: Full=Mycosubtilin synthetase subunit A;       
   68::610     2e-34  28%  615 aa  ACSF2_MOUSE RecName: Full=Acyl-CoA synthetase family member 2,
  115::544     4e-34  29%  552 aa  4CLL4_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 4;       
  460::947     5e-34  30% 2561 aa  PPSA_BACSU RecName: Full=Plipastatin synthetase subunit A;       
  205::554     5e-34  30%  566 aa  4CLL6_ARATH RecName: Full=4-coumarate--CoA ligase-like 6;       
   68::610     6e-34  26%  615 aa  ACSF2_RAT RecName: Full=Acyl-CoA synthetase family member 2,
   68::610     6e-34  26%  615 aa  ACSF2_HUMAN RecName: Full=Acyl-CoA synthetase family member 2,
   29::512     8e-34  26% 1088 aa  TYCA_BREPA RecName: Full=Tyrocidine synthetase 1;AltName:
   37::554     1e-33  26%  562 aa  LCFA_HAEIN RecName: Full=Long-chain-fatty-acid--CoA ligase;        
  546::1036    7e-33  28% 1167 aa  MBTB_MYCSS RecName: Full=Phenyloxazoline synthase mbtB;       
  454::948     7e-33  29% 1048 aa  ANGR_VIBAN RecName: Full=Protein angR;
   32::537     7e-33  27%  547 aa  4CL1_TOBAC RecName: Full=4-coumarate--CoA ligase 1;       
   30::535     9e-33  26%  545 aa  4CL2_SOLTU RecName: Full=4-coumarate--CoA ligase 2;       
   38::528     1e-32  28%  548 aa  FADK_ECOLI RecName: Full=Short-chain-fatty-acid--CoA ligase;       
   11::501     1e-32  25%  504 aa  DLTA_BACHK RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::501     1e-32  25%  504 aa  DLTA_BACCZ RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::501     1e-32  25%  504 aa  DLTA_BACC3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::501     1e-32  25%  504 aa  DLTA_BACC0 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::501     1e-32  25%  504 aa  DLTA_BACAH RecName: Full=D-alanine--poly(phosphoribitol) ligase
  318::834     1e-32  26% 3791 aa  ACVS2_PENCH RecName:
  288::804     1e-32  26% 3746 aa  ACVS1_PENCH RecName:
  468::952     2e-32  27% 2560 aa  PPSB_BACSU RecName: Full=Plipastatin synthetase subunit B;       
   11::500     2e-32  25%  503 aa  DLTA_BACAN RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::500     2e-32  25%  503 aa  DLTA_BACAC RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::500     2e-32  25%  503 aa  DLTA_BACAA RecName: Full=D-alanine--poly(phosphoribitol) ligase
  262::774     2e-32  26% 3712 aa  ACVS_CEPAC RecName:
   30::535     2e-32  26%  545 aa  4CL1_SOLTU RecName: Full=4-coumarate--CoA ligase 1;       
   26::539     3e-32  25%  544 aa  4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7;       
   36::516     3e-32  28%  517 aa  CAIC_SALAR RecName: Full=Probable crotonobetaine/carnitine-CoA
   11::501     5e-32  24%  504 aa  DLTA_BACC2 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::501     8e-32  24%  504 aa  DLTA_BACCR RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::501     8e-32  24%  504 aa  DLTA_BACC4 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::613     8e-32  25%  618 aa  ACSF2_MACFA RecName: Full=Acyl-CoA synthetase family member 2,
  334::831     1e-31  26% 3770 aa  ACVS_EMENI RecName:
   11::501     1e-31  24%  504 aa  DLTA_BACCQ RecName: Full=D-alanine--poly(phosphoribitol) ligase
   11::501     1e-31  24%  504 aa  DLTA_BACC1 RecName: Full=D-alanine--poly(phosphoribitol) ligase
 1157::1656    2e-31  27% 5043 aa  PKSJ_BACSU RecName: Full=Polyketide synthase pksJ;         Short=PKS;
  475::960     2e-31  28% 1279 aa  PPSE_BACSU RecName: Full=Plipastatin synthetase subunit E;       
  204::550     3e-31  32%  562 aa  4CLL9_ARATH RecName: Full=4-coumarate--CoA ligase-like 9;       
  519::1001    4e-31  28% 2607 aa  BACB_BACLI RecName: Full=Bacitracin synthetase 2;       
   11::501     5e-31  24%  504 aa  DLTA_BACC7 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   39::517     5e-31  28%  518 aa  CAIC_PROSL RecName: Full=Probable crotonobetaine/carnitine-CoA
   15::499     7e-31  25%  502 aa  DLTA_BACLD RecName: Full=D-alanine--poly(phosphoribitol) ligase
   68::610     7e-31  25%  615 aa  ACSF2_PONAB RecName: Full=Acyl-CoA synthetase family member 2,
   38::546     7e-31  27%  556 aa  4CL2_ARATH RecName: Full=4-coumarate--CoA ligase 2;       
  259::754     1e-30  30% 5369 aa  MYCB_BACSU RecName: Full=Mycosubtilin synthetase subunit B;        
   11::501     1e-30  25%  504 aa  DLTA_BACWK RecName: Full=D-alanine--poly(phosphoribitol) ligase
    9::486     1e-30  29%  486 aa  MENE_BACSU RecName: Full=2-succinylbenzoate--CoA ligase;       
   15::500     7e-30  26%  503 aa  DLTA_BACA2 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  478::954     9e-30  26% 1275 aa  SRFAC_BACSU RecName: Full=Surfactin synthetase subunit 3;
  100::539     1e-29  26%  545 aa  LUCI_PHOPE RecName: Full=Luciferin 4-monooxygenase;       
   14::516     1e-29  27%  517 aa  CAIC_SALSV RecName: Full=Probable crotonobetaine/carnitine-CoA
   39::517     1e-29  28%  518 aa  CAIC_PROMH RecName: Full=Probable crotonobetaine/carnitine-CoA
  143::479     2e-29  31%  490 aa  MENE_GEOKA RecName: Full=2-succinylbenzoate--CoA ligase;       
   39::516     2e-29  26%  517 aa  CAIC_SALTI RecName: Full=Probable crotonobetaine/carnitine-CoA
   14::516     2e-29  27%  517 aa  CAIC_SALPB RecName: Full=Probable crotonobetaine/carnitine-CoA
   14::516     2e-29  27%  517 aa  CAIC_SALDC RecName: Full=Probable crotonobetaine/carnitine-CoA
   14::516     2e-29  27%  517 aa  CAIC_SALNS RecName: Full=Probable crotonobetaine/carnitine-CoA
   14::516     2e-29  27%  517 aa  CAIC_SALCH RecName: Full=Probable crotonobetaine/carnitine-CoA
   14::516     2e-29  27%  517 aa  CAIC_SALA4 RecName: Full=Probable crotonobetaine/carnitine-CoA
   67::610     2e-29  24%  615 aa  ACSF2_BOVIN RecName: Full=Acyl-CoA synthetase family member 2,
   28::533     2e-29  25%  544 aa  4CL1_PETCR RecName: Full=4-coumarate--CoA ligase 1;       
  149::504     3e-29  33%  508 aa  DLTA_LACPL RecName: Full=D-alanine--poly(phosphoribitol) ligase
   14::516     3e-29  27%  517 aa  CAIC_SALPK RecName: Full=Probable crotonobetaine/carnitine-CoA
   14::516     3e-29  27%  517 aa  CAIC_SALPC RecName: Full=Probable crotonobetaine/carnitine-CoA
   14::516     3e-29  27%  517 aa  CAIC_SALPA RecName: Full=Probable crotonobetaine/carnitine-CoA
   34::536     3e-29  24%  546 aa  4CLL5_ARATH RecName: Full=4-coumarate--CoA ligase-like 5;       
   28::533     4e-29  25%  544 aa  4CL2_PETCR RecName: Full=4-coumarate--CoA ligase 1;       
  139::503     5e-29  32%  506 aa  DLTA_LACCB RecName: Full=D-alanine--poly(phosphoribitol) ligase
  139::503     5e-29  32%  506 aa  DLTA_LACC3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   39::516     5e-29  28%  517 aa  CAIC_CITK8 RecName: Full=Probable crotonobetaine/carnitine-CoA
   17::478     8e-29  28%  478 aa  MENE_BACLD RecName: Full=2-succinylbenzoate--CoA ligase;       
 1819::2351    8e-29  28% 5218 aa  HTS1_COCCA RecName: Full=HC-toxin synthetase;         Short=HTS;     
  148::507     8e-29  32%  510 aa  DLTA_LISMC RecName: Full=D-alanine--poly(phosphoribitol) ligase
   14::516     8e-29  26%  517 aa  CAIC_SALTY RecName: Full=Probable crotonobetaine/carnitine-CoA
   14::516     8e-29  26%  517 aa  CAIC_SALHS RecName: Full=Probable crotonobetaine/carnitine-CoA
  114::507     1e-28  30%  510 aa  DLTA_LISIN RecName: Full=D-alanine--poly(phosphoribitol) ligase
  114::507     1e-28  32%  510 aa  DLTA_LISW6 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   14::516     2e-28  26%  517 aa  CAIC_SALEP RecName: Full=Probable crotonobetaine/carnitine-CoA
  148::507     2e-28  31%  510 aa  DLTA_LISMH RecName: Full=D-alanine--poly(phosphoribitol) ligase
  148::507     2e-28  32%  510 aa  DLTA_LISMF RecName: Full=D-alanine--poly(phosphoribitol) ligase
  139::503     3e-28  31%  506 aa  DLTA_LACRH RecName: Full=D-alanine--poly(phosphoribitol) ligase
   65::533     4e-28  26%  543 aa  FAT2_YEAST RecName: Full=Peroxisomal-coenzyme A synthetase;        
  148::507     4e-28  31%  510 aa  DLTA_LISMO RecName: Full=D-alanine--poly(phosphoribitol) ligase
  103::521     4e-28  31%  527 aa  BCLA_THAAR RecName: Full=Benzoate--CoA ligase;       
  468::978     5e-28  27% 5488 aa  PKSN_BACSU RecName: Full=Polyketide synthase pksN;       
   15::500     7e-28  28%  503 aa  DLTA_BACSU RecName: Full=D-alanine--poly(phosphoribitol) ligase
   65::516     7e-28  30%  517 aa  CAIC_ECO27 RecName: Full=Probable crotonobetaine/carnitine-CoA
   28::539     7e-28  25%  553 aa  4CL_VANPL RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
    8::476     9e-28  28%  486 aa  MENE_BACP2 RecName: Full=2-succinylbenzoate--CoA ligase;       
  136::461     1e-27  27%  467 aa  MENE_LISMO RecName: Full=2-succinylbenzoate--CoA ligase;       
  136::461     1e-27  33%  467 aa  MENE_LISIN RecName: Full=2-succinylbenzoate--CoA ligase;       
   71::508     2e-27  29%  512 aa  DLTA_STRPZ RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::508     2e-27  29%  512 aa  DLTA_STRPM RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::508     2e-27  29%  512 aa  DLTA_STRPG RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::508     2e-27  29%  512 aa  DLTA_STRPF RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::508     2e-27  29%  512 aa  DLTA_STRPD RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::508     2e-27  29%  512 aa  DLTA_STRP8 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   65::516     2e-27  30%  517 aa  CAIC_ECOLU RecName: Full=Probable crotonobetaine/carnitine-CoA
  221::571     2e-27  28%  591 aa  4CLL3_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 3;       
   71::508     2e-27  29%  512 aa  DLTA_STRPC RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::508     2e-27  29%  512 aa  DLTA_STRP6 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::508     2e-27  29%  512 aa  DLTA_STRP3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   71::508     2e-27  29%  512 aa  DLTA_STRP1 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  146::478     3e-27  33%  487 aa  MENE_BACA2 RecName: Full=2-succinylbenzoate--CoA ligase;       
   65::516     3e-27  30%  517 aa  CAIC_SHISS RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     3e-27  30%  517 aa  CAIC_ECO5E RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     3e-27  30%  517 aa  CAIC_ECO57 RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     3e-27  30%  517 aa  CAIC_ECO45 RecName: Full=Probable crotonobetaine/carnitine-CoA
  252::758     3e-27  27% 3649 aa  ACVS_NOCLA RecName:
  144::480     4e-27  29%  492 aa  MENE_GEOSW RecName: Full=2-succinylbenzoate--CoA ligase;       
   65::516     4e-27  30%  517 aa  CAIC_ECOSM RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     4e-27  28%  517 aa  CAIC_ECOSE RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     4e-27  30%  517 aa  CAIC_ECO55 RecName: Full=Probable crotonobetaine/carnitine-CoA
   27::532     4e-27  25%  542 aa  4CL2_TOBAC RecName: Full=4-coumarate--CoA ligase 2;       
  136::461     6e-27  29%  467 aa  MENE_LISMF RecName: Full=2-succinylbenzoate--CoA ligase;       
   65::516     6e-27  30%  517 aa  CAIC_ECOUT RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     6e-27  30%  517 aa  CAIC_ECOK1 RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     6e-27  30%  517 aa  CAIC_ECO8A RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::468     8e-27  26%  481 aa  MENE_BACC7 RecName: Full=2-succinylbenzoate--CoA ligase;       
   65::516     8e-27  30%  517 aa  CAIC_ECOHS RecName: Full=Probable crotonobetaine/carnitine-CoA
  119::571     1e-26  30%  578 aa  ACSM5_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM5,
   65::516     1e-26  30%  517 aa  CAIC_ECO7I RecName: Full=Probable crotonobetaine/carnitine-CoA
  227::590     1e-26  30%  598 aa  4CLL6_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 6;       
  114::569     2e-26  28%  577 aa  ACSM1_BOVIN RecName: Full=Acyl-coenzyme A synthetase ACSM1,
   55::504     2e-26  24%  512 aa  FAT2_SCHPO RecName: Full=Putative peroxisomal-coenzyme A
   65::516     2e-26  28%  517 aa  CAIC_ESCF3 RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     2e-26  29%  517 aa  CAIC_ECO81 RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     2e-26  30%  517 aa  CAIC_ECO24 RecName: Full=Probable crotonobetaine/carnitine-CoA
  108::446     3e-26  30%  537 aa  4CL_PINTA RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
   65::516     5e-26  29%  517 aa  CAIC_SHIDS RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     6e-26  29%  517 aa  CAIC_ECOL6 RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     6e-26  29%  517 aa  CAIC_ECOL5 RecName: Full=Probable crotonobetaine/carnitine-CoA
  101::543     6e-26  25%  552 aa  4CLL1_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 1;       
   65::516     8e-26  29%  517 aa  CAIC_SHIFL RecName: Full=Probable crotonobetaine/carnitine-CoA
  200::474     1e-25  33%  583 aa  4CLL2_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 2;       
   65::516     1e-25  29%  517 aa  CAIC_ECOLC RecName: Full=Probable crotonobetaine/carnitine-CoA
  103::556     1e-25  27%  561 aa  4CL3_ARATH RecName: Full=4-coumarate--CoA ligase 3;       
    8::468     2e-25  26%  481 aa  MENE_BACC1 RecName: Full=2-succinylbenzoate--CoA ligase;       
  259::775     2e-25  27%  805 aa  ACVS_STRCL RecName:
  191::541     2e-25  30%  559 aa  4CL4_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 4;       
    9::469     3e-25  26%  482 aa  MENE_BACCR RecName: Full=2-succinylbenzoate--CoA ligase;       
  194::537     3e-25  31%  548 aa  LUCI_LUCCR RecName: Full=Luciferin 4-monooxygenase;       
  117::572     3e-25  25%  580 aa  ACSM3_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM3,
  194::557     3e-25  28%  565 aa  4CLL2_ARATH RecName: Full=4-coumarate--CoA ligase-like 2;       
  197::573     4e-25  31%  576 aa  ACSF3_HUMAN RecName: Full=Acyl-CoA synthetase family member 3,
    8::466     5e-25  25%  481 aa  MENE_BACWK RecName: Full=2-succinylbenzoate--CoA ligase;       
  149::508     7e-25  31%  511 aa  DLTA_STRA5 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  149::508     7e-25  30%  511 aa  DLTA_STRA3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  149::508     7e-25  31%  511 aa  DLTA_STRA1 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  126::596     7e-25  25%  606 aa  ACSF2_DANRE RecName: Full=Acyl-CoA synthetase family member 2,
   65::516     9e-25  28%  517 aa  CAIC_ECOLI RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     9e-25  28%  517 aa  CAIC_ECODH RecName: Full=Probable crotonobetaine/carnitine-CoA
   65::516     9e-25  28%  517 aa  CAIC_ECOBW RecName: Full=Probable crotonobetaine/carnitine-CoA
    9::469     1e-24  25%  482 aa  MENE_BACCZ RecName: Full=2-succinylbenzoate--CoA ligase;       
  448::960     1e-24  25% 1293 aa  ENTF_ECO57 RecName: Full=Enterobactin synthetase component F;      
   17::469     2e-24  25%  482 aa  MENE_BACAH RecName: Full=2-succinylbenzoate--CoA ligase;       
  189::541     2e-24  30%  550 aa  LUCI_PHOPY RecName: Full=Luciferin 4-monooxygenase;       
  204::552     2e-24  27%  558 aa  4CLL7_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 7;       
   28::515     2e-24  27%  523 aa  3HBCL_THAAR RecName:
   17::469     2e-24  25%  482 aa  MENE_BACHK RecName: Full=2-succinylbenzoate--CoA ligase;       
    8::468     2e-24  25%  481 aa  MENE_BACCQ RecName: Full=2-succinylbenzoate--CoA ligase;       
  145::469     2e-24  28%  482 aa  MENE_BACC0 RecName: Full=2-succinylbenzoate--CoA ligase;       
  686::1051    2e-24  28% 1165 aa  MBTB_MYCPA RecName: Full=Phenyloxazoline synthase mbtB;       
  149::508     2e-24  30%  512 aa  DLTA_STRE4 RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::496     3e-24  25%  503 aa  YDAB_BACSU RecName: Full=Putative acyl--CoA ligase ydaB;       
  149::512     3e-24  30%  516 aa  DLTA_STRMU RecName: Full=D-alanine--poly(phosphoribitol) ligase
  110::565     3e-24  27%  573 aa  ACSM1_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM1,
   28::543     3e-24  25%  551 aa  4CL3_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 3;       
    8::466     3e-24  26%  481 aa  MENE_BACCN RecName: Full=2-succinylbenzoate--CoA ligase;       
  119::571     3e-24  26%  578 aa  ACSM5_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM5,
   16::468     5e-24  25%  481 aa  MENE_BACAN RecName: Full=2-succinylbenzoate--CoA ligase;       
   17::469     5e-24  25%  482 aa  MENE_BACAC RecName: Full=2-succinylbenzoate--CoA ligase;       
   17::469     5e-24  25%  482 aa  MENE_BACAA RecName: Full=2-succinylbenzoate--CoA ligase;       
  106::537     8e-24  27%  548 aa  LUCI_LUCLA RecName: Full=Luciferin 4-monooxygenase;       
  701::1388    8e-24  35% 2035 aa  HMWP2_YERE8 RecName: Full=High-molecular-weight protein 2;       
  109::563     1e-23  27%  577 aa  ACS2B_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM2B,
   25::543     1e-23  24%  551 aa  4CL1_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 1;       
  102::624     2e-23  27%  646 aa  ACSA_PSEA6 RecName: Full=Acetyl-coenzyme A synthetase;       
   26::509     2e-23  25%  539 aa  4HBCL_RHOPA RecName: Full=4-hydroxybenzoate--CoA/benzoate--CoA
    6::480     2e-23  25%  485 aa  DLTA_STAHJ RecName: Full=D-alanine--poly(phosphoribitol) ligase
  117::572     2e-23  25%  580 aa  ACSM3_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM3,
  194::545     3e-23  29%  548 aa  LUCI_LUCMI RecName: Full=Luciferin 4-monooxygenase;       
  448::876     3e-23  25% 1293 aa  ENTF_ECOLI RecName: Full=Enterobactin synthetase component F;      
   94::533     3e-23  27%  546 aa  ALKK_PSEOL RecName: Full=Medium-chain-fatty-acid--CoA ligase;      
  452::880     4e-23  25% 1281 aa  ENTF_SHIFL RecName: Full=Enterobactin synthetase component F;      
   28::543     7e-23  24%  551 aa  4CL2_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 2;       
  110::623     9e-23  27%  653 aa  ACSA_PASMU RecName: Full=Acetyl-coenzyme A synthetase;       
   99::544     9e-23  25%  552 aa  4CLL3_ARATH RecName: Full=4-coumarate--CoA ligase-like 3;       
  135::480     1e-22  28%  485 aa  DLTA_STAAW RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     1e-22  28%  485 aa  DLTA_STAAT RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     1e-22  28%  485 aa  DLTA_STAAS RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     1e-22  28%  485 aa  DLTA_STAAE RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     1e-22  28%  485 aa  DLTA_STAAC RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     1e-22  28%  485 aa  DLTA_STAA8 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     1e-22  28%  485 aa  DLTA_STAA3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     1e-22  28%  485 aa  DLTA_STAAR RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::563     1e-22  25%  577 aa  ACS2A_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM2A,
  175::528     1e-22  33%  539 aa  4CL5_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 5;       
   93::553     1e-22  27%  561 aa  4CL1_ARATH RecName: Full=4-coumarate--CoA ligase 1;       
  146::478     2e-22  26%  480 aa  MENE_OCEIH RecName: Full=2-succinylbenzoate--CoA ligase;       
  135::480     2e-22  28%  485 aa  DLTA_STAAB RecName: Full=D-alanine--poly(phosphoribitol) ligase
  310::771     3e-22  25% 4114 aa  SID2_USTMA RecName: Full=Ferrichrome siderophore peptide
  692::1034    3e-22  28% 1414 aa  MBTB_MYCTU RecName: Full=Phenyloxazoline synthase mbtB;       
  692::1034    3e-22  28% 1414 aa  MBTB_MYCBO RecName: Full=Phenyloxazoline synthase mbtB;       
  120::572     3e-22  25%  579 aa  ACSM5_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM5,
  109::564     3e-22  25%  575 aa  ACSM2_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM2,
  115::542     3e-22  26%  550 aa  4CLL4_ARATH RecName: Full=4-coumarate--CoA ligase-like 4;       
  135::480     4e-22  28%  485 aa  DLTA_STAAU RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     4e-22  28%  485 aa  DLTA_STAAN RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     4e-22  28%  485 aa  DLTA_STAAM RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     4e-22  28%  485 aa  DLTA_STAA9 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     4e-22  28%  485 aa  DLTA_STAA2 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  135::480     4e-22  28%  485 aa  DLTA_STAA1 RecName: Full=D-alanine--poly(phosphoribitol) ligase
 2719::3233    7e-22  28% 4924 aa  SIB1_SCHPO RecName: Full=Hydroxamate-type ferrichrome siderophore
   10::477     7e-22  24%  485 aa  MENE_ENTFA RecName: Full=2-succinylbenzoate--CoA ligase;       
  123::578     7e-22  28%  586 aa  ACSM3_PONAB RecName: Full=Acyl-coenzyme A synthetase ACSM3,
  109::563     7e-22  25%  572 aa  ACSM2_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM2,
  200::542     7e-22  26%  550 aa  4CLL8_ARATH RecName: Full=4-coumarate--CoA ligase-like 8;       
  144::494     1e-21  29%  499 aa  DLTA_LACLA RecName: Full=D-alanine--poly(phosphoribitol) ligase
  197::567     1e-21  30%  583 aa  ACSF3_MOUSE RecName: Full=Acyl-CoA synthetase family member 3,
  123::578     1e-21  28%  586 aa  ACSM3_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM3,
  153::512     2e-21  30%  516 aa  DLTA_STRZT RecName: Full=D-alanine--poly(phosphoribitol) ligase
  153::512     2e-21  30%  516 aa  DLTA_STRPJ RecName: Full=D-alanine--poly(phosphoribitol) ligase
  153::512     2e-21  28%  516 aa  DLTA_STRP7 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  114::569     2e-21  27%  577 aa  ACSM1_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM1,
   82::621     2e-21  26%  654 aa  ACSA_GEMAT RecName: Full=Acetyl-coenzyme A synthetase;       
  212::562     2e-21  30%  569 aa  4CL2_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 2;       
  153::512     2e-21  30%  516 aa  DLTA_STRZP RecName: Full=D-alanine--poly(phosphoribitol) ligase
  153::512     2e-21  30%  516 aa  DLTA_STRR6 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  153::512     2e-21  30%  516 aa  DLTA_STRPN RecName: Full=D-alanine--poly(phosphoribitol) ligase
  153::512     2e-21  30%  516 aa  DLTA_STRP2 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  117::572     2e-21  28%  580 aa  ACSM4_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM4,
  117::572     2e-21  28%  580 aa  ACSM4_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM4,
  140::626     2e-21  26%  655 aa  ACSA_NITEU RecName: Full=Acetyl-coenzyme A synthetase;       
  103::611     3e-21  28%  644 aa  ACSA_RUBXD RecName: Full=Acetyl-coenzyme A synthetase;       
   99::631     3e-21  26%  672 aa  ACSA_PHYBL RecName: Full=Acetyl-coenzyme A synthetase;       
  136::480     4e-21  30%  485 aa  DLTA_STAES RecName: Full=D-alanine--poly(phosphoribitol) ligase
   99::575     4e-21  28%  578 aa  ACSF3_XENLA RecName: Full=Acyl-CoA synthetase family member 3,
  113::624     8e-21  25%  653 aa  ACSA_LARHH RecName: Full=Acetyl-coenzyme A synthetase;       
  187::531     8e-21  29%  554 aa  4CL3_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 3;       
   49::489     1e-20  25%  492 aa  MENE_STAAR RecName: Full=2-succinylbenzoate--CoA ligase;       
  160::511     1e-20  27%  520 aa  BAIB_EUBSP RecName: Full=Bile acid-coenzyme A ligase;       
  113::625     1e-20  27%  654 aa  ACSA_CHRVO RecName: Full=Acetyl-coenzyme A synthetase;       
  213::555     1e-20  27%  572 aa  ACSA_BACSU RecName: Full=Acetyl-coenzyme A synthetase;       
  136::480     2e-20  31%  485 aa  DLTA_STAEQ RecName: Full=D-alanine--poly(phosphoribitol) ligase
  134::464     2e-20  27%  474 aa  MENE_STAES RecName: Full=2-succinylbenzoate--CoA ligase;       
   94::627     2e-20  23%  661 aa  ACSA_COPC7 RecName: Full=Acetyl-coenzyme A synthetase;       
   65::455     3e-20  30%  510 aa  CAIC_SHIF8 RecName: Full=Probable crotonobetaine/carnitine-CoA
   42::555     3e-20  25%  562 aa  4CL2_SOYBN RecName: Full=4-coumarate--CoA ligase 2;       
  134::464     4e-20  27%  474 aa  MENE_STAEQ RecName: Full=2-succinylbenzoate--CoA ligase;       
   85::611     4e-20  27%  650 aa  ACSA_SYNFM RecName: Full=Acetyl-coenzyme A synthetase;       
   49::489     5e-20  25%  492 aa  MENE_STAAN RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     5e-20  25%  492 aa  MENE_STAAM RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     5e-20  25%  492 aa  MENE_STAA9 RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     5e-20  25%  492 aa  MENE_STAA2 RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     5e-20  25%  492 aa  MENE_STAA1 RecName: Full=2-succinylbenzoate--CoA ligase;       
  118::634     5e-20  24%  674 aa  ACSA_DICDI RecName: Full=Acetyl-coenzyme A synthetase;       
   94::627     5e-20  23%  661 aa  ACSA_COPCI RecName: Full=Acetyl-coenzyme A synthetase;       
  117::572     7e-20  28%  580 aa  ACSM4_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM4,
   74::614     7e-20  26%  647 aa  ACSA_XYLFA RecName: Full=Acetyl-coenzyme A synthetase;       
   84::624     7e-20  25%  662 aa  ACSA_SCHPO RecName: Full=Probable acetyl-coenzyme A synthetase;    
   87::615     7e-20  25%  649 aa  ACSA_PSYIN RecName: Full=Acetyl-coenzyme A synthetase;       
   98::613     7e-20  26%  649 aa  ACSA_NOVAD RecName: Full=Acetyl-coenzyme A synthetase;       
  479::997     9e-20  25% 3131 aa  ESYN_FUSEQ RecName: Full=Enniatin synthetase;Includes:  RecName:
  149::632     9e-20  26%  670 aa  ACSA_PYRAE RecName: Full=Acetyl-coenzyme A synthetase;       
   74::614     1e-19  26%  647 aa  ACSA_XYLFT RecName: Full=Acetyl-coenzyme A synthetase;       
  198::572     2e-19  28%  586 aa  ACSF3_BOVIN RecName: Full=Acyl-CoA synthetase family member 3,
  105::615     2e-19  25%  649 aa  ACSA_VIBCH RecName: Full=Acetyl-coenzyme A synthetase;       
  129::449     2e-19  26%  451 aa  MENE_LACLA RecName: Full=2-succinylbenzoate--CoA ligase;       
    4::482     2e-19  25%  487 aa  DLTA_STAXY RecName: Full=D-alanine--poly(phosphoribitol) ligase
   98::615     2e-19  26%  652 aa  ACSA_SALTI RecName: Full=Acetyl-coenzyme A synthetase;       
  134::612     2e-19  29%  645 aa  ACSA_BDEBA RecName: Full=Acetyl-coenzyme A synthetase;       
  105::636     2e-19  24%  671 aa  ACS1_DEBHA RecName: Full=Acetyl-coenzyme A synthetase 1;       
   98::563     2e-19  24%  564 aa  4CL1_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 1;       
  114::625     3e-19  25%  653 aa  ACSA_SYNY3 RecName: Full=Acetyl-coenzyme A synthetase;       
   90::614     3e-19  29%  647 aa  ACSA_CAUCR RecName: Full=Acetyl-coenzyme A synthetase;       
   35::547     3e-19  27%  555 aa  4CLL9_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 9;       
   49::489     3e-19  24%  492 aa  MENE_STAAU RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     3e-19  24%  492 aa  MENE_STAAT RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     3e-19  24%  492 aa  MENE_STAAE RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     3e-19  24%  492 aa  MENE_STAAC RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     3e-19  24%  492 aa  MENE_STAA8 RecName: Full=2-succinylbenzoate--CoA ligase;       
   49::489     3e-19  24%  492 aa  MENE_STAA3 RecName: Full=2-succinylbenzoate--CoA ligase;       
  149::632     3e-19  28%  670 aa  ACSA_PYRAR RecName: Full=Acetyl-coenzyme A synthetase;       
   91::615     4e-19  26%  652 aa  ACSA_SALTY RecName: Full=Acetyl-coenzyme A synthetase;       
  267::626     4e-19  28%  655 aa  ACSA_NITEC RecName: Full=Acetyl-coenzyme A synthetase;       
   97::612     4e-19  25%  648 aa  ACSA_BRAJA RecName: Full=Acetyl-coenzyme A synthetase;       
   34::537     6e-19  22%  543 aa  VIBE_VIBCH RecName: Full=Vibriobactin-specific
  136::642     6e-19  25%  671 aa  ACSA_RHOBA RecName: Full=Acetyl-coenzyme A synthetase;       
   98::615     6e-19  26%  652 aa  ACSA_CITK8 RecName: Full=Acetyl-coenzyme A synthetase;       
   98::615     8e-19  26%  650 aa  ACSA_SHEFN RecName: Full=Acetyl-coenzyme A synthetase;       
  105::614     8e-19  26%  648 aa  ACSA_AERS4 RecName: Full=Acetyl-coenzyme A synthetase;       
   87::626     8e-19  26%  651 aa  ACSA1_PSEAE RecName: Full=Acetyl-coenzyme A synthetase 1;       
  162::489     1e-18  28%  492 aa  MENE_STAAW RecName: Full=2-succinylbenzoate--CoA ligase;       
  162::489     1e-18  28%  492 aa  MENE_STAAS RecName: Full=2-succinylbenzoate--CoA ligase;       
  113::627     1e-18  25%  656 aa  ACSA_THEEB RecName: Full=Acetyl-coenzyme A synthetase;       
   86::613     1e-18  25%  645 aa  ACSA_BEII9 RecName: Full=Acetyl-coenzyme A synthetase;       
  162::489     1e-18  27%  492 aa  MENE_STAAB RecName: Full=2-succinylbenzoate--CoA ligase;       
  137::617     1e-18  28%  651 aa  ACSA_SHEDO RecName: Full=Acetyl-coenzyme A synthetase;       
  105::615     1e-18  24%  649 aa  ACSA_PHOPR RecName: Full=Acetyl-coenzyme A synthetase;       
  196::533     2e-18  28%  542 aa  4CLL5_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 5;       
  103::611     2e-18  26%  646 aa  ACSA_DESAA RecName: Full=Acetyl-coenzyme A synthetase;       
   98::615     3e-18  26%  652 aa  ACSA_SODGM RecName: Full=Acetyl-coenzyme A synthetase;       
  106::615     3e-18  28%  650 aa  ACSA_SHEHH RecName: Full=Acetyl-coenzyme A synthetase;       
   98::615     4e-18  26%  652 aa  ACSA_ECOLI RecName: Full=Acetyl-coenzyme A synthetase;       
  105::614     4e-18  26%  648 aa  ACSA_AERHH RecName: Full=Acetyl-coenzyme A synthetase;       
   87::615     5e-18  26%  651 aa  ACSA_PSESM RecName: Full=Acetyl-coenzyme A synthetase;       
  107::612     5e-18  24%  650 aa  ACSA_BRASO RecName: Full=Acetyl-coenzyme A synthetase;       
  101::634     5e-18  24%  671 aa  ACS2_CANAL RecName: Full=Acetyl-coenzyme A synthetase 2;       
  168::515     6e-18  33%  689 aa  LCF2_SCHPO RecName: Full=Long-chain-fatty-acid--CoA ligase 2;      
  266::624     6e-18  29%  654 aa  ACSA_METFK RecName: Full=Acetyl-coenzyme A synthetase;       
  115::622     8e-18  28%  656 aa  ACSA_RHOCA RecName: Full=Acetyl-coenzyme A synthetase;       
  105::634     8e-18  27%  670 aa  ACSA_EMENI RecName: Full=Acetyl-coenzyme A synthetase;       
   87::611     1e-17  27%  647 aa  ACSA_SYNAS RecName: Full=Acetyl-coenzyme A synthetase;       
   98::615     1e-17  26%  652 aa  ACSA_ECOL6 RecName: Full=Acetyl-coenzyme A synthetase;       
  186::528     1e-17  28% 1100 aa  ACSF4_MOUSE RecName: Full=Acyl-CoA synthetase family member 4;     
  464::858     2e-17  28% 1419 aa  LYS2_SCHPO RecName: Full=L-aminoadipate-semialdehyde dehydrogenase;
   87::615     2e-17  26%  652 aa  ACSA_YERPP RecName: Full=Acetyl-coenzyme A synthetase;       
   87::615     2e-17  26%  652 aa  ACSA_YERPN RecName: Full=Acetyl-coenzyme A synthetase;       
   87::615     2e-17  26%  652 aa  ACSA_YERPE RecName: Full=Acetyl-coenzyme A synthetase;       
   87::615     2e-17  26%  652 aa  ACSA_YERPA RecName: Full=Acetyl-coenzyme A synthetase;       
  106::615     2e-17  27%  650 aa  ACSA_SHEPA RecName: Full=Acetyl-coenzyme A synthetase;       
  141::626     2e-17  29%  661 aa  ACSA_LEPIN RecName: Full=Acetyl-coenzyme A synthetase;       
  141::626     2e-17  29%  661 aa  ACSA_LEPIC RecName: Full=Acetyl-coenzyme A synthetase;       
  104::612     3e-17  25%  645 aa  ACSA_HALHL RecName: Full=Acetyl-coenzyme A synthetase;       
   98::615     3e-17  26%  652 aa  ACSA_ENTS8 RecName: Full=Acetyl-coenzyme A synthetase;       
   87::615     4e-17  26%  652 aa  ACSA_YERPS RecName: Full=Acetyl-coenzyme A synthetase;       
   87::615     4e-17  26%  652 aa  ACSA_YERP3 RecName: Full=Acetyl-coenzyme A synthetase;       
   89::615     4e-17  26%  651 aa  ACSA_PSEU2 RecName: Full=Acetyl-coenzyme A synthetase;       
  107::640     4e-17  27%  675 aa  ACS1_CANAL RecName: Full=Acetyl-coenzyme A synthetase 1;       
  368::703     4e-17  29%  719 aa  AAS_SHIFL RecName: Full=Bifunctional protein aas;Includes:
  368::703     4e-17  29%  719 aa  AAS_SHIF8 RecName: Full=Bifunctional protein aas;Includes:
  267::631     5e-17  29%  660 aa  ACSA_BURPS RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     5e-17  29%  660 aa  ACSA_BURP6 RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     5e-17  29%  660 aa  ACSA_BURP1 RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     5e-17  29%  660 aa  ACSA_BURP0 RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     5e-17  29%  660 aa  ACSA_BURMS RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     5e-17  29%  660 aa  ACSA_BURMA RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     5e-17  29%  660 aa  ACSA_BURM9 RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     5e-17  29%  660 aa  ACSA_BURM7 RecName: Full=Acetyl-coenzyme A synthetase;       
  366::703     5e-17  29%  719 aa  AAS_SALDC RecName: Full=Bifunctional protein aas;Includes:
  105::633     7e-17  25%  669 aa  ACSA_PENCH RecName: Full=Acetyl-coenzyme A synthetase;       
  108::619     7e-17  25%  652 aa  ACSA_MARMS RecName: Full=Acetyl-coenzyme A synthetase;       
  104::612     7e-17  26%  644 aa  ACSA_MAGSM RecName: Full=Acetyl-coenzyme A synthetase;       
  368::703     7e-17  29%  719 aa  AAS_ECOUT RecName: Full=Bifunctional protein aas;Includes:
  368::703     7e-17  29%  719 aa  AAS_ECOK1 RecName: Full=Bifunctional protein aas;Includes:
  368::703     7e-17  29%  719 aa  AAS_ECO45 RecName: Full=Bifunctional protein aas;Includes:
  157::532     7e-17  28%  542 aa  4CLL1_ARATH RecName: Full=4-coumarate--CoA ligase-like 1;       
  105::616     9e-17  23%  650 aa  ACSA_VIBPA RecName: Full=Acetyl-coenzyme A synthetase;       
  255::613     9e-17  31%  646 aa  ACSA_PSEHT RecName: Full=Acetyl-coenzyme A synthetase;       
   87::615     9e-17  26%  651 aa  ACSA_PSE14 RecName: Full=Acetyl-coenzyme A synthetase;       
   98::615     9e-17  26%  652 aa  ACSA_ECO57 RecName: Full=Acetyl-coenzyme A synthetase;       
   77::615     9e-17  25%  653 aa  ACSA1_PSEPK RecName: Full=Acetyl-coenzyme A synthetase 1;       
  285::644     1e-16  26%  672 aa  ACSA_METSO RecName: Full=Acetyl-coenzyme A synthetase;       
  368::703     1e-16  29%  719 aa  AAS_SHISS RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_SHIB3 RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALTI RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALSV RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALPK RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALPB RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALPA RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALHS RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALG2 RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALEP RecName: Full=Bifunctional protein aas;Includes:
  366::703     1e-16  29%  719 aa  AAS_SALA4 RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECOSM RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECOSE RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECOLU RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECOLI RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECOLC RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECOL6 RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECOHS RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECODH RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECOBW RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECO5E RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECO57 RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECO55 RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECO27 RecName: Full=Bifunctional protein aas;Includes:
  368::703     1e-16  29%  719 aa  AAS_ECO24 RecName: Full=Bifunctional protein aas;Includes:
   87::615     2e-16  29%  652 aa  ACSA_SERP5 RecName: Full=Acetyl-coenzyme A synthetase;       
  366::703     2e-16  28%  719 aa  AAS_SALTY RecName: Full=Bifunctional protein aas;Includes:
  366::703     2e-16  29%  719 aa  AAS_SALPC RecName: Full=Bifunctional protein aas;Includes:
  366::703     2e-16  28%  719 aa  AAS_SALNS RecName: Full=Bifunctional protein aas;Includes:
  366::703     2e-16  29%  719 aa  AAS_SALCH RecName: Full=Bifunctional protein aas;Includes:
  368::703     2e-16  29%  719 aa  AAS_ECOL5 RecName: Full=Bifunctional protein aas;Includes:
  368::703     2e-16  29%  719 aa  AAS_ECO7I RecName: Full=Bifunctional protein aas;Includes:
   88::612     2e-16  24%  645 aa  ACSA_ALHEH RecName: Full=Acetyl-coenzyme A synthetase;       
  366::703     2e-16  28%  719 aa  AAS_KLEP3 RecName: Full=Bifunctional protein aas;Includes:
  366::707     2e-16  29%  719 aa  AAS_ENT38 RecName: Full=Bifunctional protein aas;Includes:
  187::595     2e-16  25%  609 aa  4CLL8_ORYSJ RecName: Full=Putative 4-coumarate--CoA ligase-like 8; 
   87::615     3e-16  26%  652 aa  ACSA_YERE8 RecName: Full=Acetyl-coenzyme A synthetase;       
   87::616     3e-16  24%  650 aa  ACSA_VIBVY RecName: Full=Acetyl-coenzyme A synthetase;       
   87::616     3e-16  24%  650 aa  ACSA_VIBVU RecName: Full=Acetyl-coenzyme A synthetase;       
  265::625     3e-16  27%  655 aa  ACSA_THIDA RecName: Full=Acetyl-coenzyme A synthetase;       
   78::615     3e-16  27%  650 aa  ACSA_SHESH RecName: Full=Acetyl-coenzyme A synthetase;       
   82::615     3e-16  26%  651 aa  ACSA_PHOLL RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     3e-16  28%  660 aa  ACSA_BURTA RecName: Full=Acetyl-coenzyme A synthetase;       
    3::283     3e-16  31%  293 aa  4CL1_SOYBN RecName: Full=4-coumarate--CoA ligase 1;       
   88::613     6e-16  25%  651 aa  ACSA_XANP2 RecName: Full=Acetyl-coenzyme A synthetase;       
  366::703     6e-16  28%  718 aa  AAS_YERE8 RecName: Full=Bifunctional protein aas;Includes:
  109::618     8e-16  26%  648 aa  ACSA_THET2 RecName: Full=Acetyl-coenzyme A synthetase;       
  104::612     8e-16  24%  647 aa  ACSA_PARL1 RecName: Full=Acetyl-coenzyme A synthetase;       
  103::632     8e-16  24%  667 aa  ACSA_NEUCR RecName: Full=Acetyl-coenzyme A synthetase;       
   89::616     8e-16  24%  649 aa  ACSA_MARAV RecName: Full=Acetyl-coenzyme A synthetase;       
  366::703     8e-16  27%  723 aa  AAS_PECCP RecName: Full=Bifunctional protein aas;Includes:
  368::632     8e-16  30%  719 aa  AAS_ESCF3 RecName: Full=Bifunctional protein aas;Includes:
  153::592     1e-15  30%  711 aa  ACSL4_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 4;     
  109::618     1e-15  26%  648 aa  ACSA_THET8 RecName: Full=Acetyl-coenzyme A synthetase;       
  103::615     1e-15  26%  647 aa  ACSA_BART1 RecName: Full=Acetyl-coenzyme A synthetase;       
  101::642     1e-15  25%  679 aa  ACS2_DEBHA RecName: Full=Acetyl-coenzyme A synthetase 2;       
  211::567     1e-15  27%  570 aa  4CL4_ARATH RecName: Full=4-coumarate--CoA ligase 4;       
  107::612     2e-15  25%  648 aa  ACSA_RHOP5 RecName: Full=Acetyl-coenzyme A synthetase;       
  366::703     2e-15  27%  738 aa  AAS_ERWCT RecName: Full=Bifunctional protein aas;Includes:
   78::615     2e-15  24%  650 aa  ACSA_SHEAM RecName: Full=Acetyl-coenzyme A synthetase;       
  102::616     3e-15  24%  651 aa  ACSA_RHILO RecName: Full=Acetyl-coenzyme A synthetase;       
  134::619     3e-15  26%  654 aa  ACSA_LEPBJ RecName: Full=Acetyl-coenzyme A synthetase;       
  114::631     3e-15  25%  660 aa  ACSA_BURS3 RecName: Full=Acetyl-coenzyme A synthetase;       
  187::529     4e-15  29% 1098 aa  ACSF4_HUMAN RecName: Full=Acyl-CoA synthetase family member 4;     
  366::703     4e-15  29%  719 aa  AAS_CITK8 RecName: Full=Bifunctional protein aas;Includes:
  224::806     5e-15  25% 1374 aa  LYS2_CANGA RecName: Full=L-aminoadipate-semialdehyde dehydrogenase
  100::648     5e-15  24%  687 aa  ACS2_ASHGO RecName: Full=Acetyl-coenzyme A synthetase 2;       
  136::659     7e-15  26%  694 aa  ACSA_CRYPV RecName: Full=Acetyl-coenzyme A synthetase;       
  366::703     7e-15  26%  718 aa  AAS_YERPY RecName: Full=Bifunctional protein aas;Includes:
  366::703     7e-15  26%  718 aa  AAS_YERPS RecName: Full=Bifunctional protein aas;Includes:
  366::703     7e-15  26%  718 aa  AAS_YERPP RecName: Full=Bifunctional protein aas;Includes:
  366::703     7e-15  26%  718 aa  AAS_YERPG RecName: Full=Bifunctional protein aas;Includes:
  366::703     7e-15  26%  718 aa  AAS_YERPB RecName: Full=Bifunctional protein aas;Includes:
  366::703     7e-15  26%  718 aa  AAS_YERP3 RecName: Full=Bifunctional protein aas;Includes:
  103::615     9e-15  24%  652 aa  ACSA_BARQU RecName: Full=Acetyl-coenzyme A synthetase;       
  103::615     9e-15  24%  652 aa  ACSA_BARHE RecName: Full=Acetyl-coenzyme A synthetase;       
  100::635     9e-15  23%  675 aa  ACS2_ZYGBA RecName: Full=Acetyl-coenzyme A synthetase 2;       
  107::613     1e-14  24%  645 aa  ACSA_METSB RecName: Full=Acetyl-coenzyme A synthetase;       
  134::619     1e-14  26%  654 aa  ACSA_LEPBL RecName: Full=Acetyl-coenzyme A synthetase;       
  103::615     2e-14  23%  651 aa  ACSA_AGRT5 RecName: Full=Acetyl-coenzyme A synthetase;       
  100::643     2e-14  25%  683 aa  ACS2_YEAST RecName: Full=Acetyl-coenzyme A synthetase 2;       
  182::525     3e-14  25%  539 aa  DHBE_BACSU RecName: Full=2,3-dihydroxybenzoate-AMP ligase;       
  108::615     3e-14  24%  650 aa  ACSA_SHESA RecName: Full=Acetyl-coenzyme A synthetase;       
   88::614     3e-14  24%  649 aa  ACSA_METPB RecName: Full=Acetyl-coenzyme A synthetase;       
  183::672     3e-14  28%  704 aa  ACS1_CANGA RecName: Full=Acetyl-coenzyme A synthetase 1;       
  368::703     3e-14  26%  718 aa  AAS_YERPE RecName: Full=Bifunctional protein aas;Includes:
  368::703     3e-14  26%  718 aa  AAS_YERPA RecName: Full=Bifunctional protein aas;Includes:
  435::837     3e-14  29% 1409 aa  LYS2_PENCH RecName: Full=L-aminoadipate-semialdehyde dehydrogenase
  153::576     3e-14  29%  711 aa  ACSL4_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 4;     
  176::570     4e-14  29%  726 aa  ACBG1_BOVIN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;
  162::556     6e-14  30%  676 aa  LCF1_SCHPO RecName: Full=Long-chain-fatty-acid--CoA ligase 1;      
  366::703     6e-14  26%  719 aa  AAS_ENTS8 RecName: Full=Bifunctional protein aas;Includes:
   84::619     7e-14  27%  654 aa  ACSA_LEPBP RecName: Full=Acetyl-coenzyme A synthetase;       
   84::619     7e-14  27%  654 aa  ACSA_LEPBA RecName: Full=Acetyl-coenzyme A synthetase;       
  112::551     1e-13  29%  670 aa  ACSL4_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 4;       
  162::601     1e-13  29%  720 aa  ACSL3_PONAB RecName: Full=Long-chain-fatty-acid--CoA ligase 3;     
  162::349     1e-13  27%  720 aa  ACSL3_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 3;     
   74::614     1e-13  26%  647 aa  ACSA_XANAC RecName: Full=Acetyl-coenzyme A synthetase;       
  108::615     1e-13  24%  650 aa  ACSA_SHESR RecName: Full=Acetyl-coenzyme A synthetase;       
  108::615     1e-13  24%  650 aa  ACSA_SHESM RecName: Full=Acetyl-coenzyme A synthetase;       
   86::614     1e-13  23%  649 aa  ACSA_METEP RecName: Full=Acetyl-coenzyme A synthetase;       
   18::445     1e-13  27%  455 aa  MENE_SALTY RecName: Full=2-succinylbenzoate--CoA ligase;       
  113::618     1e-13  27%  649 aa  ACSA_DEIRA RecName: Full=Acetyl-coenzyme A synthetase;       
  272::644     1e-13  28%  684 aa  ACS2_KLULA RecName: Full=Acetyl-coenzyme A synthetase 2;       
  366::703     1e-13  26%  719 aa  AAS_KLEP7 RecName: Full=Bifunctional protein aas;Includes:
  239::821     2e-13  25% 1392 aa  LYS2_YEAST RecName: Full=L-aminoadipate-semialdehyde dehydrogenase;
   74::614     2e-13  26%  647 aa  ACSA_XANOM RecName: Full=Acetyl-coenzyme A synthetase;       
  108::615     2e-13  24%  650 aa  ACSA_SHEON RecName: Full=Acetyl-coenzyme A synthetase;       
  134::614     2e-13  24%  648 aa  ACSA_METRJ RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     2e-13  28%  660 aa  ACSA_BURP8 RecName: Full=Acetyl-coenzyme A synthetase;       
  116::662     2e-13  26%  694 aa  ACS1_ASHGO RecName: Full=Acetyl-coenzyme A synthetase 1;       
  150::526     2e-13  23%  536 aa  ENTE_ECO57 RecName: Full=Enterobactin synthetase component
  137::625     2e-13  24%  654 aa  ACSA_WOLSU RecName: Full=Acetyl-coenzyme A synthetase;       
   98::615     3e-13  26%  650 aa  ACSA_SHELP RecName: Full=Acetyl-coenzyme A synthetase;       
  141::629     3e-13  24%  662 aa  ACSA_HELAH RecName: Full=Acetyl-coenzyme A synthetase;       
  129::675     3e-13  26%  707 aa  ACS1_KLULA RecName: Full=Acetyl-coenzyme A synthetase 1;       
  183::526     5e-13  23%  536 aa  ENTE_ECOLI RecName: Full=Enterobactin synthetase component
  116::480     5e-13  23%  480 aa  ACSM6_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM6,
   86::614     5e-13  23%  652 aa  ACSA_METC4 RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     5e-13  26%  660 aa  ACSA_HERAR RecName: Full=Acetyl-coenzyme A synthetase;       
   79::875     8e-13  32%  983 aa  ESYN_GIBPU RecName: Full=Enniatin synthetase;Includes:  RecName:
  366::703     8e-13  27%  719 aa  AAS_ERWT9 RecName: Full=Bifunctional protein aas;Includes:
  204::651     1e-12  26%  690 aa  S27A5_HUMAN RecName: Full=Bile acyl-CoA synthetase;       
  101::615     1e-12  24%  652 aa  ACSA_BARBK RecName: Full=Acetyl-coenzyme A synthetase;       
  190::584     1e-12  30%  721 aa  ACBG1_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;  
  203::650     2e-12  25%  689 aa  S27A5_MOUSE RecName: Full=Bile acyl-CoA synthetase;       
  108::615     2e-12  23%  650 aa  ACSA_SHESW RecName: Full=Acetyl-coenzyme A synthetase;       
  108::615     2e-12  23%  650 aa  ACSA_SHEPC RecName: Full=Acetyl-coenzyme A synthetase;       
  141::629     2e-12  23%  662 aa  ACSA_HELPY RecName: Full=Acetyl-coenzyme A synthetase;       
  141::629     2e-12  23%  662 aa  ACSA_HELPH RecName: Full=Acetyl-coenzyme A synthetase;       
  141::629     2e-12  23%  662 aa  ACSA_HELPG RecName: Full=Acetyl-coenzyme A synthetase;       
  259::612     2e-12  26%  645 aa  ACSA_ALCBS RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     2e-12  27%  660 aa  ACSA_RALSO RecName: Full=Acetyl-coenzyme A synthetase;       
  519::636     2e-12  33%  670 aa  ACSA_DROME RecName: Full=Acetyl-coenzyme A synthetase;       
  190::584     2e-12  30%  721 aa  ACBG1_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;
  141::629     3e-12  23%  662 aa  ACSA_HELP2 RecName: Full=Acetyl-coenzyme A synthetase;       
  108::616     4e-12  22%  651 aa  ACSA_STRCO RecName: Full=Acetyl-coenzyme A synthetase;       
  263::572     5e-12  33%  694 aa  LCF4_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 4;      
  172::443     5e-12  28% 1149 aa  ACSF4_DANRE RecName: Full=Acyl-CoA synthetase family member 4;     
  137::617     5e-12  26%  653 aa  ACSA_PSYA2 RecName: Full=Acetyl-coenzyme A synthetase;       
  105::623     5e-12  25%  651 aa  ACSA_MYCTU RecName: Full=Acetyl-coenzyme A synthetase;       
  105::623     5e-12  25%  651 aa  ACSA_MYCBO RecName: Full=Acetyl-coenzyme A synthetase;       
  119::627     7e-12  23%  659 aa  ACSA_CHLTE RecName: Full=Acetyl-coenzyme A synthetase;       
  107::289     7e-12  30%  645 aa  ACSA2_PSEAE RecName: Full=Acetyl-coenzyme A synthetase 2;       
  114::641     7e-12  23%  682 aa  ACS2L_MOUSE RecName: Full=Acetyl-coenzyme A synthetase 2-like,
  193::587     9e-12  30%  724 aa  ACBG1_MACFA RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;
  103::329     1e-11  26%  649 aa  ACSA2_RHIME RecName: Full=Acetyl-coenzyme A synthetase 2;       
  193::587     1e-11  30%  724 aa  ACBG1_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;
  204::651     2e-11  24%  690 aa  S27A5_RAT RecName: Full=Bile acyl-CoA synthetase;       
  154::548     2e-11  25%  667 aa  S27A3_MOUSE RecName: Full=Long-chain fatty acid transport protein
   93::485     2e-11  31%  607 aa  LCFH_HAEIN RecName: Full=Putative long-chain-fatty-acid--CoA
  497::615     2e-11  33%  651 aa  ACSA_RHILW RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     2e-11  26%  660 aa  ACSA_RALME RecName: Full=Acetyl-coenzyme A synthetase;       
   85::611     2e-11  23%  644 aa  ACSA2_PSEPK RecName: Full=Acetyl-coenzyme A synthetase 2;       
   87::448     2e-11  22%  453 aa  VRAA_STAEQ RecName: Full=Putative long chain fatty acid-CoA ligase
  136::443     2e-11  28%  451 aa  MENE_ECOLI RecName: Full=2-succinylbenzoate--CoA ligase;       
  191::587     2e-11  29%  763 aa  ACBG2_CHICK RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;
  115::537     3e-11  28%  667 aa  FCSA_DICDI RecName: Full=Fatty acyl-CoA synthetase A;       
  146::482     3e-11  32%  578 aa  FAD21_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
  146::482     3e-11  32%  578 aa  FAD21_MYCBO RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
  103::329     3e-11  26%  649 aa  ACSA_RHISN RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     3e-11  25%  660 aa  ACSA_RALEJ RecName: Full=Acetyl-coenzyme A synthetase;       
  103::285     3e-11  29%  641 aa  ACSA_PRB01 RecName: Full=Acetyl-coenzyme A synthetase;       
  490::644     3e-11  31%  683 aa  ACS2_CANGA RecName: Full=Acetyl-coenzyme A synthetase 2;       
   88::604     3e-11  26%  643 aa  S27A4_PONAB RecName: Full=Long-chain fatty acid transport protein
  137::617     3e-11  23%  655 aa  ACSA_PSYCK RecName: Full=Acetyl-coenzyme A synthetase;       
  141::631     4e-11  24%  660 aa  ACSA_RALEH RecName: Full=Acetyl-coenzyme A synthetase;       
   88::604     6e-11  23%  643 aa  S27A4_MOUSE RecName: Full=Long-chain fatty acid transport protein
  111::598     6e-11  27%  628 aa  PRPE_ECOLI RecName: Full=Propionate--CoA ligase;       
  104::272     6e-11  31%  645 aa  ACSA_SACD2 RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     6e-11  26%  660 aa  ACSA_RALPJ RecName: Full=Acetyl-coenzyme A synthetase;       
   88::604     1e-10  25%  643 aa  S27A4_MACFA RecName: Full=Long-chain fatty acid transport protein
  150::323     1e-10  27%  698 aa  ACSL1_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 1;     
  103::275     1e-10  27%  652 aa  ACSA_AGRRK RecName: Full=Acetyl-coenzyme A synthetase;       
  217::610     1e-10  27%  730 aa  S27A3_HUMAN RecName: Full=Long-chain fatty acid transport protein
  162::349     1e-10  25%  720 aa  ACSL3_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 3;       
  497::615     1e-10  32%  651 aa  ACSA_RHIEC RecName: Full=Acetyl-coenzyme A synthetase;       
  497::615     1e-10  32%  651 aa  ACSA_RHIE6 RecName: Full=Acetyl-coenzyme A synthetase;       
  497::615     1e-10  33%  651 aa  ACSA_AGRVS RecName: Full=Acetyl-coenzyme A synthetase;       
  132::437     2e-10  31%  571 aa  FAD11_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD11;  
  135::629     2e-10  25%  683 aa  ACSL5_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 5;     
   74::274     2e-10  29%  647 aa  ACSA_XANCP RecName: Full=Acetyl-coenzyme A synthetase;       
   74::274     2e-10  29%  647 aa  ACSA_XANC8 RecName: Full=Acetyl-coenzyme A synthetase;       
  267::631     2e-10  25%  660 aa  ACSA_CUPTR RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUSU RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUSI RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUO2 RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUME RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUMB RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUC2 RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUAB RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUA2 RecName: Full=Acetyl-coenzyme A synthetase;       
  497::617     2e-10  41%  651 aa  ACSA_BRUA1 RecName: Full=Acetyl-coenzyme A synthetase;       
  113::533     2e-10  29%  667 aa  ACBG2_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;
  140::532     2e-10  28%  666 aa  BGM_DROME RecName: Full=Very long-chain-fatty-acid--CoA ligase
  162::349     2e-10  25%  720 aa  ACSL3_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 3;     
  103::329     2e-10  25%  649 aa  ACSA_SINMW RecName: Full=Acetyl-coenzyme A synthetase;       
  121::391     3e-10  23%  411 aa  VRAA_STAES RecName: Full=Putative long chain fatty acid-CoA ligase
  238::604     3e-10  26%  643 aa  S27A4_HUMAN RecName: Full=Long-chain fatty acid transport protein
  203::634     3e-10  29%  739 aa  ACBG2_XENLA RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;
   60::501     4e-10  24%  620 aa  S27A2_MOUSE RecName: Full=Very long-chain acyl-CoA synthetase;     
  166::570     5e-10  29%  580 aa  FAD28_MYCBO RecName: Full=Putative fatty-acid--CoA ligase fadD28;  
  155::566     6e-10  29%  583 aa  FAD26_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD26;  
  108::617     8e-10  23%  652 aa  ACSA_STRAW RecName: Full=Acetyl-coenzyme A synthetase;       
  103::292     8e-10  27%  652 aa  ACSA_AGRRH RecName: Full=Acetyl-coenzyme A synthetase;       
  234::607     1e-09  24%  646 aa  S27A1_RAT RecName: Full=Long-chain fatty acid transport protein 1; 
   52::598     1e-09  26%  628 aa  PRPE_SALTY RecName: Full=Propionate--CoA ligase;       
  132::435     1e-09  33%  521 aa  MBTM_MYCSS RecName:
   78::275     1e-09  34%  651 aa  ACSA_PSEU5 RecName: Full=Acetyl-coenzyme A synthetase;       
  293::661     1e-09  26%  688 aa  ACSB_DICDI RecName: Full=Acyl-CoA synthetase short-chain family
  108::360     2e-09  26%  650 aa  ACSA_SHEB9 RecName: Full=Acetyl-coenzyme A synthetase;       
  108::360     2e-09  25%  650 aa  ACSA_SHEB8 RecName: Full=Acetyl-coenzyme A synthetase;       
  108::360     2e-09  25%  650 aa  ACSA_SHEB5 RecName: Full=Acetyl-coenzyme A synthetase;       
  234::607     3e-09  26%  646 aa  S27A1_MOUSE RecName: Full=Long-chain fatty acid transport protein
  239::408     3e-09  32%  700 aa  LCF1_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 1;      
  112::250     4e-09  28%  628 aa  Y3568_PSEAE RecName: Full=Uncharacterized protein PA3568;
  150::323     4e-09  22%  697 aa  ACSL6_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 6;     
  497::617     4e-09  38%  651 aa  ACSA_OCHA4 RecName: Full=Acetyl-coenzyme A synthetase;       
  150::323     5e-09  25%  697 aa  ACSL6_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 6;     
   88::450     7e-09  23%  461 aa  VRAA_STAHJ RecName: Full=Putative long chain fatty acid-CoA ligase
   60::501     7e-09  23%  620 aa  S27A2_RAT RecName: Full=Very long-chain acyl-CoA synthetase;       
  151::324     7e-09  25%  699 aa  ACSL1_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 1;     
  242::528     9e-09  26%  646 aa  S27A1_HUMAN RecName: Full=Long-chain fatty acid transport protein
  242::528     1e-08  27%  646 aa  S27A1_BOVIN RecName: Full=Long-chain fatty acid transport protein
   69::571     2e-08  26%  583 aa  FAD25_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD25;  
  121::305     2e-08  25%  689 aa  ACS2L_HUMAN RecName: Full=Acetyl-coenzyme A synthetase 2-like,
  239::315     2e-08  41%  694 aa  LCF3_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 3;      
  135::340     2e-08  25%  683 aa  ACSL5_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 5;       
  135::340     2e-08  25%  683 aa  ACSL5_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 5;     
  151::324     2e-08  26%  699 aa  ACSL1_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 1;       
  150::323     2e-08  26%  698 aa  ACSL1_CAVPO RecName: Full=Long-chain-fatty-acid--CoA ligase 1;     
  213::628     2e-08  26%  667 aa  AACS_CHICK RecName: Full=Acetoacetyl-CoA synthetase;       
  141::347     4e-08  30%  713 aa  ACS1_YEAST RecName: Full=Acetyl-coenzyme A synthetase 1;       
  142::274     6e-08  34%  667 aa  ACBG2_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;  
  108::500     1e-07  23%  619 aa  S27A6_HUMAN RecName: Full=Long-chain fatty acid transport protein
  215::528     1e-07  28%  681 aa  BGML_DROME RecName: Full=Long-chain-fatty-acid--CoA ligase
  127::422     2e-07  25%  452 aa  MENE_HAEIN RecName: Full=2-succinylbenzoate--CoA ligase;       
  163::667     2e-07  25%  701 aa  ACSA_MOUSE RecName: Full=Acetyl-coenzyme A synthetase, cytoplasmic;
  150::295     4e-07  24%  697 aa  ACSL6_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 6;       
  366::618     7e-07  27%  639 aa  AAS_PHOLL RecName: Full=Bifunctional protein aas;Includes:
  135::310     1e-06  26%  686 aa  ACSS3_HUMAN RecName: Full=Acyl-CoA synthetase short-chain family
  135::310     1e-06  26%  686 aa  ACSS3_PONAB RecName: Full=Acyl-CoA synthetase short-chain family
  196::327     1e-06  28%  666 aa  ACBG2_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;
  138::305     3e-06  26%  682 aa  ACSS3_MOUSE RecName: Full=Acyl-CoA synthetase short-chain family
  136::623     3e-06  25%  657 aa  ACSA_CAMJJ RecName: Full=Acetyl-coenzyme A synthetase;       
  136::623     3e-06  25%  657 aa  ACSA_CAMJE RecName: Full=Acetyl-coenzyme A synthetase;       
  136::623     3e-06  25%  657 aa  ACSA_CAMJ8 RecName: Full=Acetyl-coenzyme A synthetase;       
  233::300     3e-06  34%  643 aa  FAT1_COCHE RecName: Full=Fatty acid transporter protein;
  166::320     7e-06  25%  744 aa  LCF2_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 2;      
  245::292     7e-06  38%  673 aa  FCSB_DICDI RecName: Full=Fatty acyl-CoA synthetase B;       
  163::383     7e-06  31%  701 aa  ACSA_HUMAN RecName: Full=Acetyl-coenzyme A synthetase, cytoplasmic;
  220::633     1e-05  24%  672 aa  AACS_RAT RecName: Full=Acetoacetyl-CoA synthetase;       
   60::501     2e-05  22%  620 aa  S27A2_HUMAN RecName: Full=Very long-chain acyl-CoA synthetase;     
  220::633     2e-05  25%  672 aa  AACS_MOUSE RecName: Full=Acetoacetyl-CoA synthetase;       
  395::483     3e-05  35%  579 aa  FAD21_MYCLE RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
  304::408     4e-05  25%  411 aa  PCL_RHOS4 RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
  200::226     4e-05  63%  701 aa  ORA_PLAFN RecName: Full=Octapeptide-repeat antigen;       
  134::309     8e-05  25%  686 aa  ACSS3_BOVIN RecName: Full=Acyl-CoA synthetase short-chain family
  313::510     3e-04  32%  521 aa  MBTM_MYCPA RecName:
  248::313     4e-04  30%  669 aa  FAT1_YEAST RecName: Full=Very long-chain fatty acid transport
   43::213     9e-04  24%  337 aa  ACSA_NOSLI RecName: Full=Acetyl-coenzyme A synthetase;       
    1::538

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSRIHSANSLVHSLVLDNALKGPDASALVHGDQTLTYASLGETVXXXXXXXXXXXXXXXXXVAIYLPKRP
LCFB_BACSU      ----------------ETASEKPDSIACRFKDHMMTYQELNEYIQRFADGLQEAGMEKGDHLALLLGNSP
GRSB_ANEMI      ----------IQGLFEEQVEKTPDHVAVGWKDQTLTYRELNERANQVARVLRQKGVQPDNIVGLLVERSP
SRFAB_BACSU     ------------------AQQTPDHSAVKAGGNLLTYRELDEQANQLAHHLRAQGAGNEDIVAIVMDRSA
LGRD_BREPA      ----------LHHAFEQQAAKTPENIALEYKEQSLSYAGLNERANQLAHLLIAQGVKPDTTVAICVERSM
LGRC_BREPA      ----------VHQAFEQQVEKTPDAVALVYKDVELTYAELNERANQLAHRLLAEGVKPDELVGICVERSP
GRSB_BREBE      ----------IQGLFEEQVEKTPDHVAVGWKDQALTYRELNERANQVARVLRQKGVQPDNIVGLLVERSP
BACC_BACLI      -------NKTIHQLFEEQAERTPGHTAVVFEKEELSYKALNERSNQLAGLLREKGVKPDMIVGVMAERSV
LGRA_BREPA      -------NKLIMSMLEDWAAATPDKTALVFREQRVTYRELNERVNQLAHTLREKGVQPDDLVMLMAERSV
LCFA_SALTY      -------------------------------------------------------------VALMMPNLL
LCFA_SALTI      -------------------------------------------------------------VALMMPNLL
LCFA_ECO57      -------------------------------------------------------------VALMMPNLL
DHBF_BACSU      ------------------AVLTPERIALMCDDIQVNYRKLNEEANRLARLLIEKGIGPEQFVALALPRSP
LCFA_ECOLI      -------------------------------------------------------------VALMMPNLL
LCFA_ECOL6      -------------------------------------------------------------VALMMPNLL
LCFA_BACSU      -------NKTLQSILTDSAARFPDKTAISFYGKKLTFHDILTDALKLAAFLQCNGLQKGDRVAVMLPNCP
LCFA_YERPE      ------------------ALRYADQPAFINMGEVMTFRKLEESRAFAAYLQQGLGLQKGDRVALMMPNLL
TYCC_BREPA      ----------IQELFEQQAAKTPEHAAVVMDGQMLTYRELNEKANQLAHVLRQNGVGKESIVGLLADRSL
TYCB_BREPA      --REYRADQTIQQLFEELAEKMPEHTALVFEEKRMSFRELNERANQLAAVLREKGVGPAQIVALLVERSA
MYCC_BACSU      ----------IHQLFEEQANRTPDQVAVVYEENQLTYQELNEKANQIARTLQSEGVHPDQPVGIMAERSL
PPSD_BACSU      ----------ISQLFEQQAARTPKASALVSGDKTLTYQELDEWSNGIARALRSRGVKPDTPVGIMMHRSF
BACA_BACLI      ----------IHQLFEEQAKRIPDHTAVVFEDQKLTYRQLNEKANQVARLLREKGVKPDTLVGIMMERSS
LGRB_BREPA      --RHYPTDKLIHQIFXXXXXXXXXXIALVMGEQVLTYRELNEKANQLAKLLRARGIGPESMVSLLTERSA
SRFAA_BACSU     ----------------EQAANTPDHTALQYEGESLTYRELNERANRLARGILSLGAGEGRTAAVLCERSM
GRSA_BREBE      ----------IHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSI
GRSA_ANEMI      ----------IHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSI
DLTA_BACCN      ------------------ATETPDQTAFVWRDAKITYKQLKDDSDALAHWISSEYPDDSSPIMVYGHMQP
PPSC_BACSU      ----------LHGLFERQAAVTPERLAIRFSGGSLTYAELDMYASRLAAHLAARGVTNESIVGVLSERSP
MYCA_BACSU      ----------------------PDDEAVIFGNERCTYGQLNERVNQLARTLRTKGVQADQFVAIICPHRI
ACSF2_MOUSE     ----HLVNTTVGECLDATAQRFPDREALVHENIRLNFAQLKEEVDKAASGLLSIGLRKGDRLGMWGPNSY
4CLL4_ORYSJ     ----------------------------------------------------------------------
PPSA_BACSU      ----------LHGLFERQAAFTPERLAIRFSGGSLTYAELDMYASRLAAHLAARGVTNESIVGVLSERSP
4CLL6_ARATH     ----------------------------------------------------------------------
ACSF2_RAT       ----HLVNKTVGECLDATAQRFPNREALVHENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSY
ACSF2_HUMAN     ----HLNSKTVGQCLETTAQRVPEREALVHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSY
TYCA_BREPA      ----------IHQLFEEQAEAFPDRVAIVFENRRLSYQELNRKANQLARALLEKGVQTDSIVGVMMEKSI
LCFA_HAEIN      ----------------------PDRPAYINMGQVLTFRKLEESRAFAAYLQNEFKLQRGDRVALMMPNLL
MBTB_MYCSS      ------SDDALHDGFFRTAAHTPDATAVIGSTGTLTYAELRERVLAVTGALQVAGIKPGDTVAVMGPKCA
ANGR_VIBAN      ---------LLHQRFFKNVESTPNALAIIHGQESLDYITLASYAKSCAGALTEAGVKSGDRVAVTMNKGI
4CL1_TOBAC      ----------LHSYCFENISEFSSRPCLINGDQIYTYAEVELTCRKVAVGLNKLGIQQKDTIMILLPNSP
4CL2_SOLTU      ----------LHSYCFENLSEFNSRPCLIDGDRIYTYAEVELTSRKVAVGLNKLGIQQKDTIMILLPNCP
FADK_ECOLI      ----------------------PDKIAVVHG-ASYTYSALDHAASCLANWMLAKGIESGDRIAFQLPGWC
DLTA_BACHK      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
DLTA_BACCZ      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
DLTA_BACC3      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
DLTA_BACC0      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
DLTA_BACAH      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
ACVS2_PENCH     ----YPSSKRLHHLIEEVVERHEDKIAVVCDERELTYGELNAQGNSLARYLRSIGILPEQLVALFLDKSE
ACVS1_PENCH     ----YPSSKRLHHLIEEVVERHEDKIAVVCDERELTYGELNAQGNSLARYLRSIGILPEQLVALFLDKSE
PPSB_BACSU      -------NKTIPQLFEEQAHKTPEAAALKMGNECWTYRQLQVRANQIAHALIEKGVGSGDIVAVMMGRSM
DLTA_BACAN      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
DLTA_BACAC      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
DLTA_BACAA      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
ACVS_CEPAC      ----------LHHLFEEAAVRRPQHVALICGDKRITYEELNAMANRLAHHLVSSGIQTEQLVGLFLDKTE
4CL1_SOLTU      ----------LHSYCFENLSEFNSRPCLIDGDRIYTYAEVELTSRKVAVGLNKLGIQQKDTIMILLPNCP
4CLL7_ARATH     -------NTSLVSFLFRNSSSYPSKLAIADSDDSLTFSQLKSAVARLAHGFHRLGIRKNDVVLIFAPNSY
CAIC_SALAR      --------------------------------QHFSYASLNREINRTANLFYSLGIRKGDNVALHLDNCP
DLTA_BACC2      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSAYPDDRSPIMVYGHMQP
DLTA_BACCR      ------------------AAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
DLTA_BACC4      ------------------AAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
ACSF2_MACFA     ----HLLSKTVGRCLEATAQRVPEREALVHENIRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSY
ACVS_EMENI      -----------------------DKVAIVYKRRQLTYGELNAQANCFAHYLRSIGILPEQLVALFLEKSE
DLTA_BACCQ      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
DLTA_BACC1      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
PKSJ_BACSU      -----------HELFEQQAKKTPDRAAVSYEGQTLTYRELDEKSTQLAIYLQAHGVGPDRLAGIYVDRSL
PPSE_BACSU      -------NHTIIDLFREQAEKTPDHTALVYGNMSISYKELDKRSNALARELIQKGFRKNETAGILAAHSP
4CLL9_ARATH     ----------------------------------------------------------------------
BACB_BACLI      -------NKTLSRLFEERAEKTPDHTAVIFEDQQLTYRELNEKANQLAWLLREKGVKPDTIVAIMTDRSL
DLTA_BACC7      ------------------AIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
CAIC_PROSL      -----------------------------------SYSELNEEINRAANLFHACGIKKGDHVALHLDNCP
DLTA_BACLD      ----------------------PDTLAFVNEEEKLTYGELWSQSERLAARIQSEALTDASPIIVYGHMKP
ACSF2_PONAB     ----HLNSKTVGQCLDTTAQRVPEREALVHEDVRLTFGQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSY
4CL2_ARATH      ----------LHDYIFENISEFAAKPCLINGPEVYTYADVHVTSRKLAAGLHNLGVKQHDVVMILLPNSP
MYCB_BACSU      ----YSGNKTVSQLFEEQAERTPDHVAVKFVNNHMTYRELNEKSNRLARTLRNYGVQADTLVAIMAERSL
DLTA_BACWK      ------------------AVETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
MENE_BACSU      --------------LMQRAQLTPERIALIYEDQTVTFAELFAASKRMAEQLAAHSVRKGDTAAILLQNRA
DLTA_BACA2      ----------------------PQAEAFRSLDHSLTYGELWDSERVASGIQKHTADGSKAPVLVYGHMEP
SRFAC_BACSU     ----------------------PDAPALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVVALYTKRSL
LUCI_PHOPE      ----------------------------------------------------------------------
CAIC_SALSV      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYALGIRKGDRVALHLDNCP
CAIC_PROMH      -----------------------------------SYSELNEEINRAANLFHACGIKKGDHVALHLDNCP
MENE_GEOKA      ----------------------------------------------------------------------
CAIC_SALTI      -----------------------------------SYASLNEEINRTANLFYYLGIRKGDRVALHLDNCP
CAIC_SALPB      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCP
CAIC_SALDC      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCP
CAIC_SALNS      -----------------------DDLAGVYGDKTFSYASINEEINRTANLFYSLGIRKGDRVALHLDNCP
CAIC_SALCH      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCP
CAIC_SALA4      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCP
ACSF2_BOVIN     ---LHLSNKTVGRCLDATAQRVPDQEALVHENIRLTFAQLKEEVDKAASGLLSIGLRKGDRLGMWGPNSY
4CL1_PETCR      ----------LHTYCFENISKVGDKSCLINGGETFTYSQVELLSRKVASGLNKLGIQQGDTIMLLLPNSP
DLTA_LACPL      ----------------------------------------------------------------------
CAIC_SALPK      -----------------------DDLAEVYGDKTFSYASLNEEINRTANLFHSLGIRKGDRVALHLDNCP
CAIC_SALPC      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCP
CAIC_SALPA      -----------------------DDLAEVYGDKTFSYASLNEEINRTANLFHSLGIRKGDRVALHLDNCP
4CLL5_ARATH     ----------VTTFISSQAHRGRIAFIDASTGQNLTFTELWRAVESVADCLSEIGIRKGHVVLLLSPNSI
4CL2_PETCR      ----------LHTYCFENISKVGDKSCLINGGETFTYSQVELLSRKVASGLNKLGIQQGDTIMLLLPNSP
DLTA_LACCB      ----------------------------------------------------------------------
DLTA_LACC3      ----------------------------------------------------------------------
CAIC_CITK8      -----------------------------------SYASLNEEINRTANLFLASGIQKGDNVALHLDNCP
MENE_BACLD      ----------------------PDRMAVIQGDHKLTFIQLFHEAKKTAGRLKSFGLKNGDTAALLLTNRM
HTS1_COCCA      ------ATECIHETFSRKVVEHPQREAICSWDGSLTYAELSDLSQRLSIHLVSLGIKVGTKIPICFEKSM
DLTA_LISMC      ----------------------------------------------------------------------
CAIC_SALTY      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCP
CAIC_SALHS      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCP
DLTA_LISIN      ----------------------------------------------------------------------
DLTA_LISW6      ----------------------------------------------------------------------
CAIC_SALEP      -----------------------DDLAGVYGDKTFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCP
DLTA_LISMH      ----------------------------------------------------------------------
DLTA_LISMF      ----------------------------------------------------------------------
DLTA_LACRH      ----------------------------------------------------------------------
FAT2_YEAST      -------------------------------------------------------------VAISMRNGL
DLTA_LISMO      ----------------------------------------------------------------------
BCLA_THAAR      ----------------------------------------------------------------------
PKSN_BACSU      ----------IHEVFEEKAKQTPDAVAVMFEDRSLTYKEVDEKSTSVAVYLQHQGVRPEQPVGICAERSF
DLTA_BACSU      ----------------------PQTDAFRSQGQSLTYQELWESDRAAAAIQKRISGEKKSPILVYGHMEP
CAIC_ECO27      -------------------------------------------------------------VALHLDNCP
4CL_VANPL       -------NLPLHSYCFENISKFSSRPCLINGDEIFTYADVELISRRVGSGLSKLGIKQGDTIMILLPNSP
MENE_BACP2      --------------LLHRAYVTPERVALIYQDKKWTFRDLADEVNELSNRLAQTSLKKGEAVGLLMNNHP
MENE_LISMO      ----------------------------------------------------------------------
MENE_LISIN      ----------------------------------------------------------------------
DLTA_STRPZ      ----------------------------------------------------------------------
DLTA_STRPM      ----------------------------------------------------------------------
DLTA_STRPG      ----------------------------------------------------------------------
DLTA_STRPF      ----------------------------------------------------------------------
DLTA_STRPD      ----------------------------------------------------------------------
DLTA_STRP8      ----------------------------------------------------------------------
CAIC_ECOLU      -------------------------------------------------------------VALHLDNCP
4CLL3_ORYSJ     ----------------------------------------------------------------------
DLTA_STRPC      ----------------------------------------------------------------------
DLTA_STRP6      ----------------------------------------------------------------------
DLTA_STRP3      ----------------------------------------------------------------------
DLTA_STRP1      ----------------------------------------------------------------------
MENE_BACA2      ----------------------------------------------------------------------
CAIC_SHISS      -------------------------------------------------------------VALHLDNCP
CAIC_ECO5E      -------------------------------------------------------------VALHLDNCP
CAIC_ECO57      -------------------------------------------------------------VALHLDNCP
CAIC_ECO45      -------------------------------------------------------------VALHLDNCP
ACVS_NOCLA      ----------LNELFEDVVRRAPDREAVVCGDVRLTYREVNERANQFAHWLIQGPVRVRPGIGLYLDKSD
MENE_GEOSW      ----------------------------------------------------------------------
CAIC_ECOSM      -------------------------------------------------------------VALHLDNCP
CAIC_ECOSE      -------------------------------------------------------------VALHLDNCP
CAIC_ECO55      -------------------------------------------------------------VALHLDNCP
4CL2_TOBAC      ----------LHSYCFENISEFSSRPCLINGKQIYTYADVELNSRKVAAGLHKQGIQPKDTIMILLPNSP
MENE_LISMF      ----------------------------------------------------------------------
CAIC_ECOUT      -------------------------------------------------------------VALHLDNCP
CAIC_ECOK1      -------------------------------------------------------------VALHLDNCP
CAIC_ECO8A      -------------------------------------------------------------VALHLDNCP
MENE_BACC7      --------------LMQRAFLTPDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGM
CAIC_ECOHS      -------------------------------------------------------------VALHLDNCP
ACSM5_RAT       ---------------------------------------------------------------LVLPRLP
CAIC_ECO7I      -------------------------------------------------------------VALHLDNCP
4CLL6_ORYSJ     ----------------------------------------------------------------------
ACSM1_BOVIN     -------------------------------------------------------------LALILPRVP
FAT2_SCHPO      -------------------------------------------------------------VNIAIPNGL
CAIC_ESCF3      -------------------------------------------------------------VALHLDNCP
CAIC_ECO81      -------------------------------------------------------------VALHLDNCP
CAIC_ECO24      -------------------------------------------------------------VALHLDNCP
4CL_PINTA       ----------------------------------------------------------------------
CAIC_SHIDS      -------------------------------------------------------------VALHLDNCP
CAIC_ECOL6      -------------------------------------------------------------VALHLDNCP
CAIC_ECOL5      -------------------------------------------------------------VALHLDNCP
4CLL1_ORYSJ     ----------------------------------------------------------------------
CAIC_SHIFL      -------------------------------------------------------------VALHLDNCP
4CLL2_ORYSJ     ----------------------------------------------------------------------
CAIC_ECOLC      -------------------------------------------------------------VALHLDNCP
4CL3_ARATH      -------------------------------------------------------------IMILLQNSA
MENE_BACC1      --------------LMQRAFLTPDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHIGVKRGQKVAVLMKNGM
ACVS_STRCL      ------ADQRLNDLVEAAVRRSPDREAVVFGTQRLTYREVDARANRFAHWLLGPGLGVRSQVGIFLDKSD
4CL4_ORYSJ      ----------------------------------------------------------------------
MENE_BACCR      --------------LMQRAFLTPDRTAIEIEEEKVTFMELHEKVVSVCEHLTHVGVERGQKVAVLMKNGM
LUCI_LUCCR      ----------------------------------------------------------------------
ACSM3_MOUSE     -------------------------------------------------------------VMVILPKIP
4CLL2_ARATH     ----------------------------------------------------------------------
ACSF3_HUMAN     ----------------------------------------------------------------------
MENE_BACWK      --------------LMQRAFLTPDRTAIEIEEEKVTFVQLHEKVVSVCEHLTHVGVKRAQKVAVLMKNGM
DLTA_STRA5      ----------------------------------------------------------------------
DLTA_STRA3      ----------------------------------------------------------------------
DLTA_STRA1      ----------------------------------------------------------------------
ACSF2_DANRE     ------------------------------------------------------------------PNIY
CAIC_ECOLI      -------------------------------------------------------------VALHLDNCP
CAIC_ECODH      -------------------------------------------------------------VALHLDNCP
CAIC_ECOBW      -------------------------------------------------------------VALHLDNCP
MENE_BACCZ      --------------LMQRAFLTPDRTAIEMEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGM
ENTF_ECO57      -TQVEIPETTLSALVAEQAAKTPDAPALADARYQFSYREMREQVVALANLLREHGVKPGDSVAVALPRSV
MENE_BACAH      ----------------------PDRTAIEIEEEKVTFVQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGM
LUCI_PHOPY      ----------------------------------------------------------------------
4CLL7_ORYSJ     ----------------------------------------------------------------------
3HBCL_THAAR     -----------------------EQTAMLCAERSITYRELDAATNRHGNALRAHGVGKGDRVLFLMDDSP
MENE_BACHK      ----------------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGM
MENE_BACCQ      --------------LMQRAFLTPDRTAIEIEEEKVTFMQLHEKVVSVCGNLTHVGVKRGQKVAVLMKNGM
MENE_BACC0      ----------------------------------------------------------------------
MBTB_MYCPA      ----------------------------------------------------------------------
DLTA_STRE4      ----------------------------------------------------------------------
YDAB_BACSU      -------------LILHDMPNSEEIEAVKSGDHTLTYKGYRKRINQLANAMLQKGIQKGDRVALLCKNGH
DLTA_STRMU      ----------------------------------------------------------------------
ACSM1_MOUSE     -------------------------------------------------------------LALILPRVP
4CL3_DICDI      -------------LILKHIRYKPDQVLLVDGLTFKEYSSVADTIEKVACGLNKLNIKKGDVLGVILPNLP
MENE_BACCN      --------------LMQRAFLTPDRIAIETKEEKITFFALHEKVVSVCENLAYLQIKKGQKVAVLMKNGM
ACSM5_MOUSE     ---------------------------------------------------------------LVLPRLP
MENE_BACAN      ----------------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGM
MENE_BACAC      ----------------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGM
MENE_BACAA      ----------------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGM
LUCI_LUCLA      ----------------------------------------------------------------------
HMWP2_YERE8     ----------------------------------------------------------------------
ACS2B_HUMAN     -------------------------------------------------------------VAVMLPRVP
4CL1_DICDI      ----------VPQLILKHIRSKPDQVLLVDGLTFKEYSSVADTIEKVACGLNKLNIKKGDVLGVILPNLP
ACSA_PSEA6      -----------------------------HSHDIITYHRLHDEVAKIANGLRKLGVGKGDRVAIYMPMIP
4HBCL_RHOPA     --------------------------AFIDPQRSLSYGELRDAVARVGPMLARLGVEQENRIALVLKDTV
DLTA_STAHJ      ------------NLINDFGQSNPERVAVRHKDEELTYQQLMDE----SSKLAHLLQDNHKPLIVYGHMSP
ACSM3_RAT       -------------------------------------------------------------VMVILPKIP
LUCI_LUCMI      ----------------------------------------------------------------------
ENTF_ECOLI      -TQVEIPETTLSALVAEQAAKTPDAPALADARYLFSYREMREQVVALANLLRERGVKPGDSVAVALPRSV
ALKK_PSEOL      ----------------------------------------------------------------------
ENTF_SHIFL      -TQVEIPETTLSALVAEQAAKTPDAPALADARYLFSYREMHEQVVALANLLRERGVKPGDSVAVALPRSV
4CL2_DICDI      -------------LILKHIRSKPDQVLLVDGLTFKEYSSVADTIEKVACGLNKLNIKKGDVLGVILPNLP
ACSA_PASMU      --------------------------------QLYTYAKLHNRVCRFANALRELGIKKGDRVIIYLPMLV
4CLL3_ARATH     --------------------------------------------------------------SIYIPVVC
DLTA_STAAW      ----------------------------------------------------------------------
DLTA_STAAT      ----------------------------------------------------------------------
DLTA_STAAS      ----------------------------------------------------------------------
DLTA_STAAE      ----------------------------------------------------------------------
DLTA_STAAC      ----------------------------------------------------------------------
DLTA_STAA8      ----------------------------------------------------------------------
DLTA_STAA3      ----------------------------------------------------------------------
DLTA_STAAR      ----------------------------------------------------------------------
ACS2A_HUMAN     -------------------------------------------------------------VAVVLPRVP
4CL5_ORYSJ      ----------------------------------------------------------------------
4CL1_ARATH      -------------------------------------------------------------VMLLLPNCP
MENE_OCEIH      ----------------------------------------------------------------------
DLTA_STAAB      ----------------------------------------------------------------------
SID2_USTMA      -------------------------------------------------------------VALYLEKSP
MBTB_MYCTU      ----------------------------------------------------------------------
MBTB_MYCBO      ----------------------------------------------------------------------
ACSM5_HUMAN     ---------------------------------------------------------------LVLPRLP
ACSM2_MOUSE     -------------------------------------------------------------VAVVLPRIP
4CLL4_ARATH     ----------------------------------------------------------------------
DLTA_STAAU      ----------------------------------------------------------------------
DLTA_STAAN      ----------------------------------------------------------------------
DLTA_STAAM      ----------------------------------------------------------------------
DLTA_STAA9      ----------------------------------------------------------------------
DLTA_STAA2      ----------------------------------------------------------------------
DLTA_STAA1      ----------------------------------------------------------------------
SIB1_SCHPO      ----------LHQFVEYFAQKSPNSCALINQDSVLTYSELNERANKLAHNLKSYGFRVGSIIAVYFDKCI
MENE_ENTFA      --------------------KRPDHPAFYFQDESWTFLEVQQEVSHWVATYQQVLAPEEKRVALFSKNSK
ACSM3_PONAB     -------------------------------------------------------------VILILPRVP
ACSM2_RAT       -------------------------------------------------------------VAVVLPRVP
4CLL8_ARATH     ----------------------------------------------------------------------
DLTA_LACLA      ----------------------------------------------------------------------
ACSF3_MOUSE     ----------------------------------------------------------------------
ACSM3_HUMAN     -------------------------------------------------------------VILILPRVP
DLTA_STRZT      ----------------------------------------------------------------------
DLTA_STRPJ      ----------------------------------------------------------------------
DLTA_STRP7      ----------------------------------------------------------------------
ACSM1_HUMAN     -------------------------------------------------------------LALMLPRVP
ACSA_GEMAT      ---------------IDRHVHGPNKAALIWGDRTFTYWDLYREVNLAANMLKKLGVGRGDRVAIYLPMIP
4CL2_ORYSJ      ----------------------------------------------------------------------
DLTA_STRZP      ----------------------------------------------------------------------
DLTA_STRR6      ----------------------------------------------------------------------
DLTA_STRPN      ----------------------------------------------------------------------
DLTA_STRP2      ----------------------------------------------------------------------
ACSM4_RAT       -------------------------------------------------------------VAVILPRIP
ACSM4_HUMAN     -------------------------------------------------------------LAVILPRIP
ACSA_NITEU      -------------------------------------------------------------VVIYMPMRI
ACSA_RUBXD      -------------------------------NRTLTYSELKAEVEKFANVLKGLGVRKGDAVSIYLPMIP
ACSA_PHYBL      -----------------HAFKNPDKIAIIHGDEPITYGELLREVCRMANVLKGLGVRKGDPVAIYMPMIP
DLTA_STAES      ----------------------------------------------------------------------
ACSF3_XENLA     -------------------------------------------------------------VSFLCPNNS
ACSA_LARHH      ----------------------------------ISYRSLYEQVCQFANGLKSLGVGKGDRVVIYMPMVP
4CL3_ORYSJ      ----------------------------------------------------------------------
MENE_STAAR      -------------------------------------------------------------VGLYIDNSI
BAIB_EUBSP      ----------------------------------------------------------------------
ACSA_CHRVO      ----------------------------------VTYSELHRRVCQFANGLKSLGVKKGDRVVVYMPMGI
ACSA_BACSU      ----------------------------------------------------------------------
DLTA_STAEQ      ----------------------------------------------------------------------
MENE_STAES      ----------------------------------------------------------------------
ACSA_COPC7      ------------------AFKHPEKTAIIYEGREISYAELLREVCSIANVLKSFGVKKGDTVSVYLPMTW
CAIC_SHIF8      -------------------------------------------------------------VALHLDNCP
4CL2_SOYBN      ----------LHSYCFQNLSQFAHRPCLIVGSKTFTYADTHLISSKIAAGLSNLGILKGDVVMILLQNSA
MENE_STAEQ      ----------------------------------------------------------------------
ACSA_SYNFM      ------------------AKRGDQVAIIWEGDDPITYRELHDQVCRFANVLKAQGLKKGDRATIYLPMIP
MENE_STAAN      -------------------------------------------------------------VGLYIDNSI
MENE_STAAM      -------------------------------------------------------------VGLYIDNSI
MENE_STAA9      -------------------------------------------------------------VGLYIDNSI
MENE_STAA2      -------------------------------------------------------------VGLYIDNSI
MENE_STAA1      -------------------------------------------------------------VGLYIDNSI
ACSA_DICDI      ----------------------------------VTYREMFEEVCRLSNLLISLGVGKGDTVAIYLPNTP
ACSA_COPCI      ------------------AFKHPEKTAIIYEGREISYAELLREVCSIANVLKSFGVKKGDTVSVYLPMTW
ACSM4_MOUSE     -------------------------------------------------------------VAVILPRIP
ACSA_XYLFA      -------NASVNCLDRHLTLRGDKTALLFEPDSRITYRELYERVCQLGNALRHLNIEKGDRVTIYLPMIP
ACSA_SCHPO      ------AISPCYNLVDRHAIARPDAVALIYEGRYITYRELLASVSQCAGALQSMGVGMGDRVAIYMPMIP
ACSA_PSYIN      ------------------ATKGDQVAILWEGDEKITYKQLHQRVCQFANVLKSQGVRKGDVVCLYMPMTP
ACSA_NOVAD      ----------------------PDSPDEAHRE--ITYRQLHADVCRFANLLKAKGVQKGERVTIYLPMVP
ESYN_FUSEQ      ---IDAQDTLIHSEMLKWTSQSPNKAAVAAWDGEWTYAELDNSSRLAQHINSIDLGKEHAIVPIYFEKSK
ACSA_PYRAE      -------------------------------------------------------------ITLYLPMVP
ACSA_XYLFT      -------NASVNCLDRHLTLRGDKTALLFEPDSRITYRELYERVCQLGNALRHLGIEKGDRVTIYLPMIP
ACSF3_BOVIN     ----------------------------------------------------------------------
ACSA_VIBCH      -------------------------------DKTLTYKQLHQEVCRFANALKEQGVRKGDVVCIYMPMVP
MENE_LACLA      ----------------------------------------------------------------------
DLTA_STAXY      ---------IIYSLI-ENEKMYPEQIAIKHNTDVLTYRELNQYANKLADLIKDTKSP----LIVYGHMSP
ACSA_SALTI      --------------------EGDDASQSKH----ISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
ACSA_BDEBA      -------------------------------------------------------------VTIYMPMIP
ACS1_DEBHA      ------------------AIKNPNKPAIIYEGRIITYGQLLKDVCKLAQCLTKLGIRKGDSVAVYLPMIP
4CL1_ORYSJ      -----------------------------------------------------------------LRNSP
ACSA_SYNY3      ----------------------------------ITYAQLHREVCQFANALKSLGVQKGDRVAIYLPMIP
ACSA_CAUCR      --------------------KKDDVALVFEGDETLTYGQLHEEVCRMANVLKAQGVKKGDRVTIYLPMVP
4CLL9_ORYSJ     ----------VPEFVLDGAEAYADRVALVEGGRSYTYGEVARDTARFARALRSXXXXXXXXXXXALPNLA
MENE_STAAU      -------------------------------------------------------------VGLYIDNSI
MENE_STAAT      -------------------------------------------------------------VGLYIDNSI
MENE_STAAE      -------------------------------------------------------------VGLYIDNSI
MENE_STAAC      -------------------------------------------------------------VGLYIDNSI
MENE_STAA8      -------------------------------------------------------------VGLYIDNSI
MENE_STAA3      -------------------------------------------------------------VGLYIDNSI
ACSA_PYRAR      -------------------------------------------------------------VTLYLPMVP
ACSA_SALTY      -----------------------DRTAIIEGDDTISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
ACSA_NITEC      ----------------------------------------------------------------------
ACSA_BRAJA      --------------------EGDDPSQSRH----ITYKELHDEVCRMANILRTRNVKKGDRVTIYLPMIP
VIBE_VIBCH      -----------------SAERTPNALALVGDNQQWRYQAMLERIEQLAAGFTELGLGCGDNVVLQLGNVA
ACSA_RHOBA      --------------------------------RTLTYAELQTEVAKCAEGLTQLGIGVGDVVSIYMPMTP
ACSA_CITK8      --------------------EGDDATQSKH----ISYRELHRDVCRFANTLLELGIKKGDVVAIYMPMVP
ACSA_SHEFN      --------------------EGDDANE----QRKLTYAELHTQVCKFANALRSQGVNKGDIVTIYMPMVP
ACSA_AERS4      -------------------------------DRKLTYRELHAEVCKFSNVLKAQGVHRGDVVCLYMPMVP
ACSA1_PSEAE     ------------------AERGDQVAIIWEGDQEITYRQLHEQVCKFANALRGQDVHRGDVVTIYMPMIP
MENE_STAAW      ----------------------------------------------------------------------
MENE_STAAS      ----------------------------------------------------------------------
ACSA_THEEB      --------------------------------RTLTYAQLHREVCQFANVLKQLGVKKGDRVGIYMPMIP
ACSA_BEII9      ------------------ATRGDQTAILFEGDRAITYKELHDSVCRLANVLKAHGVGKGDTVSLYLPMIP
MENE_STAAB      ----------------------------------------------------------------------
ACSA_SHEDO      -------------------------------------------------------------VTLYMPMVP
ACSA_PHOPR      -------------------------------DATFTYNELHEQVCKFSNALKSQGVRKGDVVCLYMPMVA
4CLL5_ORYSJ     ----------------------------------------------------------------------
ACSA_DESAA      -------------------------------EEKITYRQLYERVCRFSNVLKSCGVKKGDRVSIYLPMIP
ACSA_SODGM      --------------------EGDDASQ----SKTLTYRQLHQAVCRFANVLKAQGIGKGDVVALYMPMVP
ACSA_SHEHH      --------------------------------RTLTYGQLHTQVCKFANALRSQGVRRGDVVTIYMPMVP
ACSA_ECOLI      --------------------EGDDASQSKH----ISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVP
ACSA_AERHH      -------------------------------DRKLTYRELHTEVCKFANVLKAQGVHRGDVVCLYMPMVP
ACSA_PSESM      ------------------AERGDTIAIIWEGDREITYRELHEEVCKFANALRGQDVHRGDVVTIYMPMIP
ACSA_BRASO      ----------------------------------ITYRQLHDEVCKMANILRNRNVKKGDRVTIYLPMIP
ACS2_CANAL      -----------------HAFANPDKPALIKDSHILTYGDLLREVSKVAGVLQSWGIKKGDTVAVYLPMNA
LCF2_SCHPO      ----------------------------------------------------------------------
ACSA_METFK      ----------------------------------------------------------------------
ACSA_RHOCA      ----------------------------------ITYKELSEKVNRMANVLLSQGIMRGDRVVIYLPMIP
ACSA_EMENI      -----------------HAIKNPNKVAIIYEGRTITYGELLREVSRVAWVLKQRGVKKGDTVAIYLPMIP
ACSA_SYNAS      --------------------RGDQIALLWEGDRSLTYRRLHEEVCRFANVMKSLGLRRGDRVTIYLPMIP
ACSA_ECOL6      --------------------EGDDASQSKH----ISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVP
ACSF4_MOUSE     ----------------------------------------------------------------------
LYS2_SCHPO      ----------------------------------------------------------------------
ACSA_YERPP      ------------------AERGDQTAIIWEGDKTVTYKQLHHDVCQFANVLKSLGVKKGDVVAIYMPMVP
ACSA_YERPN      ------------------AERGDQTAIIWEGDKTVTYKQLHHDVCQFANVLKSLGVKKGDVVAIYMPMVP
ACSA_YERPE      ------------------AERGDQTAIIWEGDKTVTYKQLHHDVCQFANVLKSLGVKKGDVVAIYMPMVP
ACSA_YERPA      ------------------AERGDQTAIIWEGDKTVTYKQLHHDVCQFANVLKSLGVKKGDVVAIYMPMVP
ACSA_SHEPA      --------------------------------RTLTYGQLHAEVCKFANALRSQGVRRGDVVTVYMPMVP
ACSA_LEPIN      -------------------------------------------------------------VLVYLPMIP
ACSA_LEPIC      -------------------------------------------------------------VLVYLPMIP
ACSA_HALHL      -------------------------------DEHITYRDLYERVGRLANALKARGVKKGDRVCIYLPMVP
ACSA_ENTS8      --------------------EGDDATQSKH----ISYRELHRDVCRFANTLTSLGIKKGDVVAIYMPMVP
ACSA_YERPS      ------------------AERGDQTAIIWEGDKTVTYKQLHHDVCQFANVLKSLGIKKGDVVAIYMPMVP
ACSA_YERP3      ------------------AERGDQTAIIWEGDKTVTYKQLHHDVCQFANVLKSLGIKKGDVVAIYMPMVP
ACSA_PSEU2      --------------------RGDSIAIIWEGDREITYRELHAEVCKFANALRGQDVHRGDVVTIYMPMIP
ACS1_CANAL      ------------------AIKNPDKPAIIYGDEPITYGELLKQVSKLAQALTKLGVKKGDSVAVYLPMIP
AAS_SHIFL       ----------------------------------------------------------------------
AAS_SHIF8       ----------------------------------------------------------------------
ACSA_BURPS      ----------------------------------------------------------------------
ACSA_BURP6      ----------------------------------------------------------------------
ACSA_BURP1      ----------------------------------------------------------------------
ACSA_BURP0      ----------------------------------------------------------------------
ACSA_BURMS      ----------------------------------------------------------------------
ACSA_BURMA      ----------------------------------------------------------------------
ACSA_BURM9      ----------------------------------------------------------------------
ACSA_BURM7      ----------------------------------------------------------------------
AAS_SALDC       ----------------------------------------------------------------------
ACSA_PENCH      -----------------HALKNPDKVAIIYEGRKITYGELMREVSRVAWTLKERGVKKGDTVGIYLPMIP
ACSA_MARMS      ----------------------------------ITYQTLHDEVGRLANLLKRQGVKKGDRVAIYMPMIP
ACSA_MAGSM      -------------------------------DRKITYRELSALVNKFANALKARGVKKGDRVCIYMPMIP
AAS_ECOUT       ----------------------------------------------------------------------
AAS_ECOK1       ----------------------------------------------------------------------
AAS_ECO45       ----------------------------------------------------------------------
4CLL1_ARATH     ----------------------------------------------------------------------
ACSA_VIBPA      -------------------------------DKTLTFNELHKEVCKFSNALKDQGVRKGDVVCLYMPMVP
ACSA_PSEHT      ----------------------------------------------------------------------
ACSA_PSE14      ------------------AERGDTIAIIWEGDREITYRELHAEVCKFANALRGQDVHRGDVVTIYMPMIP
ACSA_ECO57      --------------------EGDDASQSKH----ISYKELHRDVCRFANTLLKLGIKKGDVVAIYMPMVP
ACSA1_PSEPK     ----------VSSNCLDRHLRGDQLAIIWEGDRNITYRELHEQVCKFANALRGQDVHRGDVVTIYMPMIP
ACSA_METSO      ----------------------------------------------------------------------
AAS_SHISS       ----------------------------------------------------------------------
AAS_SHIB3       ----------------------------------------------------------------------
AAS_SALTI       ----------------------------------------------------------------------
AAS_SALSV       ----------------------------------------------------------------------
AAS_SALPK       ----------------------------------------------------------------------
AAS_SALPB       ----------------------------------------------------------------------
AAS_SALPA       ----------------------------------------------------------------------
AAS_SALHS       ----------------------------------------------------------------------
AAS_SALG2       ----------------------------------------------------------------------
AAS_SALEP       ----------------------------------------------------------------------
AAS_SALA4       ----------------------------------------------------------------------
AAS_ECOSM       ----------------------------------------------------------------------
AAS_ECOSE       ----------------------------------------------------------------------
AAS_ECOLU       ----------------------------------------------------------------------
AAS_ECOLI       ----------------------------------------------------------------------
AAS_ECOLC       ----------------------------------------------------------------------
AAS_ECOL6       ----------------------------------------------------------------------
AAS_ECOHS       ----------------------------------------------------------------------
AAS_ECODH       ----------------------------------------------------------------------
AAS_ECOBW       ----------------------------------------------------------------------
AAS_ECO5E       ----------------------------------------------------------------------
AAS_ECO57       ----------------------------------------------------------------------
AAS_ECO55       ----------------------------------------------------------------------
AAS_ECO27       ----------------------------------------------------------------------
AAS_ECO24       ----------------------------------------------------------------------
ACSA_SERP5      ------------------AERGDQTAIIWEGDKQVTYKQLHHDVCQFANXXXXXXXXXXXXXAIYMPMVP
AAS_SALTY       ----------------------------------------------------------------------
AAS_SALPC       ----------------------------------------------------------------------
AAS_SALNS       ----------------------------------------------------------------------
AAS_SALCH       ----------------------------------------------------------------------
AAS_ECOL5       ----------------------------------------------------------------------
AAS_ECO7I       ----------------------------------------------------------------------
ACSA_ALHEH      --------------------RGDQTAIIWEGDEHITYKDLHERVCRLANAMKARGVKKGDRVCIYLPMIP
AAS_KLEP3       ----------------------------------------------------------------------
AAS_ENT38       ----------------------------------------------------------------------
4CLL8_ORYSJ     ----------------------------------------------------------------------
ACSA_YERE8      ------------------AERGDQTAIIWEGDKTVTYKQLHHDVCQFANVLKKLGIKKGDVVAIYMPMVP
ACSA_VIBVY      ------------------AERGDDVAIIWEGDKTLTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVP
ACSA_VIBVU      ------------------AERGDDVAIIWEGDKTLTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVP
ACSA_THIDA      ----------------------------------------------------------------------
ACSA_SHESH      -----SANCLDRHLEKDSIWEGDDAK----DQRTITYGELHSDVCKFANALRSQGVRRGDIVTVYMPMVP
ACSA_PHOLL      ---------------LDRHLKGEQTAIIWEGDKAITYRELHHDVCQFANVLKNMGIKKGDVVAIYMPMVP
ACSA_BURTA      ----------------------------------------------------------------------
4CL1_SOYBN      ----------------------------------------------------------------------
ACSA_XANP2      --------------------RGDQVAIIWEGDRNITYRELSSEVNKLANVLRNRGVEKGDRVTIYLPMIP
AAS_YERE8       ----------------------------------------------------------------------
ACSA_THET2      -------------------------------ERVLTYHDLWREVQRFANVLKRLGVKKGDRVTIYLPMIP
ACSA_PARL1      -------------------------------DRKITYRELHDEVCRFANVLKARGVKKGDRVTIYMPMIP
ACSA_NEUCR      -----------------HAHKDPNRVAIIYEGRNVTYGELLREVSKLAHVLTNLGVRKGDTVAIYLPMIP
ACSA_MARAV      --------------------RGDQTAIIFEGDRNVTYRELYEETCKFANVLKDQGVKKGDVVTIYMPMIV
AAS_PECCP       ----------------------------------------------------------------------
AAS_ESCF3       ----------------------------------------------------------------------
ACSL4_HUMAN     -------------------------------------------------------------IAIFCETRA
ACSA_THET8      -------------------------------ERVLTYHDLWREVQRFANVLKRLGVKKGDRVTIYLPMIP
ACSA_BART1      -------------------------------DKKITYNELYEHVCRFANLLKNHGVKKGDKVTIYLPMIP
ACS2_DEBHA      -----------------HAFATPNKPAIIYDSKILTFAELLREVCQVAGVLQSWGIKKGDTVAIYMPMNS
4CL4_ARATH      ----------------------------------------------------------------------
ACSA_RHOP5      ----------------------------------ITYRQLHDEVCKMANVLRNRNVQKGDRVTIYLPMIP
AAS_ERWCT       ----------------------------------------------------------------------
ACSA_SHEAM      -----SANCLDRHL----ASKGDDVAIIWEGDDAVTYRELHAEVCQFANALKAEGVKRGDVVTIYMPMVV
ACSA_RHILO      -----------------------------YDDKKITYNELYERVCRLANVMKKHGVKKGDRVTIYMPMIP
ACSA_LEPBJ      -------------------------------------------------------------VLVYLPMIP
ACSA_BURS3      ----------------------------------VTYADLLARVSRFANALKKRGIGKGDRVVIYIPMSI
ACSF4_HUMAN     ----------------------------------------------------------------------
AAS_CITK8       ----------------------------------------------------------------------
LYS2_CANGA      ----------IHDIFQDNAEKFPERTCVVETPRTFTYKDINEASNIVAHYLINTGIKRGDVVMIYSSRGV
ACS2_ASHGO      -----------------HALENPDKVAIIYDNRVVTFGELLRQVSQVAGVLQSWGVKKGDTVAVYMPMIP
ACSA_CRYPV      --------------------EGDDPSSIRH----ISYIELFRNVCKMANVLKRFGIKKGDSVGIYMPMIP
AAS_YERPY       ----------------------------------------------------------------------
AAS_YERPS       ----------------------------------------------------------------------
AAS_YERPP       ----------------------------------------------------------------------
AAS_YERPG       ----------------------------------------------------------------------
AAS_YERPB       ----------------------------------------------------------------------
AAS_YERP3       ----------------------------------------------------------------------
ACSA_BARQU      -------------------------------DKKITYNELYEHVCRFANILKNHGVKKGDRVTIYLPMIP
ACSA_BARHE      -------------------------------DKKITYNELYEHVCRFANILKNHGVKKGDKVTIYLTMIP
ACS2_ZYGBA      -----------------HAFANPDKPALIYDNRMITFSELLRQVSRVAGVLQSWGVKKGDTVAVYLPMIP
ACSA_METSB      ----------------------------------ITYKQLHEEVCRLANVLKSYGISKGDTVTIYLPMIP
ACSA_LEPBL      -------------------------------------------------------------VLVYLPMIP
ACSA_AGRT5      -------------------------------DKKITYNQLYDYVCRLANVLKKHGVKKGDRVTIYMPMIP
ACS2_YEAST      -----------------HAFANPDKPALIYDNKIITFGELLRKVSQIAGVLKSWGVKKGDTVAIYLPMIP
DHBE_BACSU      ----------------------------------------------------------------------
ACSA_SHESA      ----------------------------------ITYGELHTQVCKFANALRSQGVRRGDIVTIYMPMVP
ACSA_METPB      --------------------RGDQTAIIWEGDQHITYKQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIP
ACS1_CANGA      -------------------------------------------------------------VAVYMPMIP
AAS_YERPE       ----------------------------------------------------------------------
AAS_YERPA       ----------------------------------------------------------------------
LYS2_PENCH      ----------------------------------------------------------------------
ACSL4_MOUSE     -------------------------------------------------------------IAIFCETRA
ACBG1_BOVIN     ----------------------------------------------------------------------
LCF1_SCHPO      ----------------------------------------------------------------------
AAS_ENTS8       ----------------------------------------------------------------------
ACSA_LEPBP      ---------------LDSPLKNK-AALIWEGDKVLTYHDLHREVNHFANVLKKFKVKKGDRVLIYLPMVP
ACSA_LEPBA      ---------------LDSPLKNK-AALIWEGDKVLTYHDLHREVNHFANVLKKFKVKKGDRVLIYLPMVP
ACSL4_RAT       -------------------------------------------------------------IAIFCETRA
ACSL3_PONAB     -------------------------------------------------------------IAIFCETRA
ACSL3_HUMAN     -------------------------------------------------------------IAIFCETRA
ACSA_XANAC      -------NASVNCLDRQLATRGDKTALLFEPDSPVTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIV
ACSA_SHESR      ----------------------------------ITYGELHTQVCKFANALRSQGVRRGDIVTIYMPMVP
ACSA_SHESM      ----------------------------------ITYGELHTQVCKFANALRSQGVRRGDIVTIYMPMVP
ACSA_METEP      ------------------ATRGDQTAIIWEGDDPITYRQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIP
MENE_SALTY      ------------------------APALRLNDEVLSWRALCERIDVLAGGFAAQGVREGDGVLLRAGNQP
ACSA_DEIRA      --------------------------------RTYTYAELLREVCKAANALEELGVVAGDRVTLYMPLIP
ACS2_KLULA      ----------------------------------------------------------------------
AAS_KLEP7       ----------------------------------------------------------------------
LYS2_YEAST      ----------IHDIFQDNAEAFPERTCVVETSRSFTYRDINRTSNIVAHYLIKTGIKRGDVVMIYSSRGV
ACSA_XANOM      -------NASVNCLDRQLATRGDKTALLFEPDSPVTYRQLYERVCKLGNALRNLGVKKGDRVTIYLPMIV
ACSA_SHEON      ----------------------------------ITYGELHTQVCKFANALRSQGVRRGDIVTIYMPMVP
ACSA_METRJ      -------------------------------------------------------------VTLYMPMIP
ACSA_BURP8      ----------------------------------------------------------------------
ACS1_ASHGO      -----------YNLVDRHAARTPDKVAIIYADESLTYRELAQVCKVAQVLQYSMGVRKGDTVAVYMPMIP
ENTE_ECO57      ----------------------------------------------------------------------
ACSA_WOLSU      -------------------------------------------------------------VVIYMPMIP
ACSA_SHELP      --------------------EGDDAA----DQRTLTYGELHTEVCKFANALRSQGVRRGDVVTVYMPMVP
ACSA_HELAH      -------------------------------------------------------------VIIYMPMIA
ACS1_KLULA      -----------YNLVDRHAFTQPNKVAILYADESLTYAELLEQVCKVAQILQYSMNVKKGDVAVYMPMIP
ENTE_ECOLI      ----------------------------------------------------------------------
ACSM6_HUMAN     ---------------------------------------------------------------IILPPTP
ACSA_METC4      ------------------ATRGDQTAIIWEGDDPITYRQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIP
ACSA_HERAR      ----------------------------------------------------------------------
ESYN_GIBPU      ----------------------------------------------------------------------
AAS_ERWT9       ----------------------------------------------------------------------
S27A5_HUMAN     ----------------------------------------------------------------------
ACSA_BARBK      -----------------------------YSDKKITYNELYEHVCRFANILKNHGVKKGDRVSIYLPMIP
ACBG1_RAT       ----------------------------------------------------------------------
S27A5_MOUSE     ----------------------------------------------------------------------
ACSA_SHESW      ----------------------------------ITYGELHADVCKFANALRSQGVRRGDIVTIYMPMVP
ACSA_SHEPC      ----------------------------------ITYGELHADVCKFANALRSQGVRRGDIVTIYMPMVP
ACSA_HELPY      -------------------------------------------------------------VIIYMPMIV
ACSA_HELPH      -------------------------------------------------------------VIIYMPMIV
ACSA_HELPG      -------------------------------------------------------------VIIYMPMIV
ACSA_ALCBS      ----------------------------------------------------------------------
ACSA_RALSO      ----------------------------------------------------------------------
ACSA_DROME      ----------------------------------------------------------------------
ACBG1_MOUSE     ----------------------------------------------------------------------
ACSA_HELP2      -------------------------------------------------------------VIIYMPMIV
ACSA_STRCO      --------------------------------RALTYAQLKDEVSKAANALLELGVQKGDRVAIYMPMIP
LCF4_YEAST      ----------------------------------------------------------------------
ACSF4_DANRE     ----------------------------------------------------------------------
ACSA_PSYA2      -------------------------------------------------------------VTLYMPMIP
ACSA_MYCTU      --------------------------------RTLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIP
ACSA_MYCBO      --------------------------------RTLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIP
ACSA_CHLTE      -------------------------------ERILTYGELHRQVSKFANVLKIAGIKPGDKVAIYMGMVP
ACSA2_PSEAE     ----------------------------------ITYRKLHHNVCRLANVLKSRGVEKGDRVCIYMPMIP
ACS2L_MOUSE     --------------------KSPETIALIWEEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSP
ACBG1_MACFA     ----------------------------------------------------------------------
ACSA2_RHIME     -------------------------------DKKITYNELYDKVCRLANVLKEQGVKKGDRVTIYMPMIP
ACBG1_HUMAN     ----------------------------------------------------------------------
S27A5_RAT       ----------------------------------------------------------------------
S27A3_MOUSE     -------------------------------------------------------------VALLLPAGP
LCFH_HAEIN      ----------------------------------------------------------------------
ACSA_RHILW      ----------------------------------------------------------------------
ACSA_RALME      ----------------------------------------------------------------------
ACSA2_PSEPK     ------------------AQRGEQTALLWEGDKAITYRELHRQVCRLANAMKARGVKKGDRVSIYMPMIP
VRAA_STAEQ      ----------------------------------------------------------------------
MENE_ECOLI      ----------------------------------------------------------------------
ACBG2_CHICK     ----------------------------------------------------------------------
FCSA_DICDI      -------------------------------------------------------------IGIFSINRP
FAD21_MYCTU     ----------------------------------------------------------------------
FAD21_MYCBO     ----------------------------------------------------------------------
ACSA_RHISN      -------------------------------DKRITYNELYDKVCRLANVLKKHGVEKGDRVTIYMPMVP
ACSA_RALEJ      ----------------------------------------------------------------------
ACSA_PRB01      ----------------------------------LTYKELHDEVCKFANVLKDLGVQKGSRVCIYMPMII
ACS2_CANGA      ----------------------------------------------------------------------
S27A4_PONAB     ----------------------PDKTALIEGTDTLTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRN
ACSA_PSYCK      -------------------------------------------------------------VTLYMPMIP
ACSA_RALEH      -------------------------------------------------------------VVIYMPMSV
S27A4_MOUSE     ----------------------PDKTALIFEDTHWTFRQLDEYSSSVANFLQARGLASGNVVALFMENRN
PRPE_ECOLI      -------------------------------------------------------------VLVYMPMIA
ACSA_SACD2      -------------------------------DASITYQQLHDAVCKFANVLKARGVAKGDRVCIYMPMIP
ACSA_RALPJ      ----------------------------------------------------------------------
S27A4_MACFA     ----------------------PDKTALIFEDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRN
ACSL1_HUMAN     -------------------------------------------------------------IGIFAQNRP
ACSA_AGRRK      -------------------------------DKKVTYNELYEHVCRLANVLKKHGVKKGDRVTIYMPMIP
S27A3_HUMAN     -------------------------------------------------------------VALLLPAGP
ACSL3_RAT       -------------------------------------------------------------IAIFCETRA
ACSA_RHIEC      ----------------------------------------------------------------------
ACSA_RHIE6      ----------------------------------------------------------------------
ACSA_AGRVS      ----------------------------------------------------------------------
FAD11_MYCTU     ----------------------------------------------------------------------
ACSL5_HUMAN     -------------------------------------------------------------VGIFAQNRP
ACSA_XANCP      -------NASVNCLDRQLATRGDKTALLFEPDSPVTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIV
ACSA_XANC8      -------NASVNCLDRQLATRGDKTALLFEPDSPVTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIV
ACSA_CUPTR      ----------------------------------------------------------------------
ACSA_BRUSU      ----------------------------------------------------------------------
ACSA_BRUSI      ----------------------------------------------------------------------
ACSA_BRUO2      ----------------------------------------------------------------------
ACSA_BRUME      ----------------------------------------------------------------------
ACSA_BRUMB      ----------------------------------------------------------------------
ACSA_BRUC2      ----------------------------------------------------------------------
ACSA_BRUAB      ----------------------------------------------------------------------
ACSA_BRUA2      ----------------------------------------------------------------------
ACSA_BRUA1      ----------------------------------------------------------------------
ACBG2_MOUSE     ----------------------------------------------------------------------
BGM_DROME       ----------------------------------------------------------------------
ACSL3_MOUSE     -------------------------------------------------------------IAIFCETRA
ACSA_SINMW      -------------------------------DKKITYNELYDTVCRLANVLKKHGVKKGDRVTIYMPMIP
VRAA_STAES      ----------------------------------------------------------------------
S27A4_HUMAN     ----------------------------------------------------------------------
ACBG2_XENLA     ----------------------------------------------------------------------
S27A2_MOUSE     ---------------LEQARKTPHKPFLLFRDETLTYAQVDRSNQVARALHDQLGLRQGDCVALFMGNEP
FAD28_MYCBO     ----------------------------------------------------------------------
FAD26_MYCTU     ----------------------------------------------------------------------
ACSA_STRAW      --------------------------------RAITYAELKDEVSKAANALTELGVQKGDRVAVYLPMIP
ACSA_AGRRH      -------------------------------DRKITYRELYEHVCRMANVLKKHGVKKGDRVTIYMPMVP
S27A1_RAT       ----------------------------------------------------------------------
PRPE_SALTY      --------NLCHNAVDRWRDKQPEALALIDEERTFTFSQLHDEVNIVAAMLLSLGVQRGDRVLVYMPMIA
MBTM_MYCSS      ----------------------------------------------------------------------
ACSA_PSEU5      -----SANCLDRHL----AERGDQVAIIWEGDREITYRELYQEVCKFANALRGQDVHRGDVVTIYMPMIP
ACSB_DICDI      ----------------------------------------------------------------------
ACSA_SHEB9      ----------------------------------ITYGELHAEVCKFANALRSQGVRRGDIVTIYMPMVP
ACSA_SHEB8      ----------------------------------ITYGELHADVCKFANALRSQGVRRGDIVTIYMPMVP
ACSA_SHEB5      ----------------------------------ITYGELHADVCKFANALRSQGVRRGDIVTIYMPMVP
S27A1_MOUSE     ----------------------------------------------------------------------
LCF1_YEAST      ----------------------------------------------------------------------
Y3568_PSEAE     -------------------------------------------------------------VIIYMPMVP
ACSL6_MOUSE     -------------------------------------------------------------VGVFAQNRP
ACSA_OCHA4      ----------------------------------------------------------------------
ACSL6_HUMAN     -------------------------------------------------------------IGVFAQNRP
VRAA_STAHJ      ----------------------------------------------------------------------
S27A2_RAT       ---------------LEQARKTPHKPFLLFRDETLTYAQVDRSNQVARALHDHLGLRQGDCVALFMGNEP
ACSL1_MOUSE     -------------------------------------------------------------IGLFSQNRP
S27A1_HUMAN     ----------------------------------------------------------------------
S27A1_BOVIN     ----------------------------------------------------------------------
FAD25_MYCTU     ---------------------------------------------------------------ILAPQSL
ACS2L_HUMAN     --------------------KSPESVALIWEEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSP
LCF3_YEAST      ----------------------------------------------------------------------
ACSL5_RAT       -------------------------------------------------------------IGIFAQNRP
ACSL5_MOUSE     -------------------------------------------------------------VGIFAQNRP
ACSL1_RAT       -------------------------------------------------------------IGIFSQNRP
ACSL1_CAVPO     -------------------------------------------------------------IGIFAQNRP
AACS_CHICK      ----------------------------------------------------------------------
ACS1_YEAST      -----------------HALKTPNKKAIIEGDESITYKELLEEVCQVAQVLTYSMGVRKGDVAVYMPMVP
ACBG2_RAT       ----------------------------------------------------------------------
S27A6_HUMAN     -------------------------------------------------------------VALLMSNEP
BGML_DROME      ----------------------------------------------------------------------
MENE_HAEIN      ----------------------------------------------------------------------
ACSA_MOUSE      -------------------------------------------------------------VAIYMPMIL
ACSL6_RAT       -------------------------------------------------------------IGVFAQNRP
AAS_PHOLL       ----------------------------------------------------------------------
ACSS3_HUMAN     -------------------------SPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIP
ACSS3_PONAB     -------------------------SPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIP
ACBG2_HUMAN     ----------------------------------------------------------------------
ACSS3_MOUSE     ---------------------------------TISYKEVLEQVSKLAGVLVKQGVKKGDTVVIYMPMIP
ACSA_CAMJJ      -------------------------------------------------------------VVIYMPMIP
ACSA_CAMJE      -------------------------------------------------------------VVIYMPMIP
ACSA_CAMJ8      -------------------------------------------------------------VVIYMPMIP
FAT1_COCHE      ----------------------------------------------------------------------
LCF2_YEAST      -------------------------------------------------------------VAILSHNNP
FCSB_DICDI      ----------------------------------------------------------------------
ACSA_HUMAN      -------------------------------------------------------------VAIYMPMIP
AACS_RAT        ----------------------------------------------------------------------
S27A2_HUMAN     ---------------LEKARQTPHKPFLLFRDETLTYAQVDRSNQVARALHDHLGLRQGDCVALLMGNEP
AACS_MOUSE      ----------------------------------------------------------------------
FAD21_MYCLE     ----------------------------------------------------------------------
PCL_RHOS4       ----------------------------------------------------------------------
ORA_PLAFN       ----------------------------------------------------------------------
ACSS3_BOVIN     -------------------------SPVTNTKATITYKEVLEQVSKLAGVLVKHGVKKGDTVVIYMPMIP
MBTM_MYCPA      ----------------------------------------------------------------------
FAT1_YEAST      ----------------------------------------------------------------------
ACSA_NOSLI      -----------------------------NADSKVTYRELHARVCQLANAMRGMGVQKGDRVCIYLPMIE


                         .         .         *         .         .         .         .:140
query           ETVVTLFXXXXXXXVFVPINPLLKPRQVAHILRDCNVRVLVTASNRIDFLQDALAECHDLRSLVIVDAPT
LCFB_BACSU      DFIIAFFGALKAGIVVVPINPLYTPTEIGYMLTNGDVKAIVGVSQLLP-LYESMHESLPKVELVILCQTG
GRSB_ANEMI      EMLVGIMGILKAGGAYLPLDPEYPADRISYMIQDCGVRIMLTQ-------QHLLSLVHDEFDCVILDE--
SRFAB_BACSU     EVMVSILGVMKAGAAFLPIDPDTPEERIRYSLEDSGAKFAVVNERNMT----AIGQYEGI--IVSLDDGK
LGRD_BREPA      EMIIGILGVLKAGAAYVPIDPAHPEERIAYMLDDSQAVVVLTQAGLADKFTQAAAPVICLGEKLFADRAH
LGRC_BREPA      EMIVAFLGVMKAGAAYVPLDPAHPQERIAYMIEDSQASVLLTQASLTDRLPASSRQVICLDSDELANEPV
GRSB_BREBE      EMLVGIMGILKAGGAYLPLDPEYPADRISYMIQDCGVRIMLTQ-------QHLLSLVHDEFDCVILDE--
BACC_BACLI      EMIVGMLAVLKAGGAYLPIDPEYPEDRIRYMIEDSGISILLKKADKVDFT------CIDMNE--------
LGRA_BREPA      EMMVAIFAVLKAGGAYLPIDPHSPAERIAYIFADSGAKLVLAQSPFVE--KASMAEVVDLNSASSYAADT
LCFA_SALTY      QYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGAAAIIIVSNFAHTLEDQLSTAKGTVVNFVVKYIK
LCFA_SALTI      QYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGAAAIIIVSNFAHTLEDQLSTAKGTVVNFVVKYIK
LCFA_ECO57      QYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIVSNFAHTLEDQLSTAKGTLVNFVVKYIK
DHBF_BACSU      EMVASMLGVLKTGAAYLPLDPEFPADRISYMLEDAKPSCIITTEEIAASLPDDLA----VPELVLDQAVT
LCFA_ECOLI      QYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIVSNFAHTLEDQLSTAKGTVVNFVVKYIK
LCFA_ECOL6      QYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIVSNFAHTLEDQLSTAKGTVVNFVVKYIK
LCFA_BACSU      QTVISYYGVLFAGGIVVQTNPLYTEHELEYQLRDAQVSVIIT----LDLL---FPKAIKMKTLSIVDQPK
LCFA_YERPE      QYPIALFGVLRAGMIVVNVNPLYTPRELEHQLSDSGAVAIVIVSNFAHTLEDQLSAAKGTLVNFVVKYIK
TYCC_BREPA      EMITGIMGILKAGGAYLGLDPEHPSERLAYMLEDGGVKVVLVQKHLLPLVGEGLMP-------IVLEEES
TYCB_BREPA      EMVIATLATLKAGGAFLPVDPDYPEERIRYMLEDSQAKLVVTHAH---LLHKVSSQSEXXXXXXPGSYAT
MYCC_BACSU      EMIVGLFGILKAGGAYVPIDPTYPEERIRYILEDSDTKLLLVQ--------------HHLREKVPFTGKV
PPSD_BACSU      SMIASILGVWKAGGCYVPIDPEYPKERKRYILSDSGTKLLMTINEA------------DLGVLADFEGEI
BACA_BACLI      DMIAAILGVLKAGGAYLPIDPEYPPERMRYMAFDSEVKVIIS--------DVPLAEELTAESIELIHMDD
LGRB_BREPA      EMMIAILAIFKAGGAYLPIDPSHPKERIEYILQDSRSELLLV-NHRFLGAVDFADRIIDLEAAEIYQGAA
SRFAA_BACSU     DMIVSILAVLKSGSAYVPIDPEHPIQRMQHFFRDSGAKVLLTQRKL-----KALAEEAEFKGVIVLADEE
GRSA_BREBE      DLFIGILAVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLI-------HNIQFNGQVEIFE
GRSA_ANEMI      DLFIGILAVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLI-------HNIQFNGQVEIFE
DLTA_BACCN      DMIISFLGCVKAGHAYIPVDLSIPADRVLRIAESSGAKLLLSAAE-----------------LTVTDLPV
PPSC_BACSU      DMLIAVLAVLKAGGAYLPLDPAYPKERLSYMLKDSGASLLLT--------QPGCSAPNFSGETLEVDMTS
MYCA_BACSU      ELIVGILAVLKAGGAYVPIDPEYPEDRIQYMLKDSEAKIVLAQL--------------DLHKHLTFDADV
ACSF2_MOUSE     AWVLIQLATAQAGIILVSVNPAYQSSELEYVLRKVGCKGIVKTQQYYDILKQVCPELEDLTTVISVDAPL
4CLL4_ORYSJ     --------------VLTTANPLNTPAEIAKQVADARPVLAFTTRE----LLPKLPRAHDLRVVLLESA--
PPSA_BACSU      DMLIAVLAVLKAGGAYLPLDPAYPKERLSYMLKDSGASLLLTQPG--------------------CSAPN
4CLL6_ARATH     ----------------------------------------------------------------------
ACSF2_RAT       AWVLIQLATAQAGIILVSVNPAYQASELEYVLRKVGCKGIVKTQQYYNILKQVCPELEDLTTVISVDAPL
ACSF2_HUMAN     AWVLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVKTQQYYNVLKQICPEVEDLTTVISVDAPL
TYCA_BREPA      ENVIAILAVLKAGGAYVPIDIEYPRDRIQYILQDSQTKIVLTQKSVSQLVHD------------------
LCFA_HAEIN      QYPIALFGILRAGLIAVNVNPLYTPRELELQLQDSGAVAIVVVSNFASTLEKVVFNTN-VKHVILTRMGD
MBTB_MYCSS      DQVTALLAIHAAGAVYVPIGADQPADRADSILQTAGVRMALACGDEPPTFLPALTIAEAVRVGSRVHGVT
ANGR_VIBAN      GQIVAVLGILYAGAIYVPVS-LDQPQE----------------------RRESIYQGAGINVILINESDS
4CL1_TOBAC      EFVFAFMGASYLGAISTMANPLFTPAEVVKQAKASSAKIIITQSCFVGKVKDYASE-NDVKVICIDSAP-
4CL2_SOLTU      EFVFAFIGASYLGAISTMANPLFTPAEVVKQAKASSAKIVITQACFAGKVKDYAIE-NDLKVICVDSAPE
FADK_ECOLI      EFTVIYLACLKIGAVSVPLLPSWREAELVWVLNKCQAKMLFKQTRPVDXXXXXXXXXXXXXXXVGVDAPA
DLTA_BACHK      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA-----------------AVTVTDLPV
DLTA_BACCZ      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA-----------------TVTVTDLPV
DLTA_BACC3      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA-----------------AVTVTDLPV
DLTA_BACC0      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA-----------------AVTVTDLPV
DLTA_BACAH      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA-----------------AVTVTDLPV
ACVS2_PENCH     KLIVTILGVWKSGAAYVPIDPTYPDERVRFVLDDTKARAIIASNQHVERLQ---REVIGDRNLCII----
ACVS1_PENCH     KLIVTILGVWKSGAAYVPIDPTYPDERVRFVLDDTKARAIIASNQHVERLQ---REVIGDRNLCII----
PPSB_BACSU      EMPAALLGIWKAGGAYMPLDPHFPAERLSFLLKDSQAAQLLIEEDLISLIPPSY------------EGNT
DLTA_BACAN      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA------------------VTVTDLPV
DLTA_BACAC      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA------------------VTVTDLPV
DLTA_BACAA      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA------------------VTVTDLPV
ACVS_CEPAC      LMIATILGIWKSGAAHVPIDPGYPDERVKFVLNDTKAQVVIASQRHVDRLRAEAVGGQHLRIIGL----E
4CL1_SOLTU      EFVFAFIGASYLGAISTMANPLFTPAEVVKQAKASSAKIVITQACFAGKVKDYAIE-NDLKVICVDSVPE
4CLL7_ARATH     QFPLCFLAVTAIGGVFTTANPLYTVNEVSKQIKDSNPKIIISVNQLFDKIKG-----FDLPVVLLGSKDT
CAIC_SALAR      EFIFCWFGLAKIGAIVVPINARLLREESAWILQNSRTSLLVTSAPFYPMYRQIQQEGRTPLSHICLIGPT
DLTA_BACC2      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAA-----------------AVTVTDLPV
DLTA_BACCR      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAT-----------------AVTVTDLPV
DLTA_BACC4      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAT-----------------AVTVTDLPV
ACSF2_MACFA     AWVLIQLATAQAGIILVSVNPAYQATELEYVLKKVGCKALVKTQQYYNILKQICPEVEDLTTVISVDAPL
ACVS_EMENI      NLIVTILGIWKSGAAYVPIDPTYPDERVRFVLEDTQAKVIIASNHLAERLQSEVISDREL-SIIRLEHCL
DLTA_BACCQ      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSGTE-----------------VTVTDLPV
DLTA_BACC1      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSGTE-----------------VTVTDLPV
PKSJ_BACSU      DMLVGLLAILKAGGAYVPLDPSYPAERLEYMLEDSEVFITLTTSELVN-------------TLSWNGVTT
PPSE_BACSU      EFMISVLAVLKAGGAYLPLDAELPPERVSFMLEETQAKMLI--------VQKGLEQNAAFSGTCIISDAQ
4CLL9_ARATH     ----------------------------------------------------------------------
BACB_BACLI      EMXXXXXXXLKAGGAYLPIDPDYPEDRVKYMLEDSGADMVV--------IQEPFKSKIDGRQLITAE---
DLTA_BACC7      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSGTE-----------------VTVTDLPV
CAIC_PROSL      EFFFCWFGLAKIGAVMVPINARFMYEESAWIINHCQAHFVVTSDNFSPIYQPMLHDKHSLTQLFLITEPT
DLTA_BACLD      VMAVSFLACVKAGHPYIPVDVSIPADRILKIINSSKAELLLNNSGTSVDTGDALIS--------------
ACSF2_PONAB     AWVLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVKTQQYYNILKQICPEVDDLTTVISVDAPL
4CL2_ARATH      EVVLTFLAASFIGAITTSANPFFTPAEISKQAKASAAKLIVTQSRYVDKIKNLQND-----GVLIVTTDS
MYCB_BACSU      EMIVSIMAIWKAGGAYVPLDPEYPEERLQYVLNDANADVLVVQRH--------------FKNSLVFDGPM
DLTA_BACWK      EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAESSGAKLLLSGAE-----------------VTVTDLPV
MENE_BACSU      EMVYAVHACFLLGVKAVLLNTKLSTHERLFQLEDSGSGFLLTDSS----------------------FEK
DLTA_BACA2      NMIVSFLGSVKAGRPYIPVDVSIPAERIVKIIESSGAELLISVSG------DA------------VDTGS
SRFAC_BACSU     ELVIGILGVLKAGAAYLPVDPKLPEDRISYMLADSAAACLLTHQE----MKEQAAELPYTGTTLFIDDQT
LUCI_PHOPE      --------------IAAPVSDKYIERELIHSLGIVKPRIIFCSKNTFQKVLNVKSKLKYVETIIILDLNE
CAIC_SALSV      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRQDSTPLNHICLIGEQL
CAIC_PROMH      EFFFCWFGLAKIGAVMVPINARFMYEESAWIINHCQAHFVVTSDNFSPIYQPMLHDKHSLTQLFLITEPT
MENE_GEOKA      ----------------------------------------------------------------------
CAIC_SALTI      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRQDSTPLNHICLIGEQL
CAIC_SALPB      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRQDSTPLNHICLIG---
CAIC_SALDC      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRQDSTPLNHICLIGEQL
CAIC_SALNS      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRQDSTPLNHICLIGEQL
CAIC_SALCH      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSVQFYPMYREIRQDSTPLNHICLIGEQL
CAIC_SALA4      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRQDSTPLNHICLIG---
ACSF2_BOVIN     AWVLMQLATAQAGIILVSVNPAYQAMELEYALKKVGCKALVKTQQYYNILKQICPEVEKLKSQRLPDLTT
4CL1_PETCR      EYFFAFLGASYRGAISTMANPFFTSAEVIKQLKASQAKLIITQACYVDKVKDYAAE-KNIQIICIDDAPQ
DLTA_LACPL      ----------------------------------------------------------------------
CAIC_SALPK      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRGNSTPLNHICLIGEQL
CAIC_SALPC      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSVQFYPMYREIHQDSTPLNHICLIGEQL
CAIC_SALPA      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRGNSTPLNHICLIGEQL
4CLL5_ARATH     LFPVVCLSVMSLGAIITTTNPLNTSNEIAKQIKDSNPVLAFTTSQLLPKISAAA------KKLPIVLMDE
4CL2_PETCR      EYFFAFLGASYRGAISTMANPFFTSAEVIKQLKASLAKLIITQACYVDKVKDYAAE-KNIQIICIDDAPQ
DLTA_LACCB      ----------------------------------------------------------------------
DLTA_LACC3      ----------------------------------------------------------------------
CAIC_CITK8      EFFFCWFGLAKIGAIMVPINARLLREESAWILQNSRAQLIVTSAEFYPMYRQILLEDDTLLNHICLIGEN
MENE_BACLD      EMVIAVHACFLLGVRIVLLNTKLSMAERSYQIEHSEAKLLLTEKPFIEEHRGG----QPARAVDIED---
HTS1_COCCA      WTIVTILAVVQAGGVFVLLEPGHPESRLSGIIKQVQAELLLCATSRMGALQNISTQMGT--EFKIVELEP
DLTA_LISMC      ----------------------------------------------------------------------
CAIC_SALTY      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRQDSTPLNHICLIGEQL
CAIC_SALHS      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFYPMYREIRQDSTPLNHICLIGEQL
DLTA_LISIN      -------------------------------------------------------------NLTITGCPV
DLTA_LISW6      -------------------------------------------------------------NLTITDCPV
CAIC_SALEP      EFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSVQFYPMYREIRQDSTPLNHICLIGEQL
DLTA_LISMH      ----------------------------------------------------------------------
DLTA_LISMF      ----------------------------------------------------------------------
DLTA_LACRH      ----------------------------------------------------------------------
FAT2_YEAST      EFIVAFLGATMDAKIGAPLNPNYKEKEFNFYLNDLKSKAICVPKGTTKLQSSEILKSASTFGCFIVDATR
DLTA_LISMO      ----------------------------------------------------------------------
BCLA_THAAR      ----------------IAINTLLTESDYEYMLTDSAARVAVVSQELLPLFAPMLGKVPTLEHLVVAGGAG
PKSN_BACSU      DMXXXXXXXXXXXXXYVPLDPSFPQERLKYMLKDSQASIVLTQPNVHDRISGLTG---------------
DLTA_BACSU      HMIVSFLGSVKAGHPYIPVDLSIPSERIAKIIESSGAELLIHAAG------------------LSIDAVG
CAIC_ECO27      EFIFCWFGLAKIGAIMVPINARLLREESTWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVSL
4CL_VANPL       EFVFAFLGASFIGSISTMANPFFTSTEVIKQAKASNAKLIITQGCYVDKVKDYACE----NGVKIISIXX
MENE_BACP2      QMVMLVHACFSLGFKIVLLNNKLTKAERRFQLEDVKAAAL--------FTEPVYASDHK------GELPV
MENE_LISMO      ----------------------------------------------------------------------
MENE_LISIN      ----------------------------------------------------------------------
DLTA_STRPZ      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
DLTA_STRPM      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
DLTA_STRPG      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
DLTA_STRPF      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
DLTA_STRPD      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
DLTA_STRP8      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
CAIC_ECOLU      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEASQLRHICLIDVSS
4CLL3_ORYSJ     ----------------------------------------------------------------------
DLTA_STRPC      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
DLTA_STRP6      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
DLTA_STRP3      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
DLTA_STRP1      --------------------------------------VALTKSGHAYIPVDVHSAPERILAIIEIAKPS
MENE_BACA2      ----------------------------------------------------------------------
CAIC_SHISS      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
CAIC_ECO5E      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
CAIC_ECO57      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
CAIC_ECO45      EFIFCWFGLAKIGAIMVPINARLLREESTWILQNSQACLLVTSAQFYPMYQQIQQEASQLRHICLIDVSS
ACVS_NOCLA      LGVVATFGIWKSGAAYVPIDPAYPAERIRFLVGDTGLSGIVTNRRHAERLREVLGDEHASVHVIEVEAV-
MENE_GEOSW      ----------------------------------------------------------------------
CAIC_ECOSM      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
CAIC_ECOSE      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
CAIC_ECO55      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
4CL2_TOBAC      EFVFAFIGASYLGAISTMANPLFTPAEVVKQAKASSAKIIVTQACHVNKVKDYAFE-NDVKIICIDSAPE
MENE_LISMF      ----------------------------------------------------------------------
CAIC_ECOUT      EFIFCWFGLAKIGAIMVPINARLLREESTWILQNSQACLLVTSAQFYPMYQQIQQEASQLRHICLIDVSS
CAIC_ECOK1      EFIFCWFGLAKIGAIMVPINARLLREESTWILQNSQACLLVTSAQFYPMYQQIQQEASQLRHICLIDVSS
CAIC_ECO8A      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
MENE_BACC7      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF-----------------DAKD
CAIC_ECOHS      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
ACSM5_RAT       EWWLTIVACMRTGVVMIPGISQLTQKDLKYRLQAARVKSIITSDALAPHVDAISADCPSLQSRLLVS---
CAIC_ECO7I      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
4CLL6_ORYSJ     ----------------------------------------------------------------------
ACSM1_BOVIN     EWWLVCVGCIRTGIIFMPGTTQMKAKDILYRLQVSGAKAIVTTDTLAPEVESVAPECPSLKTKLLVSDHS
FAT2_SCHPO      EFVVAFYAVSWQRAICGPLNSNYKQSEFEFYIDDLKSKLVIVPEGSVAANTPAVRAAKKLSVAVLAWCPK
CAIC_ESCF3      EFIFCWFGLVKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTD---
CAIC_ECO81      EFIFCWFGLAKIGAIMVPINARLLREESTWILQNSQACLLVTSAQFYPMYQQIQQEASELRHICLTDVSS
CAIC_ECO24      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
4CL_PINTA       -------------------NPFYKPGEIAKQAKAAGARIIVTLAAYVEKLADL--QSHDVLVITIDDAPK
CAIC_SHIDS      EFIFCWFGLAKIGAIMVPINARLLREESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
CAIC_ECOL6      EFIFCWFGLAKIGAIMVPINARLLREESTWILQNSQACLLVTSAQFYPMYQQIQQEASQLRHICLTDVSS
CAIC_ECOL5      EFIFCWFGLAKIGAIMVPINARLLREESTWILQNSQACLLVTSAQFYPMYQQIQQEASQLRHICLTDVSS
4CLL1_ORYSJ     ---VCFFAVTALGAVGTTVNPDYTPREIAKQVSDARAKLVITISALVPKIAG-------LRLPVIXXXXX
CAIC_SHIFL      EFIFCWFGLAKIGAIMVPINARLLREESEWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
4CLL2_ORYSJ     ----------------------------------------------------------------------
CAIC_ECOLC      EFIFCWFGLAKIGAIMVPINARLLCEESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
4CL3_ARATH      EFVFSFMGASMIGAVSTTANPFYTSQELYKQLKSSGAKLIITHSQYVDKLKNL----GENLTLITTDEPT
MENE_BACC1      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF-----------------DAKD
ACVS_STRCL      LGVVATLGIWKAGAAYVPIDPAYPAERVRFAVGDTGLRGIVTNRHHAGRLREILGAEHADVTVVEIESV-
4CL4_ORYSJ      ----------------------------------------------------------------------
MENE_BACCR      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVVCLVTDQ---DF-----------------DAKD
LUCI_LUCCR      ----------------------------------------------------------------------
ACSM3_MOUSE     EWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKAKCIITDDTLAPAVDAVAAKCENLHSKLIV----
4CLL2_ARATH     ----------------------------------------------------------------------
ACSF3_HUMAN     ----------------------------------------------------------------------
MENE_BACWK      EMITVIHALSYIGAVAVLLNTRLSREELLWQMDDAEVVCLVTDQ---EFETENVPVC-------------
DLTA_STRA5      ----------------------------------------------------------------------
DLTA_STRA3      ----------------------------------------------------------------------
DLTA_STRA1      ----------------------------------------------------------------------
ACSF2_DANRE     EWVLMQFATAKAGIILVAVNPAYQLQEVEFALRQCNAVVCPTSQHYCDMLKQLCPEMETIKSSRLPDLHT
CAIC_ECOLI      EFIFCWFGLAKIGAIMVPINARLLCEESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
CAIC_ECODH      EFIFCWFGLAKIGAIMVPINARLLCEESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
CAIC_ECOBW      EFIFCWFGLAKIGAIMVPINARLLCEESAWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
MENE_BACCZ      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF------EAKDIPVYSFAEVMN
ENTF_ECO57      FLTLALHAIVEAGAAWLPLDTGYPDDRLKMMLEDARPSLLITTDDQLP----RFADVPDLTNLCY-NAPL
MENE_BACAH      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF------EAKDIPVYSFAEVMN
LUCI_PHOPY      ----------------------------------------------------------------------
4CLL7_ORYSJ     ----------------------------------------------------------------------
3HBCL_THAAR     ELVAAYLGTLRIGAVAVALNVRLAPRDVLYVIQDSACRLLYIDAEFLHLYQQIAGE---------LEQPP
MENE_BACHK      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF------EAKDIPVYSFAEVMN
MENE_BACCQ      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF------EAKDIPVYSFAEVMN
MENE_BACC0      ----------------------------------------------------------------------
MBTB_MYCPA      ----------------------------------------------------------------------
DLTA_STRE4      ----------------------------------------------------------------------
YDAB_BACSU      PASTVMFAALEIGAVVVPVSWQLKPYEMTGILKASEPKAMFYGAEFKEILDEVLPE---LSSLCVTMETG
DLTA_STRMU      ----------------------------------------------------------------------
ACSM1_MOUSE     EWWLVTVGCMRTGIIFMPGTTQLKAKDILYRIQISRAKAIVTTASLVPEVESVASECPDLKTKLVVSDHS
4CL3_DICDI      EYVPIFHGTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAVTLAVYEKIKNDLKRVFSVEKVILVDIAG
MENE_BACCN      EMIAVIHALSYIGAIAVLLNTRLSREELLWQMEDAEVICLLT---------DQIFEPEQV--------PV
ACSM5_MOUSE     DWWLISVACMRTGVVMIPGVSQLTAKDLKYRLQAARAKSIVTSDALAPQVDAISADCPSLQTKLLVS---
MENE_BACAN      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF------EAKDIPVYSFAEVMN
MENE_BACAC      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF------EAKDIPVYSFAEVMN
MENE_BACAA      EMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQ---DF------EAKDIPVYSFAEVMN
LUCI_LUCLA      -----------------PTNEIYTLRELVHSLGISKPTIVFSSKKGLDKVITVQKTVTAIKTIVILDS--
HMWP2_YERE8     ----------------------------------------------------------------------
ACS2B_HUMAN     EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVS---
4CL1_DICDI      EYVPIFHGTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAVTLAVYEKIKNDLKRVFSVEKVILVDIAG
ACSA_PSEA6      QAVYAMLACARIGAVHTVIFGGFSPNAIADRVNNCQAKVLITADEGLDNVDTALAE-HDCPSMEQVIVFK
4HBCL_RHOPA     DFPILFWGAIRAGIVPVLLNTRLTADQYRYLLEDSRSRVVFASSEFLPVIEEAAADLPHLRTIIAVDAPA
DLTA_STAHJ      YMLVGMIGAIKAGCGYVPIDTSVPSERVNMIINKVQPDIIFNTS-------DTQLNHSNIQELTI-----
ACSM3_RAT       EWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKSKCIITDDTLAPAVDIVAAKCENLHSKLIV----
LUCI_LUCMI      ----------------------------------------------------------------------
ENTF_ECOLI      FLTLALHAIVEAGAAWLPLDTGYPDDRLKMMLEDARPSLLITTD-------DQLPRFSDVPNLTSLCYNA
ALKK_PSEOL      ------------------INPRLFIEQITYVINHAEDKVVLLDDTFLPIIAEIHGSLPKVKAFVLM-AHN
ENTF_SHIFL      FLTLALHAIVEAGAAWLPLDTGYPDDRLKMMLEDARPSLLITTD-------DQLPRFSDVPNLTNLCYNA
4CL2_DICDI      EYVPIFHGTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAVTLAVYEKIKNDLKRVFSVEKVILVDIAG
ACSA_PASMU      EAVIAMQACARIGAVHSVVFGGFSASALRDRIEDAEAKLVITANGKIIPLKETVDECKTIENVIVIDTPW
4CLL3_ARATH     LSVMSL------GAVVTTANTLNTSGEISKQIAQSNPTLVFTTSQLAPKLAAAI-------SVVLTDEED
DLTA_STAAW      ----------------------------------------------------------------------
DLTA_STAAT      ----------------------------------------------------------------------
DLTA_STAAS      ----------------------------------------------------------------------
DLTA_STAAE      ----------------------------------------------------------------------
DLTA_STAAC      ----------------------------------------------------------------------
DLTA_STAA8      ----------------------------------------------------------------------
DLTA_STAA3      ----------------------------------------------------------------------
DLTA_STAAR      ----------------------------------------------------------------------
ACS2A_HUMAN     EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVS---
4CL5_ORYSJ      ----------------------------------------------------------------------
4CL1_ARATH      EFVLSFLAASFRGXXXXXXXXXXXXXEIAKQAKASNTKLIITEARYVDKIKPLQND--DGVVIVCIDDN-
MENE_OCEIH      ----------------------------------------------------------------------
DLTA_STAAB      ----------------------------------------------------------------------
SID2_USTMA      ETYLSFIGVLKAGAAWCPIDTDWPASRRQALLAKSNAKIVLTHDDKIS---EQLR--HDLESQLVKDKGE
MBTB_MYCTU      ----------------------------------------------------------------------
MBTB_MYCBO      ----------------------------------------------------------------------
ACSM5_HUMAN     EWWLVSVACMRTGTVMIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSS
ACSM2_MOUSE     EWWLMILGCMRTGLVFMPGTIQMRSSDILYRLQASKARAIVAGDEVAQEVDAVAPDCSFLKIKLLVSENS
4CLL4_ARATH     --------------VFTTANTLNTSGEISKQIADSNPTLVFTTRQLAPKLPVAI-------SVVLTD--D
DLTA_STAAU      ----------------------------------------------------------------------
DLTA_STAAN      ----------------------------------------------------------------------
DLTA_STAAM      ----------------------------------------------------------------------
DLTA_STAA9      ----------------------------------------------------------------------
DLTA_STAA2      ----------------------------------------------------------------------
DLTA_STAA1      ----------------------------------------------------------------------
SIB1_SCHPO      EAFISMLAILKAGCCFLALDVSAPTERIRYIVTDSTAVLVMSTGELYTKLLNASI------NVTILDAPG
MENE_ENTFA      ELYFSILALWELGKELLFLNTHLTLAELTFQLKDAQVKTIIGAPETQALLEE----------ISFVDV--
ACSM3_PONAB     EWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNXXXXXXXXXXXXKCENLHSKLIVSENS
ACSM2_RAT       EWWLVTLGCMRSGLVFMPGTTQMKSTDILYRLQSSKARAIVAGDEVVQEVDAVAPDCSFLKIKLLVSEKN
4CLL8_ARATH     ----------------------------------------------------------------------
DLTA_LACLA      ----------------------------------------------------------------------
ACSF3_MOUSE     ----------------------------------------------------------------------
ACSM3_HUMAN     EWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPAVDAVASKCENLHSKLIVSENS
DLTA_STRZT      ----------------------------------------------------------------------
DLTA_STRPJ      ----------------------------------------------------------------------
DLTA_STRP7      ----------------------------------------------------------------------
ACSM1_HUMAN     EWWLVAVGCMRTGIIFIPATILLKAKDILYRLQLSKAKGIVTIDALASEVDSIASQCPSLKTKLLVSDHS
ACSA_GEMAT      EAVIAMLACARIGAIHTVVFGGFAPESLRDRINDCGCKLLITASRRGQMVDVALKECPSIENVLVVGVGD
4CL2_ORYSJ      ----------------------------------------------------------------------
DLTA_STRZP      ----------------------------------------------------------------------
DLTA_STRR6      ----------------------------------------------------------------------
DLTA_STRPN      ----------------------------------------------------------------------
DLTA_STRP2      ----------------------------------------------------------------------
ACSM4_RAT       EWWLINVACMRTGLVFMPGTIQLTRKDILYRLQASKAKCIVASEEVAPAVDSIASECPNLKTKLLVSPHR
ACSM4_HUMAN     EWWLVNVACIRTGIIFMPGTIQLTAKDILYRLRASKAKCIVASEEVAPAVESIVLECPDLKTKLLVSPQ-
ACSA_NITEU      EAVVAMQACARIGAIHSVVFGGFSAKSVYERIIDAGASAVITADEQIRG-----GRYHPLKATVLAMGDT
ACSA_RUBXD      ELPIAMLACARIGAPHSVVFGAFSAQSLRDRINDCEAKVLVTADSRTPLKANADEALEDTPSIVVVVRRT
ACSA_PHYBL      ETIVAILACARIGAIHSVVFAGFSAEILRDRVVDCATRVVLTSDEGRRGGKNIATKCIVDEALVLVFRRT
DLTA_STAES      ----------------------------------------------------------------------
ACSF3_XENLA     SYVVCQWAVWMSGAIAVPLCKSHPPSELKYVLQDSQSALVVAEESYTNVLSP-LAEQLGIPVLTMSGSQN
ACSA_LARHH      QAIVAMQACARIGAIHSVVFGGFSAGALRDRIQDAAAKVVITANESVRTVDEALAMCDSIEKVVVLQRTY
4CL3_ORYSJ      ----------------------------------------------------------------------
MENE_STAAR      QSIILIHACWLANIEIAMINTRLTPNEMTNQMRSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGTDI
BAIB_EUBSP      ----------------------------------------------------------------------
ACSA_CHRVO      EAVVTMQACARIGAIHSVVFGGFSAGAVRDRIQDAGATVVVTANESVRTVDEALAEGAESVRHVVVYQRT
ACSA_BACSU      ----------------------------------------------------------------------
DLTA_STAEQ      ----------------------------------------------------------------------
MENE_STAES      ----------------------------------------------------------------------
ACSA_COPC7      QAIAAFLACARIGAIHSVVFAGFSAEALRDRMQDCKSRVLITSDEXXXXXXXXLKECPAVEKVLVLKRTG
CAIC_SHIF8      EFIFCWFGLAKIGAIMVPINARLLREESEWILQNSQACLLVTSAQFYPMYQQIQQEATQLRHICLTDVAL
4CL2_SOYBN      DFVFSFLAISMIGAVATTANPFYTAPEIFKQFTVSKAKLIITQAMYVDKLRDGAKLGEDFKVVTVDDPPE
MENE_STAEQ      ----------------------------------------------------------------------
ACSA_SYNFM      ELAVAMLACARIGVVHSIVFAGFSPESLAGRILDCGGKVVITADEGLENTEEALKKCPDVQKVIVVKHTG
MENE_STAAN      QSIILIHACWLANIEIAMINTRLTPNEMTNQMRSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAAM      QSIILIHACWLANIEIAMINTRLTPNEMTNQMRSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAA9      QSIILIHACWLANIEIAMINTRLTPNEMTNQMRSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAA2      QSIILIHACWLANIEIAMINTRLTPNEMTNQMRSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAA1      QSIILIHACWLANIEIAMINTRLTPNEMTNQMRSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
ACSA_DICDI      TAIYSMLACARIGAIHSVIFAGFGYESIVSRVHDAKCRVIITADEGLEKIDQVVQHCKLVQHVLVTGRPT
ACSA_COPCI      QAVAAFLACARIGAIHSVVFAGFSAEALRDRMQDCKSRVLITSDEXXXXXXXXLKECPAVEKVLVLKRTG
ACSM4_MOUSE     EWWLINVACMRTGLVFMPGTIQLTRKDILYRLQASKAKCIVASEEVAPAVDSIVSECPSLKTKLLVSPH-
ACSA_XYLFA      DAVVAILACARIGAIHSVVFGGFAPNSIADRINDCGSKLIITADEGLRGGRDAALKIHGTQSVVLVVRHT
ACSA_SCHPO      ETIIAMLAIVRLGAIHSVIFAGFSAESVADRVNDSECKVIITADERIPLVNKALTECPTIKKVLVFQRSA
ACSA_PSYIN      EAAVAMLACTRIGAVHSIVFGGFSPDAIAGRIVDSSAKIVITADERVVPLKANVDEATDCVKSVIVFKNT
ACSA_NOVAD      EAAVAMLACARIGAIHSIVFAGFSPDALAGRITDCDSRIVLTSDEGLRGVDEALKQCPGVDTVIMLRRTG
ESYN_FUSEQ      WVVASMLAVLKAGHAFTLIDPSDPPARTAQVVQQTSATVALTSKLHRETVQSTVGRC------IVVDE--
ACSA_PYRAE      ELPITMLAAWRIGAITSVVFSGFSADALAERINDSQSRIVITADGRVVRLKEALEKATGVESVIVLPRLG
ACSA_XYLFT      DAVVAILACARIGAIHSVVFGGFAANSIADRVNDCGSKLIITADEGLRGGRDAALKIHGTQSVVLVVRHT
ACSF3_BOVIN     ----------------------------------------------------------------------
ACSA_VIBCH      EAAVAMLACTRIGAVHTIVFGGFSPEALAGRIIDSNAKLVITADEGVKNVDEALCN-PEVKNISKVMVLK
MENE_LACLA      ----------------------------------------------------------------------
DLTA_STAXY      FMIVGMIASMKAGCGYVPLDISMPEERINTIIEKINP----------DFIFNTSEHSLDSNGREIVN--T
ACSA_SALTI      EAAVAMLACARIGAVHSVIFGGFSPEAIAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
ACSA_BDEBA      DTAVAMLACARIGAVHSVVFAGFSPDSISDRILDGQCRFVITGDSKVVALKEALVKTPDVQKVLVVKYAG
ACS1_DEBHA      EALVTLLAIVRIGAVHSVVFAGFSSSSLKDRILDASSKIVITTDESKKIVDDALKNCPDVTNVLLFKRTG
4CL1_ORYSJ      EFVLSFFAASRVGAAVTTANPMSTPHEIESQLAAAGATVVITESMAADKLP---SHSHGALTVVLIDERR
ACSA_SYNY3      EAAITMLACSRIGAPHSVVFGGFSAEALRDRLVDAEAKLVITADG--GFRKDAIALKQEVDKALEHGAPS
ACSA_CAUCR      LAAVAMLACARIGAVHSVVFGGFSPDSIAGRIQDCASHFVITADERVPLIDEALKHCPWVGKVLMIRWTG
4CLL9_ORYSJ     VYPVVSLGIMSAGAVFSGVNPRALAAEIKKQVEDSEAKLVVANEVAFDKVKDA-------------GVPV
MENE_STAAU      QSIILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAAT      QSIILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAAE      QSIILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAAC      QSIILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAA8      QSIILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
MENE_STAA3      QSIILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQ-LIFCTLPLELRGFQIVSLDDIE---FAGRDI
ACSA_PYRAR      ELPITMLAAWRIGAITNVVFSGFSADALAERINDSQSRIVITADGRLEVVDSALEKAPGVENVIVLPRLG
ACSA_SALTY      EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNPNSVEHVIVLKRTG
ACSA_NITEC      ----------------------------------------------------------------------
ACSA_BRAJA      EAAYAMLACARIGAIHSVVFAGFSPDSLAQRINDCQSKVIITADEGLRGVDAALAKADGVDWVVVVKRTG
VIBE_VIBCH      EFYLCFFALLRQGIRPILALPAHRLAEIRYFCQHSQAKAYLIDGAQRPFDYQALAQCCPTLQTVIVRGQT
ACSA_RHOBA      ELAVAMLACARIGAIHSVIFAGFSAESIAERNNDASAKLVITSDGLYRTVDEALEKSPTVEKCLVLDAPM
ACSA_CITK8      EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAVDDALKNVNSVEHVVVLKRTG
ACSA_SHEFN      EAAVAMLACARIGAVHSVVFGGFSPDSIAARVIDGKSKVLITADEGIRSIDEAISN-PDVTCVVIVFKRT
ACSA_AERS4      EAAIAMLACTRIGAVHSIVFGGFSPEALAGRIIDSGSSIVITADEGLKNVDEALTNPDTRVSKVIVLKRT
ACSA1_PSEAE     EAVVAMLACTRIGAIHSVVFGGFSPEALAGRIIDCKSKVVITADEGVRGVDDALTETSSVQKIIVCKRTG
MENE_STAAW      ----------------------------------------------------------------------
MENE_STAAS      ----------------------------------------------------------------------
ACSA_THEEB      EAAIAMLACARIGAPHSVVFGGFSAEALRDRLIDAQAKLVVTADG--GWRKDAIVPLKDQVDKALAHQGV
ACSA_BEII9      EAAFAMLACARIGAIHSVIFGGFSPDSLAGRIEGCRSKVLITADEGLRGGRKAIAKTGDIVQTMIVVTRT
MENE_STAAB      ----------------------------------------------------------------------
ACSA_SHEDO      EAAVAMLACARIGAVHSVIFGGFSPDSIASRVIDGKSKVIITADEGIRAVDEALARPSTCVNNVIVLKRT
ACSA_PHOPR      EAAIAMLACTRIGAVHTIVFGGFSPEALAGRIVDSNAKLVITADEGVRAVDDALANKNSIEKVIVLKRTG
4CLL5_ORYSJ     ----------------------------------------------------------------------
ACSA_DESAA      QLAVAMLACARIGAIHSIVFAGFSPDALANRITDAECTILITADEGLRGLKEAADEAMDKAGMVIVVKHT
ACSA_SODGM      EAAVAMLACARIGAVHSVIFAGFSPEAIAGRIIDSSAKLVVTADEGLRAIDDALPEVKSVNRVIVFRRTG
ACSA_SHEHH      EAAVAMLACARIGAIHSVVFGGFSPDSIASRVIDGNSKVVITAAGRIIPLKANIDEAPDVNCVVIVMKRT
ACSA_ECOLI      EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAVDDALKNPNSVEHVVVLKRTG
ACSA_AERHH      EAAIAMLACTRIGAVHSIVFGGFSPEALAGRIIDSGSSIVITADEGLKNVDEALTNPETKVNNVIVLKRT
ACSA_PSESM      EAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCSSKVVITADEGLRGGKKTALKANVDRALT--NPET
ACSA_BRASO      EAAYAMLACARIGAIHSVVFAGFSPDSLAQRIKDCDSKVVITADEKVPLKANVDAALXXXXXXXXXXXXX
ACS2_CANAL      QAIIAMLAIARLGAAHSVIFAGFSAGSIKDRVNDASCKALITCTNIKKLCDEALVDCPTVEKVLVYKRTN
LCF2_SCHPO      -------------------------------LDECKSRAIFTDPNLIPKLLGPLKQSTWVKLIVCSSTPS
ACSA_METFK      ----------------------------------------------------------------------
ACSA_RHOCA      EAAYAMLACARIGAIHSIVFAGFSPDALANRINDCGAKLVITADTRTPLKANALLHCSDVRCLVVKHTGD
ACSA_EMENI      EAIIAFLACSRIGAVHSVVFAGFSSDSLRDRVLDAGSKVVITTTKRI--VDEGLKQCPDV-STVLVYKRT
ACSA_SYNAS      ELAVAMLACTRIGVVHSIVFAGFSPESLRERIRDCQGRVVITADEGLENADEAVGKCPFVEKVIVVRRTG
ACSA_ECOL6      EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITSDEGVRAVDDALKNPNSVEHVVVLKRTG
ACSF4_MOUSE     ----------------------------------------------------------------------
LYS2_SCHPO      ----------------------------------------------------------------------
ACSA_YERPP      EAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRDEALKNPAITSIVVVFQRT
ACSA_YERPN      EAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRDEALKNPAITSIVVVFQRT
ACSA_YERPE      EAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRDEALKNPAITSIVVVFQRT
ACSA_YERPA      EAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRDEALKNPAITSIVVVFQRT
ACSA_SHEPA      EAAVAMLACARIGAIHSVVFGGFSPDSIASRVIDGNSKVVITADERAGRIIPLKANIDEALSHPDVNCVE
ACSA_LEPIN      ELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLVVTADGGIELKKNALEKSKEKVKTVIV----
ACSA_LEPIC      ELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLVVTADGGIELKKNALEKSKEKVKTVIV----
ACSA_HALHL      EAAVAMLACARIGAVHSIVFGGFSPEALRDRIQDADAEVVITSDEGVRGTDKALEGCPNVKTVFVVRRTG
ACSA_ENTS8      EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSARLVITADEGVRAVDDALKNVTSVEHVVVFKRTG
ACSA_YERPS      EAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRDEALKNPAITSIVVVFQRT
ACSA_YERP3      EAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRDEALKNPAITSIVVVFQRT
ACSA_PSEU2      EAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCSSKVVITADEGLRGGKKTALKANVDRALT--NPET
ACS1_CANAL      EAIVTLLAIVRIGAMHSVVFAGFSSASLRDRILDADSRIVITADESKKIVDDALKECPKVRNVIVFKRTG
AAS_SHIFL       ----------------------------------------------------------------------
AAS_SHIF8       ----------------------------------------------------------------------
ACSA_BURPS      ----------------------------------------------------------------------
ACSA_BURP6      ----------------------------------------------------------------------
ACSA_BURP1      ----------------------------------------------------------------------
ACSA_BURP0      ----------------------------------------------------------------------
ACSA_BURMS      ----------------------------------------------------------------------
ACSA_BURMA      ----------------------------------------------------------------------
ACSA_BURM9      ----------------------------------------------------------------------
ACSA_BURM7      ----------------------------------------------------------------------
AAS_SALDC       ----------------------------------------------------------------------
ACSA_PENCH      EAVIAFLACSRIGAVHSVVFAGFSSDSLRDRVLDASSKVIITSDEXXXXVDEAMKQCPDVHTVLVYKRTG
ACSA_MARMS      QAVYAMLACARIGAIHSVIFGGFSAHAIADRLNDCEVKLVITADHNVDMALDNNA-CPTVEN-VIVYRYT
ACSA_MAGSM      EAAVAMLACTRIGAVHSIVFGGFSPDALRDRIIDAECRVVITASKKIPLVETALAQCPNVHTCFVVQDTQ
AAS_ECOUT       ----------------------------------------------------------------------
AAS_ECOK1       ----------------------------------------------------------------------
AAS_ECO45       ----------------------------------------------------------------------
4CLL1_ARATH     ----------------------------------------------------------------------
ACSA_VIBPA      EAAIAMLACTRIGAVHTVVFGGFSPEALSGRIIDSDAKVVITADEGVKNVDEALTEVKTISKVVVLKRTG
ACSA_PSEHT      ----------------------------------------------------------------------
ACSA_PSE14      EAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCSSKVVITADEGLRGGKKTALKANVDRALT--NPET
ACSA_ECO57      EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAVDDALKNPNSVEHVVVLKRTG
ACSA1_PSEPK     EAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKSKVVITADEGVRGGRRTPLKANV--DLALTNPET
ACSA_METSO      ----------------------------------------------------------------------
AAS_SHISS       ----------------------------------------------------------------------
AAS_SHIB3       ----------------------------------------------------------------------
AAS_SALTI       ----------------------------------------------------------------------
AAS_SALSV       ----------------------------------------------------------------------
AAS_SALPK       ----------------------------------------------------------------------
AAS_SALPB       ----------------------------------------------------------------------
AAS_SALPA       ----------------------------------------------------------------------
AAS_SALHS       ----------------------------------------------------------------------
AAS_SALG2       ----------------------------------------------------------------------
AAS_SALEP       ----------------------------------------------------------------------
AAS_SALA4       ----------------------------------------------------------------------
AAS_ECOSM       ----------------------------------------------------------------------
AAS_ECOSE       ----------------------------------------------------------------------
AAS_ECOLU       ----------------------------------------------------------------------
AAS_ECOLI       ----------------------------------------------------------------------
AAS_ECOLC       ----------------------------------------------------------------------
AAS_ECOL6       ----------------------------------------------------------------------
AAS_ECOHS       ----------------------------------------------------------------------
AAS_ECODH       ----------------------------------------------------------------------
AAS_ECOBW       ----------------------------------------------------------------------
AAS_ECO5E       ----------------------------------------------------------------------
AAS_ECO57       ----------------------------------------------------------------------
AAS_ECO55       ----------------------------------------------------------------------
AAS_ECO27       ----------------------------------------------------------------------
AAS_ECO24       ----------------------------------------------------------------------
ACSA_SERP5      EAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSKLVITADEGLRAVDDALKN-PGVKSITNVVVFQ
AAS_SALTY       ----------------------------------------------------------------------
AAS_SALPC       ----------------------------------------------------------------------
AAS_SALNS       ----------------------------------------------------------------------
AAS_SALCH       ----------------------------------------------------------------------
AAS_ECOL5       ----------------------------------------------------------------------
AAS_ECO7I       ----------------------------------------------------------------------
ACSA_ALHEH      EAAVAMLACARIGAIHSIVFGGFSPDALKDRIQNADCETVITADEGVSNADKALESCPDVKNVFVVKRTG
AAS_KLEP3       ----------------------------------------------------------------------
AAS_ENT38       ----------------------------------------------------------------------
4CLL8_ORYSJ     ----------------------------------------------------------------------
ACSA_YERE8      EAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSNSKLVITADEGIRAGRDEALKNPAITSIVVVFQRT
ACSA_VIBVY      EAAVAMLACTRIGAVHTIVFGGFSPEALAGRIIDSDAKVVITADEGVKNVDEALTEVKTISKVVVFKRTG
ACSA_VIBVU      EAAVAMLACTRIGAVHTIVFGGFSPEALAGRIIDSDAKVVITADEGVKNVDEALTEVKTISKVVVFKRTG
ACSA_THIDA      ----------------------------------------------------------------------
ACSA_SHESH      EAAVVMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITADEGVRGIDEALSHPDDCVEKVIVLERT
ACSA_PHOLL      EAAVAMLACARIGAIHSVIFAGFSPDAVSGRIIDSNTKLVITADEGLXXXXXXXXXXXXXXXXXIVFKRT
ACSA_BURTA      ----------------------------------------------------------------------
4CL1_SOYBN      ----------------------------------------------------------------------
ACSA_XANP2      EAAFAMLACARLGAIHSIVFGGFSPDSLAGRVADCGSKCIITADEGLRGVDAAIAQINGGVDHVIVVRRT
AAS_YERE8       ----------------------------------------------------------------------
ACSA_THET2      EAAIAMLACTRIGAVHSVVFGGFSAGALADRIKDAEAKVLITADGGVPLKQNADEALKDATSVEHVVVVR
ACSA_PARL1      EAAYAMLACARIGAVHSVVFGGFSPDSLAGRIVDCASSCVITADEGVRGTDEALKKCPGVKSVIVVKHTG
ACSA_NEUCR      EAIVAMLACTRIGAIHSVVFAGFSSDSLRDRVVDAQSKVVITTDETKKIVDEALQQCPDVRNVLVYKRTG
ACSA_MARAV      ETAVAMLACARIGAIHSVVFGGFSPEALAARIVNGKSRFVITADEGLKNVDSALKHEDDAKKVIVVSRTG
AAS_PECCP       ----------------------------------------------------------------------
AAS_ESCF3       ----------------------------------------------------------------------
ACSL4_HUMAN     EWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLESLKTALLDISCVKHIIYVD--N
ACSA_THET8      EAAIAMLACTRIGAVHSVVFGGFSAGALADRIKDAEAKVLITADGGVPLKQNADEALKDATSVEHVVVVR
ACSA_BART1      EAAYAMLACARIGAVHSVIFAGFSAEAIAGRIVDCESTFIITADHRIN-LKDNVDHAIEIRQNVRVDQ-V
ACS2_DEBHA      QAIIAMLAVARLGAIHSVIFAGFSSGSIKDRVNDASCKALITCDNIKKLCDEALLNCPSIEKVLVYERTG
4CL4_ARATH      ----------------------------------------------------------------------
ACSA_RHOP5      EAAFAMLACARIGAIHSVVFGGFSPDSLAQRITDCASKVVITADEGLRGVDAALRKSSAVDWVVVVKRTG
AAS_ERWCT       ----------------------------------------------------------------------
ACSA_SHEAM      EATVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKLLITADEGVRGGRKIPLKGNIDEALNRPDVTT
ACSA_RHILO      EAAYAMLACTRIGAIHSIVFGGFSPDALAGRIVDCESTFVITADEGLDKAIDIAAKNFVMVKNVLVVRRT
ACSA_LEPBJ      ELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLIVTADGNVDIALEKSKE--DVKTVIVVRRTG
ACSA_BURS3      EGIVAMQACARIGATHSVVFGGFSAKSLNERLVDVGATALITADEQLKSIADALGGCEAVKSVIVYRRTG
ACSF4_HUMAN     ----------------------------------------------------------------------
AAS_CITK8       ----------------------------------------------------------------------
LYS2_CANGA      DLMVCVMGVLKAGATFSVIDPAYPPARQTIYLGVAKPKIVIRAAGQLDQLEDYITKELDLVSRIIAIQDN
ACS2_ASHGO      EAVVAMLAVARLGAVHSVIFAGFSSGSLRDRIVDAESKVVITCDHTKKIVDEGLAGVGVVSHILVFQRTG
ACSA_CRYPV      ETIYTMLACARIGAVHMVVFAGFAAQNLLERLVNARCKIVVTADNLKDVVDKALEKIPEIKTCIVFRHLN
AAS_YERPY       ----------------------------------------------------------------------
AAS_YERPS       ----------------------------------------------------------------------
AAS_YERPP       ----------------------------------------------------------------------
AAS_YERPG       ----------------------------------------------------------------------
AAS_YERPB       ----------------------------------------------------------------------
AAS_YERP3       ----------------------------------------------------------------------
ACSA_BARQU      EAAYAMLACARIGAIHSVIFAGFSSEAIADRIVDCKSTFIITADNNIDHAIDIAARRGVHVNQVLVIRRT
ACSA_BARHE      EAAYAMLACARIGAIHSVIFAGFSPEAIAGRIVDCESTFIITANQGLRGLKDSVDHAIEIRQNVHVDQ-V
ACS2_ZYGBA      EAVVAMLAIARLGAIHSVVFAGFSAGSLKDRVVDAGCKVVITCDEKTVHTKKIVDEGLNGISLVSHILVF
ACSA_METSB      EAAYAMLACARIGAIHSIVFGGFSADSLGGRIEGCKSKLIITAD-------EGYRGGRKVPLKVNADAAI
ACSA_LEPBL      ELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLIVTADGNVDIALEKSKE--DVKTVIVVRRTG
ACSA_AGRT5      EAAYAMLACARIGAVHSVVFGGFSPEALAGRIVDCESTFVITCDEGVDKAIDIAAKQYVIVNKVLVVRRT
ACS2_YEAST      EAVIAMLAVARIGAIHSVVFAGFSAGSLKDRVVDANSKVVITCDNTKKIVDEGLNGV-DLVSRILVFQRT
DHBE_BACSU      ----------------------------------------------------------------------
ACSA_SHESA      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGIDDALKH-PDVTSVEKVIVLK
ACSA_METPB      EAAYAMLACARLGAIHAIVFGGFSPDSLASRIKGCGSKLVITADEGLRGVDEAIKRLDDLVDHVIVVKRT
ACS1_CANGA      EALITLLAISRIGAIHSVVFAGFSSNSLRDRINDAGSRVVITASNRGGIVDDALRETPQVEHVLVYRRTN
AAS_YERPE       ----------------------------------------------------------------------
AAS_YERPA       ----------------------------------------------------------------------
LYS2_PENCH      ----------------------------------------------------------------------
ACSL4_MOUSE     EWMIAAQTCFKYNFPLVTLYATLGREAVVHGLNESEASYLITSVELLESLKAALVDINCVKHIIYVD--N
ACBG1_BOVIN     ------------------------PEACQYIAYDCRANIIVVDTQKLEKILKIWKHLPHLKAVVIYEAPP
LCF1_SCHPO      -----------------------------HSLRESGVRGMYTEGHLLKTLVNPLKEIESLEVIIYRNDAK
AAS_ENTS8       ----------------------------------------------------------------------
ACSA_LEPBP      ELAIATLACTRIGAVHSVVFGGFSPEALLGRIEDCKPTLVITADGGIELKKNALAETKFKVNDVIV----
ACSA_LEPBA      ELAIATLACTRIGAVHSVVFGGFSPEALLGRIEDCKPTLVITADGGIELKKNALAETKFKVNDVIV----
ACSL4_RAT       EWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSXXXXXXXXXXXXDINCVKHIIYVD--N
ACSL3_PONAB     EWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTLKDIVSLVPRLRHIITVDGKP
ACSL3_HUMAN     EWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTLKDIVSLVPRLRHIITVDGKP
ACSA_XANAC      DAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPG--T
ACSA_SHESR      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGIDDALKH-PDVTSVEKVIVLK
ACSA_SHESM      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGIDDALKH-PDVTSVEKVIVLK
ACSA_METEP      EAAYAMLACARLGAIHAIVFGGFSPDSLASRIKGCGSKLVITADEGLRGVDEAIKRLDDLVDHVIVVKRT
MENE_SALTY      RTLLAWLALMQCGARVLPVNPQLPQTLLEALVPKLTLRFALTLEGENAF--------SGLTAL-------
ACSA_DEIRA      EAAIAMLACARIGAVHSIVFGGFSVSALADRINNAQSKLLITADAKINADEAALAPC--LEHVLVVKRAG
ACS2_KLULA      ----------------------------------------------------------------------
AAS_KLEP7       ----------------------------------------------------------------------
LYS2_YEAST      DLMVCVMGVLKAGATFSVIDPAYPPARQTIYLGVAKPRIVIRAAGQLDYINDELEIVSRINSIAIQENGT
ACSA_XANOM      DAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPG--T
ACSA_SHEON      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKIVITSDEGMRGIDDALKH-PDVTSVEKVIVLK
ACSA_METRJ      EAAYAMLACARLGAIHAIVFGGFSPDSLASRIQGCGSKVVITADEGLRGVDEAIKRLDDLVDHVIVVRRT
ACSA_BURP8      ----------------------------------------------------------------------
ACS1_ASHGO      QALVTLLAISRIGAIHSVVFAGFSSNSLRDRINDARSEVVVTTTKRI--VDDAIKETPQLRKVLVYKRTC
ENTE_ECO57      ----------------------------------------------------------------------
ACSA_WOLSU      EAAFMMLACARIGAIHSVVFGGFSAEALRDRIIDAEAKLVITADGAYPVVDDALAECPSIEKVLIVIRNK
ACSA_SHELP      EAAVVMLACARIGAIHSVVFGGFSPDSIASRVIDGKSKVVITADERTIPLKANIDEALSHPDVTCVEKVI
ACSA_HELAH      ESVYMMLACTRIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFPALDKALANCPSVEKTLIVIRNA
ACS1_KLULA      QALITLLAITRIGAIHSVVFAGFSSNSLRDRINDAYSKTVITTTKRI--VDEALKDTPQVTNVLVFKRTH
ENTE_ECOLI      ----------------------------------------------------------------------
ACSM6_HUMAN     EAYWICLACVRLGITFVPGSPQLTAKKIRYQLRMSKAQCIVANEAMAPVVNSAVSDCPTLKTKLLVSDKS
ACSA_METC4      EAAYAMLACARLGAIHAIVFGGFSPDSLASRIKGCGSKLVITADEGLRGVDEAIKRLDDLVDHVIVVKRT
ACSA_HERAR      ----------------------------------------------------------------------
ESYN_GIBPU      ----------------------------------------------------------------------
AAS_ERWT9       ----------------------------------------------------------------------
S27A5_HUMAN     ------------------INPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILPQAENIRCFYLSHSPT
ACSA_BARBK      EAAYAMLACARIGAIHSVIFAGFSSEAIAGRLIDGQSTFIITADHALDNVDRAIAACQNVNTQVMVIRRT
ACBG1_RAT       ------------------------PEACQYIAHDCRANVIVVDTQKLEKILKIWKDLPHLKAVVIYQEPP
S27A5_MOUSE     ------------------INPHSRGMPLLHSVRSSGASVLIVDPDLQENLEEVLPKAENIHCFYLGSSPT
ACSA_SHESW      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITSDEGMRGIDDALNH-PDVTSVEKVIVLK
ACSA_SHEPC      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITSDEGMRGIDDALNH-PDVTSVEKVIVLK
ACSA_HELPY      ESVYMMLACTRIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRMLKPALDKCPSVEKALIVIRNA
ACSA_HELPH      ESVYMMLACARIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRMLKPALDKCPSVEKALIVIRNA
ACSA_HELPG      ESVYMMLACTRIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRMLKPALDKCPSVEKALIVIRNA
ACSA_ALCBS      ----------------------------------------------------------------------
ACSA_RALSO      ----------------------------------------------------------------------
ACSA_DROME      ----------------------------------------------------------------------
ACBG1_MOUSE     ------------------------PEACQYISHDCRANVIVVDTQKLEKILKIWKDLPHLKAVVIYQEPP
ACSA_HELP2      ESVYMMLACARIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRMLKPALDKCPSVEKALIVIRNA
ACSA_STRCO      ETAIAMLACARIGAAHSVVFGGFSSDALATRIQDADARVVITADGKPSALKPAVDEAVERAGIV---EHV
LCF4_YEAST      ----------------------------------------------------------------------
ACSF4_DANRE     ----------------------------------------------------------------------
ACSA_PSYA2      EAVVAMLACTRIGAVHSVVFGGFSTQSLGNRIIDSQSKLVITADEGIRGNKRTPLKANVDRALDMTDSVS
ACSA_MYCTU      EAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQ--FRRGKPSPLKXXXXXXXXXIPD
ACSA_MYCBO      EAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQ--FRRGKPSPLKXXXXXXXXXIPD
ACSA_CHLTE      ELVIAVLACARVGAVHNVIFAGFAAHAITERVNDSRAKIVICADNLKNIVDEAIINTPSVKNVIVLKVTG
ACSA2_PSEAE     EAAYAMLACARIGAVHSVVFGGFSPDSLRDRILDADCRTVITADEGVQNVEKALKDCPDVSTVVVVER-T
ACS2L_MOUSE     LAVAAMLACARIGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLKIVDEAVKSCPTVQH-VLVAHRT
ACBG1_MACFA     ------------------------PEACQYIAYDCCANVIVDTQKQLEKILKVWKQLPHLKAVVIYKEPP
ACSA2_RHIME     EAAYAMLACARIGAIHSVVFGGFSPEALAGRIVDCESTFVITCDEGVDTAIDIAARQHVTVSKVLVVRRT
ACBG1_HUMAN     ------------------------PEACQYIAYDCCANVIVDTQKQLEKILKIWKQLPHLKAVVIYKEPP
S27A5_RAT       ------------------INPHSRGMPLLHSVQSSGASVLIVDPDLQENLEEVLPKAENIRCFYLGSSPT
S27A3_MOUSE     DFLWIWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGASALVLATEFLESLEPDLPALRAMGLHLWATGPE
LCFH_HAEIN      --------------ITVPIYATNTAQQAEFILNHADVKILVGDQEQYDQTLEIAHHCPKLQKIV---AMK
ACSA_RHILW      ----------------------------------------------------------------------
ACSA_RALME      ----------------------------------------------------------------------
ACSA2_PSEPK     EAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRTVITADERIPLKQNALASCPAVSSVLVV---R
VRAA_STAEQ      ----------------------------------------------------------------------
MENE_ECOLI      ----------------------------------------------------------------------
ACBG2_CHICK     ------------------------PEACHYVAENCSANILVV-ENHTQACRKSLEIEHKLPHMAIIQYGE
FCSA_DICDI      EWVLSDMAAMNHSLVPVALYATLGANAIEYVVNHSEISVLLCEGKNVEKILSMPGTT--IKTIVSYDPPQ
FAD21_MYCTU     ----------------------------------------------------------------------
FAD21_MYCBO     ----------------------------------------------------------------------
ACSA_RHISN      EAAYAMLACARIGAIHSVVFGGFSPEALAGRIVDCESTFVITCDEGLEKAIDIAARQHVMVNKVLVVRRT
ACSA_RALEJ      ----------------------------------------------------------------------
ACSA_PRB01      ETAFAMLACTRIGAVHSVVFGGFSPESLKDRILDADCKIVITADEGLSNVDEALLGCPDVKNTLVIKRTG
ACS2_CANGA      ----------------------------------------------------------------------
S27A4_PONAB     EFVGLWLGMAKLGVEAALINTNLRRDAQLHCLTTSRARALVFGSE----MASAICEIHASLDPSLSLFCS
ACSA_PSYCK      EAMVAMLACTRIGAVHSVVFGGFSAESLGNRIIDSQSKLVITADEGIRGNKRTPLKANVDRALDMTDSVS
ACSA_RALEH      EGVVAMQACARLGATHSVVFGGFSAKSLQERLVDVGAVALITADEQMRIADDALAGCEAVRNVIVY---R
S27A4_MOUSE     EFVGLWLGMAKLGVEAALINTNLRRDALRHCLDTSKARALIFGSE----MASAICEIHASLEPTLSLFCS
PRPE_ECOLI      EAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSADAGAKLLDDAISQAHQPRHVLLVD---
ACSA_SACD2      EAAYAMLACARIGAVHSIVFGGFSPEALKDRIVDSDCKVLITADEGLRGADKAVAHCPQVHSVIVV----
ACSA_RALPJ      ----------------------------------------------------------------------
S27A4_MACFA     EFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFGSE----MASAICEIHASLDPSLSLFCS
ACSL1_HUMAN     EWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSVFVDKPEKAKLLLEGVENIPGLKIIVVMDAYG
ACSA_AGRRK      EAAYAMLACARIGAVHSVVFGGFSPEALGGRIVDCQSTFVITCDEGLRGGKPIPLKENTDTAIHIAAKQF
S27A3_HUMAN     EFLWLWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEP------DLPALRAMGLHL
ACSL3_RAT       EWMIAAQACFMYNFQLVTLYATLGGPAIVHGLNETEVTNIITSKELLQTLKDIVSLVPRLRHIITVDGKP
ACSA_RHIEC      ----------------------------------------------------------------------
ACSA_RHIE6      ----------------------------------------------------------------------
ACSA_AGRVS      ----------------------------------------------------------------------
FAD11_MYCTU     ----------------------------------------------------------------------
ACSL5_HUMAN     EWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMD
ACSA_XANCP      DAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPG--T
ACSA_XANC8      DAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPG--T
ACSA_CUPTR      ----------------------------------------------------------------------
ACSA_BRUSU      ----------------------------------------------------------------------
ACSA_BRUSI      ----------------------------------------------------------------------
ACSA_BRUO2      ----------------------------------------------------------------------
ACSA_BRUME      ----------------------------------------------------------------------
ACSA_BRUMB      ----------------------------------------------------------------------
ACSA_BRUC2      ----------------------------------------------------------------------
ACSA_BRUAB      ----------------------------------------------------------------------
ACSA_BRUA2      ----------------------------------------------------------------------
ACSA_BRUA1      ----------------------------------------------------------------------
ACBG2_MOUSE     EWVVTALGTILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQ--LQKILLIPPDKMETVIVQYKL
BGM_DROME       ---------------------------VQHVLESSHAQIVVVDDDKIHAIRDKLPK---LKAAIQIQEPY
ACSL3_MOUSE     EWMIAAQACFMYNFQLVTLYATLGGPAIVHGLNETEVTNIITSKELLQTLKEIVSLVPRLRHIITVDGKP
ACSA_SINMW      EAAYAMLACTRIGAVHSVVFGGFSPEALAGRIVDCESTFVITCDEGVRGGKPVALKENTDTAVGIAAKQN
VRAA_STAES      ----------------------------------------------------------------------
S27A4_HUMAN     ----------------------------------------------------------------------
ACBG2_XENLA     -----------------------------YVAQNCEANIIVVENQKQ--LQKILQVQDQLPHLAIIQYKD
S27A2_MOUSE     AYVWIWLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPDLQEAVEEALPTLKDAVSVFYVSRTS
FAD28_MYCBO     ----------------------------------------------------------------------
FAD26_MYCTU     ----------------------------------------------------------------------
ACSA_STRAW      EAVVAMLACARIGAAHSVVFGGFSXXXXXXXXXXXXXXLVITADGGYPAVDDAVSRGDGVEKVLVVRRTG
ACSA_AGRRH      EAAYAMLACARIGAIHSVVFGGFSPEALGGRIVDCQSTFVITCDENVDKAIDIAARGHVMVKNVLVIRRT
S27A1_RAT       ----------------------------------------------------------------------
PRPE_SALTY      EAQITLLACARIGAIHSVVFGGFASHSVAARIDDARPALIVSADAGAKLLDDAIAQAHQPKHVLLVD---
MBTM_MYCSS      ----------------------------------------------------------------------
ACSA_PSEU5      EAAVAMLACARIGAIHSVVFGGFSPEALAGRIIDGSSKVVITADQGIRGGKTALKENVDE---ALTNPQT
ACSB_DICDI      ----------------------------------------------------------------------
ACSA_SHEB9      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGIDDALKN-PDVTTVVIVLKRT
ACSA_SHEB8      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGIDDALKN-PDVTTVEKVIVLK
ACSA_SHEB5      EAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGIDDALKN-PDVTTVEKVIVLK
S27A1_MOUSE     ----------------------------------------------------------------------
LCF1_YEAST      ----------------------------------------------------------------------
Y3568_PSEAE     QAAMAMLACARLGAVHSVVFGGFAPYELALRIDDATPKLVLTASCGLEFLVDKALELHQPAHVMVWQRP-
ACSL6_MOUSE     EWIIAELACYTYSMVVVPLYDTLGPGSISYIINTADITVIVDKPHKATLLLEHVEETPGLKLVILMEPFE
ACSA_OCHA4      ----------------------------------------------------------------------
ACSL6_HUMAN     EWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISVIVDKPQKAVLLLEHVEETPGLKLIILMDPFE
VRAA_STAHJ      ----------------------------------------------------------------------
S27A2_RAT       AYVWLWLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPELHEAVEEVLPTLKEGVSVFYVSRTS
ACSL1_MOUSE     EWVIVEQGCFSYSMVVVPLYDTLGADAITYIVNKAELSVIFAAKLLLEGVENKLTPC--LKIIVIMDSYG
S27A1_HUMAN     ----------------------------------------------------------------------
S27A1_BOVIN     ----------------------------------------------------------------------
FAD25_MYCTU     DYVVSFIASLQAGIVAVPLSI---PQGGAHVFADTAPAIVLTASSVVDNVVE-----------YVQPQPG
ACS2L_HUMAN     LAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLKIVDEAVKHCPTVQHVLVAHRTD
LCF3_YEAST      ----------------------------------------------------------------------
ACSL5_RAT       EWVISELACYTYSMVAVPLYDTLGAEAIIYVINRADISVVICATMLIENVEKDLTP--GLKTVILMDPFD
ACSL5_MOUSE     EWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADIPVVICATMLVENVEKGLTP--GLKTIILMDPFD
ACSL1_RAT       EWVTIEQGCFTYSMVVVPLYDTLGTDAITYIVNKAELSVIFAAKLLLEGVENKLTPC--LKIIVIMDSYD
ACSL1_CAVPO     EWVIIEQACFAYSMVVVPLYDTLGADAITYIVNKAELSVIFAARILLESVENKLTP--GLKIIVVMDSGS
AACS_CHICK      --------------------------------------------NHLEKLLSVVKGLPDLKKVVVIPSSR
ACS1_YEAST      EAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVITTSNRGGIVDDALRETPGVRHVLVYRKTN
ACBG2_RAT       -----------------------------YVIKQANVNVLIVENDQQ--LQKILSIPPDKMETVIVQYRL
S27A6_HUMAN     DFVHVWFGLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVWMKDSVP
BGML_DROME      ----------------------------------------------------------------------
MENE_HAEIN      ----------------------------------------------------------------------
ACSA_MOUSE      ELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDNLKELADESLEKCREVRCCIVVDSPS
ACSL6_RAT       EWIIAELACYTYSMVVVPLYDTLGPGSIRYIINTADITVIVDKPHKAILLLEHVEETPGLKLVILMEPFD
AAS_PHOLL       ----------------------------------------------------------------------
ACSS3_HUMAN     QAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASRRVEYVEEALKGQHKPDKILIYNRPN
ACSS3_PONAB     QAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASRRVEYVEEALKGQHKPDKILIYNRPN
ACBG2_HUMAN     ----------------------------------------------------------------------
ACSS3_MOUSE     QAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIELLEEALRGQHRPDRVLIYSRPN
ACSA_CAMJJ      ETAIVMLACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVTADGAFPAVDKALSECESVEKVLIVIRNN
ACSA_CAMJE      ETAIVMLACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVTADGAFPAVDKALSECESVEKVLIVIRNN
ACSA_CAMJ8      ETAIVMLACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVTADGAFPAVDKALSECESVEKVLIVIRNN
FAT1_COCHE      ----------------------------------------------------------------------
LCF2_YEAST      EWILTDLACQAYSLTNTALYETLGPNTSEYILNLTEAPILIFAKSNMYHVLKMVPDMKFVNTLVCMDELT
FCSB_DICDI      ----------------------------------------------------------------------
ACSA_HUMAN      ELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDNLKELADEALQKCQEVRCCIVVDSTS
AACS_RAT        ----------------------------------------------LEKLQRVVKGLPDLQRVVLIPLPR
S27A2_HUMAN     AYVWLWLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPE----LQAAVEEI--LPSLKKDDVSI
AACS_MOUSE      ----------------------------------------------LEKLQRVVKGLPDLQRVVLIPLPR
FAD21_MYCLE     ----------------------------------------------------------------------
PCL_RHOS4       ----------------------------------------------------------------------
ORA_PLAFN       ----------------------------------------------------------------------
ACSS3_BOVIN     QAMYAMLACARIGAIHSLIFGGFASKELSTRIDHAKPKLVITASFGIELVEEALRGQHKPDKVLIYNRPH
MBTM_MYCPA      ----------------------------------------------------------------------
FAT1_YEAST      ----------------------------------------------------------------------
ACSA_NOSLI      EAAVAMLACARIGAVHSIVFGGFSPDSLSSRIQDSDCVLLITADEKVN-ADEALKTCPSIRHVIVAKNTG


                         +         .         .         .         .         *         .:210
query           QTIEKLAQPMAISWERLLSLGTTQQSPGHRRIDSDMAAILYTSGSTGRPKGVVLSHRNLVAGAQSVAQYL
LCFB_BACSU      EAEPEAADPMKMTTFAKILRPTSAAKQNQEPVPDDTAVILYTSGTTGKPKGAMLTHQNLYSNANDVAGYL
GRSB_ANEMI      --------------DSLYKGDSSNLAPVNQA--GDLAYIMYTSGSTGKPKGVMVEHRNVIRLVKN-TNYV
SRFAB_BACSU     WRNESKERPSSISGSR------------------NLAYVIYTSGTTGKPKGVQIEHRNLTNYVSWFSEEA
LGRD_BREPA      VDVDNIQTDVA---------------------STNLAYVIYTSGTTGLPKGVAVEHRSAMNMVQAYIAYF
LGRC_BREPA      TNAET-------------SVG-----------EHNLAYVIYTSGSTGLPKGVMIEHRSVINLAYDLIRHF
GRSB_BREBE      --------------DSLYKGDSSNLAPVNQA--GDLAYIMYTSGSTGKPKGVMVEHRNVIRLVKN-TNYV
BACC_BACLI      ---KGLAKDMAA------------ENLGHTSGSSDMAYVIYTSGSTGKPKGVMVNHQSIVNTLYWRKQSY
LGRA_BREPA      SNPPLVNQP------------------------GDLVYVMYTSGSTGKPKGVMIEHGNVLHGMQDEYPLL
LCFA_SALTY      RLVPKYHLPDAISFRSALQHGYRMQYVKPEVVAEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVATYL
LCFA_SALTI      RLVPKYHLPDAISFRSALQHGYRMQYVKPEVVAEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVATYL
LCFA_ECO57      RLVPKYHLPDAISFRSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVATYL
DHBF_BACSU      QEIIK------------------RYSPENQDVSVSLAYIIYTSGSTGRPKGVVVTQKSLSNFLLSMQEAF
LCFA_ECOLI      RLVPKYHLPDAISFRSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVATYL
LCFA_ECOL6      RLVPKYHLPDAISFRSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVATYL
LCFA_BACSU      NILYPLTQKQKIDFDKTANIHTFASCMKQEKTEHDIAVLQYTGGTTGAPKGVMLTHQNILANTEMCAAWM
LCFA_YERPE      RLVPKYYLPDAISFRTVLQKGRRMQYVKPDVINTDTAFLQYTGGTTGVAKGAILTHRNMQSNLQAKAAYL
TYCC_BREPA      LRPEDCGNPAIVNGA------------------SDLAYVMYTSGSTGKPKGVMVEHRN-VTRLVMHTNYV
TYCB_BREPA      QT------------DNLPCANTP----------SDLAYIIYTSGTTGKPKGVMLEHKG-VANLQAVAHHL
MYCC_BACSU      LDMED-PQTFSEDGSNLESISGPNQ----------LAYVIYTSGSTGKPKGVMVEHRSVINRLVWMQENY
PPSD_BACSU      LTIESVEEDDKSP--------LPQMSSAHH-----LAYIIYTSGTTGRPKGVMVEHKGIANTLQWRRNAY
BACA_BACLI      ERIA----------------GQDRSDIDNVNQSGDLAYVIYTSGSTGKPKGVMIEHQSLINLCSWHQSCF
LGRB_BREPA      DNLECVSHA------------------------NHLAYVIYTSGSTGKPKGVMIEHANIIFALQELYPLL
SRFAA_BACSU     ESYHADARNLALPLD-----------------SAAMANLTYTSGTTGTPKGNIVTHANILRTVKET-NYL
GRSA_BREBE      EDTIKIRE------------GTNLHVPSK---STDLAYVIYTSGTTGNPKGTMLEHK----GISNLKVFF
GRSA_ANEMI      EDTIKIRE------------GTNLHVPSK---STDLAYVIYTSGTTGNPKGTMLEHK----GISNLKVFF
DLTA_BACCN      RTV---------SQNNLKDIFFTHKNPEHAVKDDENFYIIYTSGSTGNPKGVQITHNCLVSFTKWAIQDF
PPSC_BACSU      LECEEVKRHVSASVS-----------------DGSLAYVIYTSGSTGQPKGVAVEHRQAVSFLTGMQHQF
MYCA_BACSU      VLLDEESS----YHEDRSNLEPTCGA-------NDLAYMIYTSGSTGNPKGVLIEHRGLANYIEWAKEVY
ACSF2_MOUSE     --------PGTLLLDDIVAAGGKEQNLAQLRYNQDPINIQFTSGTTGNPKGATLSHHNIVNNSMLIGQRL
4CLL4_ORYSJ     RLPGDSSDPRIVA--TIEEISATTPDPARRKTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMTRF
PPSA_BACSU      FSGETLEVDMT-------SLAS-EKAENHEFTPADLAYVIYTSGSTGQPKGVAVEHRQAVSFLTGMQHQF
4CLL6_ARATH     ----------------------------------DVAAIMYSSGTTGASKGVLLTHRNLIASMEEASQYE
ACSF2_RAT       --------PGTLLLDEVVAAGGKEQNLAQLRYHQDPINIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRL
ACSF2_HUMAN     --------PGTLLLDEVVAAGSTRQHLDQLQYNQDPINIQFTSGTTGSPKGATLSHYNIVNNSNILGERL
TYCA_BREPA      --VGYSGEVVVLDEEQLDARETANLHQPSK--PTDLAYVIYTSGTTGKPKGTMLEHK----GIANLQSFF
LCFA_HAEIN      QLXXXXXXXHAVTFREVLSIGKYRQYVRPEISREDLAFLQYTGGTTGVAKGAMLTHGNIITNAKWIAEPF
MBTB_MYCSS      --------PATVEPDR-------------------VAYVLFTSGSTGAPKGVEVTHAAAMNTLEFINDHF
ANGR_VIBAN      KNSPSNDLFFFLDWQTAIK-SEPMRSP-QDVAPSQPAYIIYTSGSTGTPKGVVISHQGALNTCIAINRRY
4CL1_TOBAC      --------------EGCLHFSELTQSDEHEIPEDDVVALPYSSGTTGLPKGVMLTHKGLVT---SVAQQV
4CL2_SOLTU      GCVH---------FSELIQ-SDEHEIPDVKIQPDDVVALPYSSGTTGLPKGVMLTHKGLVT---SVAQQV
FADK_ECOLI      TSSLSLSQIIADN----TSLTTAITTHG-----DELAAVLFTSGTEGLPKGVMLTHNNILASERAYCARL
DLTA_BACHK      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTQWAVEDF
DLTA_BACCZ      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTQWAVEDF
DLTA_BACC3      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTQWAVEDF
DLTA_BACC0      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTQWAVEDF
DLTA_BACAH      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTQWAVEDF
ACVS2_PENCH     -RLEPLLASLA---------QDSSKFPAHNLDDQQLAYVTYTSGTTGFPKGIFKQHTNVVNSITDLARYV
ACVS1_PENCH     -RLEPLLASLA---------QDSSKFPAHNLDDQQLAYVTYTSGTTGFPKGIFKQHTNVVNSITDLARYV
PPSB_BACSU      ITIEHTE---------------SYQTEAPNMPPGDLAYLIYTSGTTGRPKGVLVDHHGIANTLQWRREEY
DLTA_BACAN      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTQWAVEDF
DLTA_BACAC      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTQWAVEDF
DLTA_BACAA      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTQWAVEDF
ACVS_CEPAC      SLFDNLAQQTQHSPE-------TSGNLTHLPLNSQLAYVTYTSGTTGFPKGIYKEHTSVVNSITDLARYG
4CL1_SOLTU      GCVH---------FSELIQ-SDEHEIPDVKIQPDDVVALPYSSGTTGLPKGVMLTHKGLVT---SVAQQV
4CLL7_ARATH     VEIPPGSNSKILSFDNVMELSEVSEYPFVEIKQSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTQDL
CAIC_SALAR      LPAEKAQQPDVL-------LYTPPLTP------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSSWQC
DLTA_BACC2      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTKWAVEDF
DLTA_BACCR      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTKWAVEDF
DLTA_BACC4      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTKWAVEDF
ACSF2_MACFA     --------PGTLLLDEVLAAGSTXXXXXXXXXXXDPINIQFTSGTTGSPKGATLSHYNIVNNSSILGERL
ACVS_EMENI      SAIDQ--QPSTFPRANLRDPSLTSK---------QLAYVTYTSGTTGFPKGILKQHTNVVNSITDLARYV
DLTA_BACCQ      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTKWAVEDF
DLTA_BACC1      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTKWAVEDF
PKSJ_BACSU      ALLDQ-------DWDEIAQTASDRKVLTRTVTPENLAYVIYTSGSTGKPKGVMIPHKALTNFLVSMGETP
PPSE_BACSU      GLMEENDIPINIS-----------SSP------DDLAYIMYTSGSTGRPKGVMIT-XXXXXXXXXXXXYT
4CLL9_ARATH     ---------------------------------SDPAAILFSSGTTGRVKGVLLTHRNLIASAVSHQRTL
BACB_BACLI      -------DTRSFSKENLPNVNKA----------SDLAYVIYTSGSSGRPKGVMTTHRNVVHYVDAFTKRI
DLTA_BACC7      RIVSE---------DNLKDIFFTHKNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTKWAVEDF
CAIC_PROSL      EQSEKAKHPVTLNHHTPLSV-------------DDTAEILFTSGTTSQPKGVVITHYNLIAGYYSSWQNA
DLTA_BACLD      -----VVEPGVLEGD-----GVPETDPGRWVHGEDTFYIIYTSGSTGNPKGVQISADNLQSFTDWITNDF
ACSF2_PONAB     --------PGTLLLDEVVAAGSTRQHLDQLQYNQDPINIQFTSGTTGSPKGATLSHYNIVNNSNMLGERL
4CL2_ARATH      DAIP----------ENCLRFSELTQSE-EPRVDSDVVALPFSSGTTGLPKGVMLTHKGLVT---SVAQQV
MYCB_BACSU      IDLND-----ETSYHADCSLLSPIAEHSH------LAYVIYTSGTTGKPKGVMVEHGGIVNSLQWKKAFF
DLTA_BACWK      RTSEDNLKDIFFTHK-----GNTP-NPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTKWTVEDF
MENE_BACSU      KEYEHIVQTIDVD-ELMKXXXXXXXXXXYMQMDAT-ATLMYTSGTTGKPKGVQQTFGNHYFSAVSSALNL
DLTA_BACA2      NLIK------TVTPEELAADGDADLSRENWVKELDTFYIIYTSGSTGNPKGVQISADNLQSFTDWICRDF
SRFAC_BACSU     RFEEQASDP------------ATAIDP------NDPAYIMYTSGTTGKPKGNITTHAN-IQGLVKHVDYM
LUCI_PHOPE      DLGGYQCLNNFISQNSDINLDVKKFKPNSFNRDDQVALVMFSSGTTGVSKGVMLTHKNIVARFSHCKDPT
CAIC_SALSV      PADDGVSHFSQLQARQSATLCYTPALS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_PROMH      EQSEKAKHPVTLNHHTPLSV-------------DDTAEILFTSGTTSQPKGVVITHYNLRFAGYYSSWQN
MENE_GEOKA      ----------------------------------EVATIMYTSGTTGTPKGVLQTYGNHWWSAVGSALNL
CAIC_SALTI      PADDGVSHFSQLQARQSATLCYTPALS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_SALPB      ---EQLPADDGVSFTQRQSRQSTTLCYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_SALDC      PADDGVSHFSQLQARQSATLCYTPVLS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_SALNS      PADDGVSHFSQLQARQSATLCYTPALS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_SALCH      PADDGVSHFSQLQARQSATLCYTPALS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_SALA4      ---EQLPADDGVSFTQLQSRQSTTLCYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
ACSF2_BOVIN     VISVDAHLPGTLLLDEVVAAGSQEQNLTRLRHTQDPINIQFTSGTTGSPKGATLSHYNIVNNANMIGQRL
4CL1_PETCR      DCLH---------FSKLMEADESEMPEVVINSD-DVVALPYSSGTTGLPKGVMLTHKGLVT---SVAQQV
DLTA_LACPL      --------------------------------------IIFTSGTTGMPKGVQISHDNLVSYVDWMLSDL
CAIC_SALPK      PADDGVSLFSQLQARQSATLCYTPALS-----TDDAAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_SALPC      PADDGVSHFSQLQARQSATLCYTPALS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_SALPA      PADDGVSLFSQLQARQSATLCYTPALS-----TDDAAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
4CLL5_ARATH     ERVDSVGDV-----RRLVEMMKKEPS-GNRRVDQDTATLLYSSGTTGMSKGVISSHRNLIAMVQTIVRFG
4CL2_PETCR      DCLH---------FSKLMEADESEMP--EVVIDSDVVALPYSSGTTGLPKGVMLTHKGLVT---SVAQQV
DLTA_LACCB      ----------------------------HAVVGDDNYYIIFTSGTTGKPKGVQISHDNLLSYVNWNISDF
DLTA_LACC3      ----------------------------HAVVGDDNYYIIFTSGTTGKPKGVQISHDNLLSYVNWNISDF
CAIC_CITK8      APVEKDQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSSWQC
MENE_BACLD      --VQNAACPPVTEIESI-------------HLD-DAATIMYTSGTTGRPKGVMQTFANHYFSAVSSALNL
HTS1_COCCA      EFIRSLPLPPKPNHQPMVGL-------------NDDLYVVFTSGSTGVPKGAVATHQAYATGIYEHAVAC
DLTA_LISMC      --------------------------------NDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNWILQDF
CAIC_SALTY      PADDGVSHFTQLQARQSATLCYTPVLS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
CAIC_SALHS      PADDGVSHFTQLQARQSATLCYTPVLS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
DLTA_LISIN      LTQDQLMDALEKHFEEV-------PDPAECVKNDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNWILQDF
DLTA_LISW6      LNAENLVDALEKHFDE-------KPDPTSCVKNDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNWILQDF
CAIC_SALEP      PADDGVSHFSQLQARQSATLCYTPALS-----TDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQI
DLTA_LISMH      --------------------------------NDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNWILQDF
DLTA_LISMF      --------------------------------NDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNWILQDF
DLTA_LACRH      ----------------------------HAVAGDDNYYIIFTSGTTGKPKGVQISHDNLLSYVNWNISDF
FAT2_YEAST      FRVEYDIYSPEDNYKRVISLNNAKKFPGFAR-SSDVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTY
DLTA_LISMO      --------------------------------NDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNWILQDF
BCLA_THAAR      ED----------SLAALLATGSEQFEAAPTRPD-DHCFWLYSSGSTGAPKGTVHIHSDLIHTAELYARIL
PKSN_BACSU      ------SHVKAINIELACRNGTDQQSSGLKRKPEHLAYIIYTSGSTGEPKGVMVEHRSIMNTLNFLESHY
DLTA_BACSU      QQIQ------TVSAEELLENEGGSVSQDQWVKEHETFYIIYTSGSTGNPKGVQISAANLQSFTDWICADF
CAIC_ECO27      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CL_VANPL       XXXXXXXXNILHFSE--LTGADENEMPKVEISPDGVVALPYSSGTTGLPKGVMLTHKGLVT---SVAQQV
MENE_BACP2      YTMETLPEAGQENVKKIENDFDLNQT----------ATIMYTSGTTGRPKGVEQTFGNHFHSAVSSALNM
MENE_LISMO      ---------------------------------SRTASIMYTSGTTGKPKGVIQTYENHWWSAVASVLNL
MENE_LISIN      ---------------------------------SRTASVMYTSGTTGKPKGVMQTYENHWWSAVSSVLNL
DLTA_STRPZ      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
DLTA_STRPM      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
DLTA_STRPG      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
DLTA_STRPF      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
DLTA_STRPD      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
DLTA_STRP8      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
CAIC_ECOLU      FTQLKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CLL3_ORYSJ     ----------------------------------DAVAILYSSGTSGRSKGVVLTHRNLIAMTEEASQYH
DLTA_STRPC      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
DLTA_STRP6      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
DLTA_STRP3      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
DLTA_STRP1      LIIAIEEFPLTIEGISLVSLSEIESAKTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEAF
MENE_BACA2      ----------------------------------DTATLMYTSGTTGRPKGVQQTFGNHYSSAVSSALNL
CAIC_SHISS      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECO5E      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECO57      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECO45      FTQLKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
ACVS_NOCLA      -----VAGPHPEQ---------ARENPGLALSSRDRAYVTYTSGTTGVPKGVPKYHYSVVNSITDLSERM
MENE_GEOSW      ----------------------------------DIATIMYTSGTTGKPKGVLQTYENHWWSAIGSALNL
CAIC_ECOSM      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECOSE      PADDGVS-----SFTQLKNQQPATLCYAPPLLTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECO55      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CL2_TOBAC      GCLHF----------SVLTQANEHDIPEVEIQPDDVVALPYSSGTTGLPKGVMLTHKGLVT---SVAQQV
MENE_LISMF      ---------------------------------SRAASVMYTSGTTGKPKGVVQTYENHWWSAVASVLNL
CAIC_ECOUT      FTQLKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECOK1      FTQLKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECO8A      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
MENE_BACC7      IPVYSFAEVMN---------GPKEEASIQEEFSLEEATIIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
CAIC_ECOHS      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
ACSM5_RAT       ----DTSRPGWINFRELLRVA----SPEHRTRSGDSMAIYFTSGTTGTPK--MVEHSQCSYGLGFVA---
CAIC_ECO7I      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CLL6_ORYSJ     ------------------------------------AALLYSSGTTGRVKAVAITHRNLIAQISAYNAIR
ACSM1_BOVIN     RE----------GWLDFRSL-VKSASPDHICIKSDPMAIFFTSGTTGFPKMAKHSHGALRSYFPACRKLL
FAT2_SCHPO      SRLVRIVHFEGAKINAPQPLGLPQPD--------DVMLVLHTSGTTGRPKVVPLTHKNLCRSIHNITTSY
CAIC_ESCF3      --VELPADDGVSSFTQLKNQQPVTLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECO81      FTQLKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECO24      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CL_PINTA       EGCQHIS---------VLTEADETQCPAVKIHPDDVVALPYSSGTTGLPKGVMLTHKGLVS---SVAQQV
CAIC_SHIDS      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECOL6      FTQLKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECOL5      FTQLKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CLL1_ORYSJ     XXXXXXXXXXXXTVTLYTNLVAGVKEADYRRPQSDTAALLYSSGTTGDSKGVILTHRNFIAAARMVTQDE
CAIC_SHIFL      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CLL2_ORYSJ     ----------------------------------DAAAVLYSSGTSGRSKGVVVTHRNLIAMVEEASQYT
CAIC_ECOLC      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CL3_ARATH      PE-------NCLPFSTLITDDET--NPFQETVDDDAAALPFSSGTTGLPKGVVLTHKSLIT---SVAQQV
MENE_BACC1      IPVYSFAEVMN---------GPKEEASIQEEFSLEEATIIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
ACVS_STRCL      -----LDEQAAADTDGLLSV-KPELALGVR----DLAYLTYTSGTTGVPKGVPKYHDSVVNSITDLSERM
4CL4_ORYSJ      ----------------------------------DVVALPYSSGTTGLPKGVMLTHRSLVT---SVAQQV
MENE_BACCR      VPVYSLAEVMN---------GPKEEASIQEEFSLEEATIIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
LUCI_LUCCR      -----------------------------------VALIMNSSGSTGLPKGVQLTHENTVTRFSHARDPI
ACSM3_MOUSE     ------SQHSREGWGNLKEM-MKYASDSHTCVDTEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFL
4CLL2_ARATH     --------------ETMIETEPSESRVKQRVNQDDTAALLYSSGTTGTSKGVMLSHRNLIALVQ--AYRA
ACSF3_HUMAN     ------------------------------------AMIIYTSGTTGRPKGVLSTHQNIRAVVTGLVHKW
MENE_BACWK      SFAEVMQGPKAEAFQEEFSL-------------EEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
DLTA_STRA5      --------------------------------------IIFTSGTTGLPKGVQISHDNLLSFTNWMISDD
DLTA_STRA3      --------------------------------------IIFTSGTTGLPKGVQISHDNLLSFTNWMISDD
DLTA_STRA1      --------------------------------------IIFTSGTTGLPKGVQISHDNLLSFTNWMISDD
ACSF2_DANRE     VIVTDSQQPGSFLLKDLMQAGSSQQDLQKKLVCDDPINIQFTSGTTGKPKGATLSHHNIVNNAYFTGMRI
CAIC_ECOLI      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECODH      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
CAIC_ECOBW      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
MENE_BACCZ      GPKEEASIQEEFSLKEAMT-------------------IIYTSGTTGKPKGVILTYGNHWASAVGSSFNL
ENTF_ECO57      TP--QGSAPLQLS------------QPHHT------AYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHY
MENE_BACAH      GPKEEASIQEEFSLREAMT-------------------IIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
LUCI_PHOPY      --------------------------------DKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPI
4CLL7_ORYSJ     ---------------------------------SETAAIQYSSGTTGRVKAAALPHRSFIAMVAGFHALR
3HBCL_THAAR     QVVDEAPAPAIIAFKHFLTLESVQVAP------DDVAYWLYSSGTTGRPKAVMHAHRSVLIADRLEREYF
MENE_BACHK      GPKEEASIQEEFSLREAMT-------------------IIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
MENE_BACCQ      GPKEEAFIQEEFSLEEAMT-------------------IIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
MENE_BACC0      --------------------------------------IIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
MBTB_MYCPA      ------------------------------RVDGELAYVLFTSGSTGEPKGVEVTHDAAMNTVEFIGRHF
DLTA_STRE4      --------------------------------------IIFTSGTTGQPKGVQISHANLLSFTNWMIEDA
YDAB_BACSU      TAYETSAEFEALFAGPDHLPETEMVSP------DDTALLMFTSGTTGNPKRCMITHGGIYRYVKKSNSSI
DLTA_STRMU      ----------------------------------DTYYIIFTSGTTGKPKGVQISHDNLLSFTNWMAEAF
ACSM1_MOUSE     HE----------GWLDFCSL-IKSASPDHTCIKSKMKAIFFTSGTTGYPK--MAKHNQGLAFRSSCRKLL
4CL3_DICDI      QTLKEIDQLTLSSDGIVMSFNQLTNNNGKDRIDKDTAIIPFSSGTTGLFKGVCLSHYNLVSNTYQT-QTI
MENE_BACCN      YTFEEVEQSVVIQEEFSLAEAMT---------------IIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
ACSM5_MOUSE     ----DTSRPGWINFRELLRAASPEHNCVRTR-SGDSVAIYFTSGTTGAPKMVEHSQSSYGLGVASGRRWM
MENE_BACAN      GPKEEASIQEEFSLREAMT-------------------IIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
MENE_BACAC      GPKEEASIQEEFSLREAMT-------------------IIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
MENE_BACAA      GPKEEASIQEEFSLREAMT-------------------IIYTSGTTGKPKGVILTYGNHWASAVGSSLNL
LUCI_LUCLA      ----KVDYRGYQSMDNFIKKNTPQGFKGSSNRKEQVALIMNSSGSTGLPKGVQLTHENAVTRFSHARDPI
HMWP2_YERE8     ------------------------------RAPTQPAYIIYTSGSTGTPKGVVISHRGALNTCCDINTRY
ACS2B_HUMAN     ---EKSCDGW-LNFKKLLNEASTT----HHCVETEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
4CL1_DICDI      QTLKEIDQLTLSSDGIVMSFNQLINNNGKDRIDKDTAIIPFSSGTTGLFKGVCLSHHNIVSNTYQT-QTI
ACSA_PSEA6      HTGSHVSWGKDDVWWHDLTDGCSTDCPPEVMNAEDPLFILYTSGSTGQPKGVVHTTGGYLLWASITHKYV
4HBCL_RHOPA     PTLQ------------LANLLATEQEGGAPAATDDIAYWQYSSGTTGMPKGVMHVHSSPRVMAENAGRRI
DLTA_STAHJ      QSIQDSDNPTLFDSQ----MGLT-----------DVVYTIFTSGSTGEPKGVQIEYASLIEFAEWMVSLN
ACSM3_RAT       ------SQHSREGWGNLKEM-MKYASDSHTCVDTELMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFL
LUCI_LUCMI      -----------------------------------VALLMNSSGSTGLPKGVRITHEGAVTRFSHAKDPI
ENTF_ECOLI      PLTPQGSAPLQLS------------QPHHT------AYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHY
ALKK_PSEOL      NSNASAQMPGLIAYEDLIGQGDDNYI--WPDVDENEASSLYTSGTTGNPKGVLYSHRSTVLHSMTTADTL
ENTF_SHIFL      PLTPQGSAPLQLS------------QPHHT------AYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHY
4CL2_DICDI      QTLKEIGQLTLSSDGIVMSFNQLINNNGKDRIDKDTAIIPFSSGTTGLFKGVCLSHHNLVSNTHQTQTVE
ACSA_PASMU      KKGRDLW------WNELTANQPAFCEPEWMNAE-DPLFILYTSGSTGKPKGIVHSTGGYLLGANSFRNVF
4CLL3_ARATH     EKRVELTSGVRVVGSEMMKKETSGQRVRDRVNQDDTAMMLYSSGTTGTSKGVISSHRNLTA---YVAKYI
DLTA_STAAW      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAAT      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAAS      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAAE      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAAC      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAA8      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAA3      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAAR      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
ACS2A_HUMAN     ---EKSCDGW-LNFKKLLNEASTT----HHCVETEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
4CL5_ORYSJ      -------------------------------VANDAVALPYSSGTTGLPKGVMLSHRGLVT---SVAQLV
4CL1_ARATH      ---ESVPIPEGCLRFTELTQSTTEASEVIDSVEDDVVALPYSSGTTGLPKGVMLTHKGLVT---SVAQQV
MENE_OCEIH      ----------------------------------DIFTMMYTSGTTGFPKAVQQTFGNHWWSATSSALNL
DLTA_STAAB      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
SID2_USTMA      ITAIRLDQLDA----ELSQVQVVPPANANRSIQQ-LAYMIWTSGTTGLPKGVGIQHLAIIQAMRALRIYI
MBTB_MYCTU      -----------------------------------LAYVLFTSGSTGEPKGVEVAHDAAMNTVETFIRHF
MBTB_MYCBO      -----------------------------------LAYVLFTSGSTGEPKGVEVAHDAAMNTVETFIRHF
ACSM5_HUMAN     R-------PGWLNFRELLREASTEHNC-MRTKSRDPLAIYFTSGTTGAPKMVEHSQSSYGLGVASGRRWV
ACSM2_MOUSE     RE----------GWLNFKAL-LKEASTIHQCVETESAAIYFTSGTSGPPKMAEHSHCSLIKAKMDAASWT
4CLL4_ARATH     EVYQELTS--AIRVVGILSEMVKKEPSGQRVRDDDTAMMLYSSGTTGPSKGVISSHRNLTA---HVARFI
DLTA_STAAU      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAAN      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAAM      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAA9      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAA2      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
DLTA_STAA1      --------------------------------DNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELN
SIB1_SCHPO      NYSNNIENPYTKDFE-----------------DSNLAYVLYTSGSTGKPKGCCLTHHNVVQCMLAFQDQF
MENE_ENTFA      -------QPM-IKKQHSLSHQEFQQPSDLESV----ASIMYTSGTTGQPKGVLQRFKNHLASARGTQENM
ACSM3_PONAB     RE----------GWGNLKEM-MKHASDSHTCVKTEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFL
ACSM2_RAT       RE----------GWLNFKAL-LKDASPIHQCVETESAAIYFTSGTSGPPKMAEHSHCSLGLKAKMDAGWT
4CLL8_ARATH     ----------------------------------DTAMLLYSSGTTGRSKGVNSSHGNLIAHARYIAEPF
DLTA_LACLA      ---------------------------------NDSNYIIYTSGTTGVPKGVEVSHDNLVTFTNWMNNDF
ACSF3_MOUSE     ------------------------------------AMIFYTSGTTGRPKGALSTHRNLAAVVTGLVHSW
ACSM3_HUMAN     RE----------GWGNLKEL-MKHASDSHTCVKTEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFL
DLTA_STRZT      --------------------------------------IIFTSGTTGKPKGVQISHDNLLSFTNWMITDK
DLTA_STRPJ      --------------------------------------IIFTSGTTGKPKGVQISHDNLLSFTNWMITDK
DLTA_STRP7      --------------------------------------IIFTSGTTGQPKGVQISHDNLLSFTNWMITDK
ACSM1_HUMAN     RE----------GWLDFRSL-VKSASPEHTCVKSDPMVIFFTSGTTGFPKMAKHSHGLALQPSFPGSRKL
ACSA_GEMAT      ETFAEMQEGRDHWWHRL-----KRQVPRYCEPEADVLFVLYTSGTTGKPKGIVHTTGGFLTGVATTTKYF
4CL2_ORYSJ      ----------------------------------DPVALPFSSGTTGLPKGVVLTHRSVVSGAQQVNPNL
DLTA_STRZP      --------------------------------------IIFTSGTTGKPKGVQISHDNLLSFTNWMITDK
DLTA_STRR6      --------------------------------------IIFTSGTTGKPKGVQISHDNLLSFTNWMITDK
DLTA_STRPN      --------------------------------------IIFTSGTTGKPKGVQISHDNLLSFTNWMITDK
DLTA_STRP2      --------------------------------------IIFTSGTTGKPKGVQISHDNLLSFTNWMITDK
ACSM4_RAT       -------------WDGWLSFQELLQSASHNCVQTEPMAIYFTSGTTGSPKMAQHSQSSLGIGYALCGRYL
ACSM4_HUMAN     ------------SWNGWLSFQELFQSEEHSCVETEPMTIYFTSGTTGFPKMAQHSQSSLGIGFTLCGRYL
ACSA_NITEU      ATVHSVIQPERDHWWHDLIAGQPDEEPAWINAEHPLFT-LYTSGSTGKPKGVQHSSAGYLLGAVTSMQWV
ACSA_RUBXD      GDEVNMVEGRDLWWHELMR-EAEPECPAEEMDSEDILYILYSSGSTGKPKGIVHTTGGYLTHVNTTTDWV
ACSA_PHYBL      GSPVPWVQGRDVWWHEEMAKARTFCSPEPMSAE-DPLFLLYTSGSTGTPKGILHTTGGYLLGVAATVKYI
DLTA_STAES      ---------------------------------NDVVYTIFTSGSTGEPKGVQIEYASLNEFAEWMVSLN
ACSF3_XENLA     LHPSELLQEIKIS-----------------QLDLDWAMIIYTSGTTGRPKGVLSTHYNLYSMVTALVNEW
ACSA_LARHH      TPCSMGARD--ITWDALTAGQPLECEPEWMSAE-DPLFILYTSGSTGKPKGIQHSSAGYLLGAANSFRWF
4CL3_ORYSJ      ----------------------------------------YSSGTTGLPKGVMLTHRSLIT---SVAQQV
MENE_STAAR      TTNGLLDNTMGIQYDTSNETVVPKDSPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
BAIB_EUBSP      --------------------GRSKEMPSDRLANPNMISL--SGGTSGKMKFI---RQNLPCGLRSWSLMS
ACSA_CHRVO      NGGADWTDGRDVWWHKLIE-GQSEACEPEWMGAEDPLFILYTSGSTGKPKGIQHSTAGYLLGALNSFRWV
ACSA_BACSU      ----------------------------------------YTSGSTGTPKGVLHVHEAMIQQYQTGKWVL
DLTA_STAEQ      ---------------------------------NDVVYTIFTSGSTGEPKGVQIEYASLNEFAEWMVSLN
MENE_STAES      -----------------------------------IASIMFTSGTTGPQKAVPQTFNNHLASAKGCKQSL
ACSA_COPC7      NPVP-WTEGRDVWWHEAVAR-VPRYCPPEVMASEDPLFILYTSGSTGKPKGVVHTTGGLLCAALTVKYVF
CAIC_SHIF8      PADDKNQQPATLCYAPPLST-------------DDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQC
4CL2_SOYBN      NCLHF----------SVLSEANESDVPEVEIHPDDAVAMPFSSGTTGLPKGVILTHKSLTT---SVAQQV
MENE_STAEQ      -----------------------------------IASIMFTSGTTGPQKAVPQTFNNHLASAKGCKQSL
ACSA_SYNFM      GKVP-VVPGRDVDWTEAIKAASPDCPPEVMDAE-DPLFILYTSGSTGKPKGVLHTTGGLVYTALSHQYVF
MENE_STAAN      TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAAM      TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAA9      TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAA2      TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAA1      TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
ACSA_DICDI      ITFN----PSIDIWADEAMLDHRPYCPPVWLDSEDPLFILYTSGSTGTPKGLVHTQAGYLLYAAMTHRYV
ACSA_COPCI      NPVP-WTEGRDVWWHEAVAR-VPRYCPPEVMASEDPLFILYTSGSTGKPKGVVHTTGGLLCAALTVKYVF
ACSM4_MOUSE     ------------HWDGWLNFQELLQSASHNCVETEPMAIYFTSGTTGSPKMAQHSQGSLGIGYTLCGRYL
ACSA_XYLFA      GGTINMHTPRDRWFHHVVDIQATECAP-ERMNAEDPLFILYTSGSTGKPKGVLHTTGGLVYTSYTHETVF
ACSA_SCHPO      EPTASMVEGRDVWWHDIIPKFPRYCPPAVVNPEHPLF-LLYTSGSTGKPKGVVHCTGGYLLGAAATCKYV
ACSA_PSYIN      GGEVNWVVGRDLDWESVCADESSECEPEAMNAE-DPLFILYTSGSTGTPKGVLHTTGGLVYAAMTFKYVF
ACSA_NOVAD      ADVD-FVEGRDIDWATAVAEQSADCQPEEMNAE-DPLFILYTSGSTGKPKGVLHTTGGYSVWASMTHQYV
ESYN_FUSEQ      EFVKSLPQSSELS----------ASVKAH-----DLAYVIFTSGSTGIPKGIMIEHRSFSSCAIKFGPAL
ACSA_PYRAE      LKDVPMTEGRDYWWNKLMQGIPPNAYIEPEPVESEHPSILYTSGTTGKPKGIVHDTGGWAVHVYATMKWV
ACSA_XYLFT      GSTINMHTPRDRWFHDLVDIQATECAP-ERMNAEDSLFILYTSGSTGKPKGVLHTTGGLVYTSYTHETVF
ACSF3_BOVIN     ------------------------------------AMIIYTSGTTGRPKGVLSTHDNIRAVVTGLVHKW
ACSA_VIBCH      RTGGNVAEHRDIWWHEATAKASDNCPPEEMKAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYV
MENE_LACLA      --------------------------------DEKIAVIMNTSATTGKFKSVPITWGMISNHVKASKETL
DLTA_STAXY      ETL--LTDNRTVEFESKIK-------------DQDIAYTIFTSGSTGEPKGVQIRYESLNEFTNWMVDLN
ACSA_SALTI      NDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
ACSA_BDEBA      TTVDM--KPGRDLWYHEEVKTVSDQCEPEPMDAEDPLFILYTSGSTGKPKGVMHTTGGYLVYASMTHQYV
ACS1_DEBHA      NAHIPFTEGRDLWWEEMAKYGP--YFPPVPVNSEDPLFLLYTSGSTGKPKGIQHSTAGYLLGAAMTSKYF
4CL1_ORYSJ      DGCLHF-------WDDLMSEDEASPLAGXXXXXXXXXALPYSSGTTGLPKGVMLTHRSL---STSVAQQV
ACSA_SYNY3      VVVQRTKADVTMTWWHELQPQQSAHCPAEPIDSEDMLFILYTSGSTGKPKGVVHTTGGYNLYTHMTTKWI
ACSA_CAUCR      ADVP-LKAGRDIVWQDVRDTVSADCPPEPMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLAWASTFWAVF
4CLL9_ORYSJ     IGVDRERMPGAISWDGLLAAADRTGAPVDAAQQSDLCALPYSSGTTGVSKGVMLSHRNLVSNSSMFAVAP
MENE_STAAU      TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAAT      TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAAE      TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAAC      TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAA8      TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAA3      TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
ACSA_PYRAR      LKDVPMTEGRDFWWNRLMQGIPPNTYIEPEPVESEHPSILYTSGTTGKPKGIVHDTGGWAVHVYATMKWV
ACSA_SALTY      SDID-WQEGRDLWWRDLIEKASPEHQPEAMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
ACSA_NITEC      ---------------------------------------LYTSGSTGKPKGVQHSSAGYLLGAIVSMQWV
ACSA_BRAJA      GKIDM--NPTRDLWYHEAAAMVTTECPVEHMHAEDPLFILYTSGSTGQPKGVLHTSAGYLVYAAMTHQYV
VIBE_VIBCH      ----RVTDPKFIELASCYSASSCQANADPNQI----AFFQLSGGTTGTPKLIPRTHNDYAYSVTASVEIC
ACSA_RHOBA      Q------EGRDVWWHDVV-----ENQPGEKPLDSETPLILYTSGSTGKPKGILHTTAGYNLWAKRTFEWV
ACSA_CITK8      GKVD-WHEGRDLWWSDVIEKSSADHQPEEMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYV
ACSA_SHEFN      GGDIDWVEGRDVWWHSLMEVASEFCQPAEMNAE-DPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_AERS4      GGNVAWHNHRDIWWHEATAAASSDCPPEAMNAE-DPLFVLYTSGSTGKPKGVLHTTGGYLVYATLTFKYV
ACSA1_PSEAE     AEI-KWNQHRDVWYDDLMKVAGSTCAPKEMGAE-DPLFILYTSGSTGKPKGVLHTTGGLVYASLTHERVF
MENE_STAAW      ----------------------------------DIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
MENE_STAAS      ----------------------------------DIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
ACSA_THEEB      PSVENVLQPVTMHWWHDLQKGVSADCPAEPMDSEDLLFILYTSGSTGKPKGVVHTTAGYNLYTHITTQWV
ACSA_BEII9      GGAVDWVEGRDVRYEEAIAAASPECPLTEVEAEHPLF-ILYTSGSTGAPKGVVHCTGGYLVYASMTHQYV
MENE_STAAB      ----------------------------------DIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESL
ACSA_SHEDO      GANVDWQQGRDLDWDELMA-GVSSDCPAEEMNAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYAAMTHEYV
ACSA_PHOPR      GNVEWHSE-RDVWWHEATAVASSHCEPEEMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYV
4CLL5_ORYSJ     ---------------------------------SDTAAVLYSSGTTGRVKAVAITHRNLIALMSLHADNR
ACSA_DESAA      GADVPMKAGRDLWWHELTAKESTECPP--ESMDSDPLFILYTSGSTGTPKGVLHTTGGYIVYTSLTHQYV
ACSA_SODGM      NAIDW--QPERDVWWHDAIDGADDTCPPEAMGAEDPLFILYTSGSTGTPKGVLHTTGGYLVYAATTFKYV
ACSA_SHEHH      GGDINWVEGRDIWWDSLMDTAS-EHCIAEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYV
ACSA_ECOLI      GKID-WQEGRDLWWHDLVEQASDQHQAEEMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYV
ACSA_AERHH      GGNIAWHNHRDIWWHDAVAT-VSADCPPEAMGAEDPLFILYTSGSTGKPKGVLHTTGGYLVYATLTFKYI
ACSA_PSESM      SSVQKVIVCKRIEWNRLLEVASSTCAPKEMGAEESLF-ILYTSGSTGKPKGVLHTTAGLLYAALTHERVF
ACSA_BRASO      RTGGKIEMPTRDLWYHEAAEMVTTECPVEHMNAEDALFILYTSGSTGQPKGVLHTTGGYLVYASMTHQYV
ACS2_CANAL      NPEIHLTEGRDYYWDV-----ETAKFPGYLPPVSDPLFLLYTSGSTGTPKGVVHSTAGYLLGAALSTKYI
LCF2_SCHPO      EDLVELVKSTAITYDNLLSLGKEKPQPPHPPKADDICCYMYTSGSTGKPKGVVLLHRNIIAALGGINRIL
ACSA_METFK      --------------------------------------ILYTSGSTGTPKGVQHSTGGYLLGAMSMKWVF
ACSA_RHOCA      Q----------ISWVHYLMEHVSPECPPRPMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAAMTHQYF
ACSA_EMENI      GAEVPWTEGRDIWWHE-----EVEKYPAYIAPDSDPLFLLYTSGSTGKPKGVMHTTAGYLLGAAMTGKYV
ACSA_SYNAS      SQIP-WTSGRDFDWEGLMQEASADCPPEEMDAE-DPLFILYTSGSTGKPKGVLTTGGYLLFTAMSHQHIF
ACSA_ECOL6      GKID-WQEGRDLWWHDLVEQASAQHQAEEMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYV
ACSF4_MOUSE     ------------------------------RHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFRSLF
LYS2_SCHPO      ----------------------------------------FTSGSEGIPKGVKGRHFSLAYYFDWMAQEF
ACSA_YERPP      GNASYWEDGRDVWWHDLIKEASADCPPEEMNAE-DPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYV
ACSA_YERPN      GNASYWEDGRDVWWHDLIKEASADCPPEEMNAE-DPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYV
ACSA_YERPE      GNASYWEDGRDVWWHDLIKEASADCPPEEMNAE-DPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYV
ACSA_YERPA      GNASYWEDGRDVWWHDLIKEASADCPPEEMNAE-DPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYV
ACSA_SHEPA      KVIVMKRTGGDINWVRDIWWGSLMETASEHCIPEEMGALLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYV
ACSA_LEPIN      --VRRTGNESGLTWKDLMNDPELSAYCKPEEMDADPLFILYTSGSTGKPKGVLHTTGGYLLGANLTFHYV
ACSA_LEPIC      --VRRTGNESGLTWKDLMNDPELSAYCKPEEMDADPLFILYTSGSTGKPKGVLHTTGGYLLGANLTFHYV
ACSA_HALHL      GDIAW--NDGRDVWFHEACAEASPDCPPEHMDAEDPLFILYTSGSTGKPKGVQHSTAGYLLGTAMTHKYI
ACSA_ENTS8      GNIE-WHEGRDLWWSELVKKASAHHQPVEMNAE-DPLFILYTSGSTGKPKGVLHTTGGLVYAATTFLYAF
ACSA_YERPS      GNASYWEDGRDVWWHDLIKEASADCPPEEMNAE-DPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYV
ACSA_YERP3      GNASYWEDGRDVWWHDLIKEASADCPPEEMNAE-DPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYV
ACSA_PSEU2      SSVQKVIVCKRIEWNRLLEVASSTCAPKEMGAEESLF-ILYTSGSTGKPKGVLHTTAGLLYAALTHERVF
ACS1_CANAL      NSHVPFSPGRDLWWDEMAKYGP--YFPPVPVNSEDPLFLLYTSGSTGKPKGVQHNTAGYLLGAVLTTKYT
AAS_SHIFL       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SHIF8       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
ACSA_BURPS      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
ACSA_BURP6      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
ACSA_BURP1      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
ACSA_BURP0      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
ACSA_BURMS      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
ACSA_BURMA      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
ACSA_BURM9      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
ACSA_BURM7      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
AAS_SALDC       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
ACSA_PENCH      AEVPWTAG-RDIWWHEEVEKYPNYLAP-ESVSSEDPLFLLYTSGSTGKPKGVMHTTAGYLLGAAMTGKYV
ACSA_MARMS      EKDVPWFEGRDLDWAVEVENESTE-CPAERMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYASLTHELV
ACSA_MAGSM      LEIEWTEGRDV--WYHEAIAAASADCPPEEMDAEDPLFVLYTSGSTGKPKGVLHTTGGYLLYASITHQYI
AAS_ECOUT       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOK1       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECO45       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
4CLL1_ARATH     ----------AVNWKDLLEAGDKCGDTDNEEIQTDLCALPFSSGTTGLQKGVMLTHRNLIANLCSTLFGV
ACSA_VIBPA      GNVDWHGHRDV--WWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGLVYAAMTFKYVF
ACSA_PSEHT      ----------------------------------DPLFILYTSGSTGQPKGVVHTTGGYLVYASMTHEYI
ACSA_PSE14      SSVQKVIVCKRIEWNRLLEVASSTCAPKEMGAEESLF-ILYTSGSTGKPKGVLHTTAGLLYAALTHERVF
ACSA_ECO57      GKID-WQEGRDLWWHDQVEQASDQHQAEEMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYV
ACSA1_PSEPK     SSVQKIIQHRDIWYEDLMKVASSHCAPKEMGAEEALF-ILYTSGSTGKPKGVLHTTGGLVYAALTHERVF
ACSA_METSO      --------------------------------------ILYTSGTTGKPKGIEATGGNAVGPAQTLHWVF
AAS_SHISS       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SHIB3       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALTI       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALSV       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALPK       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALPB       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALPA       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALHS       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALG2       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALEP       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALA4       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOSM       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOSE       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOLU       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOLI       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOLC       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOL6       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOHS       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECODH       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOBW       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECO5E       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECO57       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECO55       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECO27       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECO24       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
ACSA_SERP5      RTGKPYWQEGRDLWWHELTAGVSADCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGLVYAAMTFKYVF
AAS_SALTY       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALPC       ----------------------------------DEAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALNS       ----------------------------------DAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_SALCH       ----------------------------------DEAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECOL5       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
AAS_ECO7I       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
ACSA_ALHEH      GDIDKEGRDI---WYHEAVADVSADCPAEELDAEDPLFILYTSGSTGKPKGVQHCSAGYLLGAAMTHKYV
AAS_KLEP3       ----------------------------------DAAMILFTSGSEGNPKGVVHSHKSLLANVEQIKTIA
AAS_ENT38       ----------------------------------DAAMILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
4CLL8_ORYSJ     ----------------------------------DAALLFYSSGTTGRSKGVVSTHGNAIAMAASLEQY-
ACSA_YERE8      GNASYWKDGRDVWWHDLIKDASVDCPPEEMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYV
ACSA_VIBVY      GNID-WHEHRDVWWHEATAKVSDVCPPEEMKAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYV
ACSA_VIBVU      GNID-WHEHRDVWWHEATAKVSDVCPPEEMKAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYV
ACSA_THIDA      --------------------------------------ILYTSGSTGKPKGVQHSTGGYLLGALLSMLWV
ACSA_SHESH      GGDVNWVEGRDIKWESLMDTASEHCIPEEMGAE-DPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYV
ACSA_PHOLL      GNIGHWQSGRDLWWHELVA-DASADCPVEEINAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASLTFKYV
ACSA_BURTA      --------------------------------------ILYTSGSTGKPKGVQHSTAGLLWVAQTMKWTF
4CL1_SOYBN      ----------------------------------------------------------------------
ACSA_XANP2      GGKVDMLPGRDVYYDEATAM-VTDECPAEHVNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYI
AAS_YERE8       ----------------------------------DSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
ACSA_THET2      RTGEEVPWTPGRDWHELMEAAPDRCDPESMEAEEPLF-ILYTSGSTGKPKGVLHXXXXXXXXXXXXXKLV
ACSA_PARL1      GAVA-MEKGRDVWYAEEAAKVSATCAPEEMNAE-DPLFILYTSGSTGKPKGVLHTTGGYMVYASMTHQYV
ACSA_NEUCR      ADIS-MTPGRDLWWHEEVEKYPAYYTPV-AMASEDPLFLLYTSGSTGKPKGVAHSTGGYLLGAAMTGKYV
ACSA_MARAV      NDQVPWTEGRDLRYEDLMKNASAECQPEPMNAE-DPLFMLYTSGSTGAPKGVLHTTGGYMVYASMTHQYV
AAS_PECCP       ----------------------------------DAAIVLFTSGSEGNPKGVVHSHDSLLANVEQIRTVA
AAS_ESCF3       ------------------------------------ALILFTSGSEGHPKGVVHSHKSILANVEQIKTIA
ACSL4_HUMAN     KAINKAEYPEGFSMQSVEELGSNPENPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERI
ACSA_THET8      RTGEEVPWTPGRDWHELMEAAPDRCDPEPMEAEEPLF-ILYTSGSTGKPKGVLHXXXXXXXXXXXXXKLV
ACSA_BART1      MVIRRTCGP--IDWEEITHAKTN--CPAEPMNAEDPLFILYTSGSTGKPKGVLHSTGGYLVYAAITHKYV
ACS2_DEBHA      NKEVTLKEGRDYWWSE-----ETQKFAGYLPPSEDPLFLLYTSGSTGTPKGVVHSTAGYLLGAALTTKYV
4CL4_ARATH      ----------------------------------DTVAMPYSSGTTGLPKGVMITHKGLVT---SIAQKV
ACSA_RHOP5      ADV--FMDDVRDFWYHEAAEMVTTECPVEPMHAEDPLFILYTSGSTGQPKGVLHTTGGYLVFASMTHQYV
AAS_ERWCT       ----------------------------------DAAIVLFTSGSEGNPKGVVHSHDSLLANVEQIRTVA
ACSA_SHEAM      ETVIVLKRTGGAKWWHQVTDGAATECAVEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYASMTHEYV
ACSA_RHILO      GGKVGWAPGRDLWYHDEVATVKAECKPEKMKAE-DPLFILYTSGSTGKPKGVLHTTAGYLVYASMTHQYV
ACSA_LEPBJ      NESGLVWKDGRDYWYHFL-IGDPDLSPYCKSMDADPLFILYTSGSTGKPKGVLHTTGGYLLGVNLTFHYV
ACSA_BURS3      GKIDWHAERDL--WMHELTAGESDQCEPEWVGAEHPLFILYTSGSTGKPKGVQHSTGGLLWAAQTMKWTF
ACSF4_HUMAN     ------------------------------RLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLF
AAS_CITK8       ----------------------------------EAAMILFTSGSEGHPKGVVHSHKSLLANVEQIKTIA
LYS2_CANGA      GTVEGGSLPSE-SGDVLASYTELKSTRTGVVVGPDSNPTLFTSGSEGIPKGVLGRHFSLAYYFSWMAKQF
ACS2_ASHGO      SEGIPMKAGRDFWWHEEVRKQRGYLPPVSVNAE-DPIFLLYTSGSTGSPKGVVHTTGGYLLGAALTTRYV
ACSA_CRYPV      GPIE-FVKGRDFDGETLMR-SEKPYCPLEDMDSEDPLFYLYTSGSTGTPKGVQHSTAGYLLYAAVTQKYL
AAS_YERPY       ----------------------------------DSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
AAS_YERPS       ----------------------------------DSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
AAS_YERPP       ----------------------------------DSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
AAS_YERPG       ----------------------------------DSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
AAS_YERPB       ----------------------------------DSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
AAS_YERP3       ----------------------------------DSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
ACSA_BARQU      SGTIDWVKGRDFWYHEEISHAKTD-CPAEMMNAEDPLFILYTSGSTGKPKGVLHTTAGYLVYVSMTHQYV
ACSA_BARHE      MVIRRTCGPIRDFWYHEEVSHTKTDCPAEKMNAEDPLFILYTSGSTGKPKGVLHTTAGYLVYASMTHKYV
ACS2_ZYGBA      QRTGSEGIPMTAGRDYWWHEETAKQRPPVPCNSEDPLFLLYTSGSTGSPKGVVHSTAGYLLGAAMTTRYV
ACSA_METSB      KKVDGIVETMIVVWYDEALAKASPDCPAAEMNAEDPLFILFTSGSTGAPKGVVHSTGGYLVWASMTHQYV
ACSA_LEPBL      NESGLVWKDGRDYWYHFL-ISDPDLSPYCKSMDADPLFILYTSGSTGKPKGVLHTTGGYLLGVNLTFHYV
ACSA_AGRT5      GGKTGWAPGRDIWYHQEIATVKPDCPPVKMRAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYTSMTHEYV
ACS2_YEAST      GTEGIPMKAGRDYWWHEEAAKQRTYLPPVSCDAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAALTTRYV
DHBE_BACSU      ---------------------------------SDVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVC
ACSA_SHESA      RTGGKVVEGRDVWWHSLVETASEHCAIEEMGAE-DPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_METPB      GGNVAMEPGRDVYYHEAAEQ-VTDECPAEAVEAEHPLFILYTSGSTGQPKGVVHTTGGYLVYASMTHQYV
ACS1_CANGA      NPQVNFQAPRDLDWETERKKYKTYFPC--EPVDSEHPLLLYTSGSTGTPKGV----------QHSTAGYL
AAS_YERPE       ------------------------------------ALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
AAS_YERPA       ------------------------------------ALILFTSGSEGNPKGVVHSHASLLANVEQIRTIA
LYS2_PENCH      ----------------------------------------FTSGSEGRPKGVRGRHFSLAYYFPWMSETF
ACSL4_MOUSE     KTINRAEYPEGLSMQSVEELGAKPENPPSRPTPSDMAIVMYTSGSTGRPKGLMMHHTNLIAGMTGQCERI
ACBG1_BOVIN     -----MRMPSVYTMEELMELGNEVPEEANAQKPNQCCALVYTSGTTGNPKGVMLSQDNITYGSQAGDIQP
LCF1_SCHPO      EEDIKTIQEIRPNL-KLIKFADFEKMXXXXXXXXXICCIMYTSGSTGLPKGVILSHKNMVAIVTAIVKHV
AAS_ENTS8       ----------------------------------DAALILFTSGSEGNPKGVVHSHKSLLANVEQIRTIA
ACSA_LEPBP      --VKRTGDEGNLNWKEMKDPEVKKECPAVPMESEDPLFILYTSGSTGKPKGVLHTTAGYLLGANTFATIF
ACSA_LEPBA      --VKRTGDEGNLNWKEMKDPEVKKECPAVPMESEDPLFILYTSGSTGKPKGVLHTTAGYLLGANTFATIF
ACSL4_RAT       KTINRAEYPEGLSVEELGSKPENSSIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERI
ACSL3_PONAB     PTWSEFPKGIIVAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERI
ACSL3_HUMAN     PTWSEFPKGIIVAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERI
ACSA_XANAC      NTVETVLQAPRDRWFHDVVDGQPAACEPERMNAEDPLFILYTSGSTGKPKGVL----HTTAGYLLFASYT
ACSA_SHESR      RTGGKVVEGRDVWWHSLVETASEHCAIEEMGAE-DPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_SHESM      RTGGKVIEGRDVWWHSLVETASEHCAVEEMGAE-DPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_METEP      GGNVAMEPGRDVYYHEAAEQ-VTDECPAEAVEAEHPLFILYTSGSTGQPKGVVHTTGGYLVYASMTHQYV
MENE_SALTY      -QIQKSTAAYAVAWQ-----------------PQRLVSMTLTSGSTGLPKAAVHTCQAHLASAQGVLSLM
ACSA_DEIRA      IPLEWWTEGRDLWWHDVVD----RQSDQHEALDSEHPLILYTSGSTGAPKGVQHTTGGYMVGTYLTTQTV
ACS2_KLULA      ----------------------------------DPLFLLYTSGSTGSPKGVVHSTAGYLLGSALTTRFV
AAS_KLEP7       ----------------------------------DAAMILFTSGSEGNPKGVVHSHKSLLSNVEQIKTIA
LYS2_YEAST      IEGGKLDN------------GEDVLAPYDHYKDTRTGVVVFTSGSEGIPKGVLGRHFSLAYYFNWMSKRF
ACSA_XANOM      NTIETVLQAPRDRWFHDVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVL----HTTAGYLLFASYT
ACSA_SHEON      RTGGKIVEGRDVWWHSLVETASEHCAVEEMGAE-DPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_METRJ      GGSVAMEAGRDVYYDEAAEQ-VTDECPAVAVDAEHPLFILYTSGSTGQPKGVVHTTGGYLVYASMTHEYV
ACSA_BURP8      --------------------------------------ILYTSGSTGKPKGVQHSTGGLLWAAQTMKWTF
ACS1_ASHGO      NPSVSYVADRDLDWDT--EVKKYKSYCPCEPVDSEHPLLLYTSGSTGAPKGVQHSTAGYLLQAYSMLYSF
ENTE_ECO57      ----RVVQLLNDSGEHNLQDAINHPADGFTATPSPADEVVYSGGTTGTPKLIPRTHNDYYYSVRRSVEIC
ACSA_WOLSU      EEINYVPGRDYI-YNEMIGLESAHCPPEPMDAE-DPLFLLYTSGSTGKPKGVQHNQAGYILWAQTTMEWV
ACSA_SHELP      -VLERTGNPVNWVEGRDIKWASLMETASEHCVAEEMGALLYTSGSTGNPKGVLHTTGGYLVYASMTHEYV
ACSA_HELAH      KEIDYV-RGRDFVYNEMVNYQSDKCEP--EMMDSDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWV
ACS1_KLULA      NENIKYIPGRDLDWDEEVKKSYTPCEP----VDSEHPLLLYTSGSTGAPKGVQHSTAGYLLQALLSMKYT
ENTE_ECOLI      ----------------------------------EVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEIC
ACSM6_HUMAN     YD-------GWLDFKKLIQVAPPKQTY-MRTKSQDPMAIFFTKGTTGAPKMVEYSQYGLGMGSQASRRWM
ACSA_METC4      GGNVAMEPGRDVYYHEAAEQ-VTDECPAEAVEAEHPLFILYTSGSTGQPKGVVHTTGGYLVYASMTHQYV
ACSA_HERAR      --------------------------------------ILYTSGSTGKPKGVQHSSAGYLLWAMLTMKWV
ESYN_GIBPU      ---------------------------------TSLAYVVFTSGSTGKPKGVMIEHRAIVRLVKS-DNFP
AAS_ERWT9       ----------------------------------DAAMVLFTSGSEGHPKGVVHSHKSLLANVEQIRTVA
S27A5_HUMAN     PGVXXXSHPVPAD----LRAGITWRSP---------ALFIYTSGTTGLPKPAILTHERVLQMSKMLS-LS
ACSA_BARBK      SKIIHWVNGRDFWYHEEMPHATPDCPPEHMNAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYV
ACBG1_RAT       P--KKMAN--VYTMEELIELG--QEVPEEALIDTQQCVLVYTSGTTGNPKGVMLSQDNITYGSQAGDIQP
S27A5_MOUSE     PGVEALGAS--------LDAAPSDPVPASLRATKSPAIFIFTSGTTGLPKPAILSHERVIQ-VSNVLSFC
ACSA_SHESW      RTGGKIVEGRDVWWHSLLETASEHCQPEEMGAE-DPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_SHEPC      RTGGKIVEGRDVWWHSLLETASEHCQPEEMGAE-DPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_HELPY      KEIDYV-RGRDFVYNEMVNYQSDKCEP--EMMDSDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWV
ACSA_HELPH      KEIDYV-RGRDFVYNEMVNYQSDKCEP--EMMDSDPLFLLYTSGSTGKPKGVQHSNAGYLLWAQMTMEWV
ACSA_HELPG      KEIDYV-RGRDFVYNEMVNYQSDKCEP--EMMDSDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWV
ACSA_ALCBS      ---------------------------------------LYTSGSTGKPKGVVHTTAGYLLNTALTHKYV
ACSA_RALSO      --------------------------------------ILYTSGSTGKPKGVQHSTGGYLLWALLTMQWF
ACSA_DROME      ----------------------------------------------------------------------
ACBG1_MOUSE     P--KKMAN--VYTMEELIELG--QEVPEEALIDTQQCVLVYTSGTTGNPKGVMLSQDNITYGSQAGDIQP
ACSA_HELP2      REIDYV-RGRDFVYNEMVNYQSDKCEP--EMMDSDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWV
ACSA_STRCO      LVVRRTGQDVAWDWHETVDGQSAEHTP--EAFDAEHPLILYTSGTTGKPKGILHTSGGYLTQTAYTAVFD
LCF4_YEAST      ----------------------------------DPACIMYTSGSTGTPKGVVLTHYNIVAGIGGVGHNV
ACSF4_DANRE     -----------------------------------LAYILHTSGTTGLPKIVKVPHRCIVPNIIHLRSVF
ACSA_PSYA2      NVIHRTGNSVPMSWYHSLVDGESQYCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYALSTFRXX
ACSA_MYCTU      CSVEHVLVVRRTGIEMAWSEGRDSASPAHEPFDSEHPLLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTI
ACSA_MYCBO      CSVEHVLVVRRTGIEMAWSEGRDSASPAHEPFDSEHPLLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTI
ACSA_CHLTE      EEIXXXXXXXXXXXX-LMGLAVDECEPA--QVDSEHPLLLYTSGSTGKPKGILHTTAGYMVHAASSFKYV
ACSA2_PSEAE     QGDIPWVEGRDIWYHEALHAASAD-CPAEAMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYV
ACS2L_MOUSE     DTKVPMGS-LDIPLEQEMAKEAPVCTP-ESMSSEDMLFMLYTSGSTGTPKGLVHTQAGLLYAAMTHKLVF
ACBG1_MACFA     PN--KMAN--VYTMEEFMELGNEVPEEALDAIPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAG
ACSA2_RHIME     GGKVGWA-PGRDLWYHQETAAAEPHCPPEKMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYV
ACBG1_HUMAN     PN--KMAN--VYTMEEFMELGNEVPEEALDAIPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAG
S27A5_RAT       PGVEALGAA--------LDAAPSDPVPAKLRANKSPAIFIYTSGTTGLPKPAILSHERVIQ-MSNVLSFC
S27A3_MOUSE     TNVAGISNLLSEAADQV-----DEPVPGYLSAPQDTCLYIFTSGTTGLPKAARISHLK-VLQCQGFYHLC
LCFH_HAEIN      STIQLQQDPLSCTWESFIKTGSNQQDELTQRLNSDLFTIIYTSGTTGEPKGVMLDYANLAHQLETHDLSL
ACSA_RHILW      ----------------------------------------------------------------------
ACSA_RALME      --------------------------------------VLYTSGSTGKPKGVQHSTGGYLLWALMTMRWF
ACSA2_PSEPK     RTGGDVAWTEGRDWYHEATKDAGDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGLLQATMTFKVVF
VRAA_STAEQ      ERIHQLVKSYDIQWDNHLTLNHDDSIYNDEVIPRNVIHIGFTSGTTGLPKAFYRNEHSWIVSFKENEKLL
MENE_ECOLI      -----------------------------------LCSMTLTSGSTGLPKAAVHTYQAHLASAQGVLSLI
ACBG2_CHICK     ELKEK--RPNQYSWREFLDLGEDIPDSQLREIPNQCCTLIYTSGTTGQPKGVMLSHDNLIAAGRSLMLLE
FCSA_DICDI      ATLDKFKDNENVKLYLLSDFEKLEQNPAQHEVPSDLCTLLYTSGSTGNPKGVMLTHTNMVAGANSPAGVI
FAD21_MYCTU     ------------------SLDLTGNSPSFRVKDLPSAAYLYTSGSTRAPAGVMISHRNLQANFQ---QLM
FAD21_MYCBO     ------------------SLDLTGNSPSFRVKDLPSAAYLYTSGSTRAPAGVMISHRNLQANFQ---QLM
ACSA_RHISN      GGKVPWAPGRDVWYHQEIATVEPHCPPEKMRAE-DPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYV
ACSA_RALEJ      --------------------------------------VLYTSGSTGKPKGVQHSTGGYLLWALMTMQWF
ACSA_PRB01      GEIN-WDDKKDVWYEDLVKDVSNKCAP--EPMDSDPLFILYTSGSTGKPKGVLHTTAGYLLGAHISFKYL
ACS2_CANGA      ----------------------------------------------------------------------
S27A4_PONAB     GSWEPNAVPT--STEHLDPL--LKDAPKHLPICTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGF
ACSA_PSYCK      NVIHRTGNSVPMSWYHSLVDGESQHCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYALSTFRVF
ACSA_RALEH      RTGGKVAWTEGRDWMEDVSAGQPDTCEAEPVSAEHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMKWF
S27A4_MOUSE     GSWEPSTVPVSTEHLDPLLEDAPKHLPSHPKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGF
PRPE_ECOLI      ---RGLAKMARVSGRDVDFASLRHQHIGARLESNETSCILYTSGTTGKPKGV---QRDVGGYAVALATSM
ACSA_SACD2      ---KRTGADVAWNTERDIWLHEAQQSVDTESMDSDPLFILYTSGSTGKPKGVL-----------------
ACSA_RALPJ      --------------------------------------ILYTSGSTGKPKGVQHSTGGYLLWALLTMQWF
S27A4_MACFA     GSWEPNAVPT--STEHLDPL--LEDAPKHLKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGF
ACSL1_HUMAN     SELVERGQRCGVSMKAMEDLGXXXXXXXXXXXXEDLAVICFTSGTTGNPKGAMVTHRNIVSDCSAFVKAT
ACSA_AGRRK      VTVEKVLAPGRDLWYHEETAKVKADCPPVKMKAEDPLFILYTSGSTGKPKGVL-----------------
S27A3_HUMAN     WAAGPGTHPAGIS-DLLAEVSAEVDGPVPGYLSSDTCLYIFTSGTTGLPKAARISHLKILQ-CQGFYQLC
ACSL3_RAT       PTWSEFPKGVIVTMAAVQALGVVDKKAHSKPLPSDIAVIMYTSGSTGIPKGVMISHSNIIASITGMARRI
ACSA_RHIEC      ----------------------------------------------------------------------
ACSA_RHIE6      ----------------------------------------------------------------------
ACSA_AGRVS      ----------------------------------------------------------------------
FAD11_MYCTU     ----------------------------------DIVTLIYTSGTTGNPKGVEMTHANLLFEGYAIDEVL
ACSL5_HUMAN     PFDDDLKQRGEKSGIEILSLYDAENGKEHFRSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCV
ACSA_XANCP      NTVETVLQAPRDRWFHDVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVL-----------------
ACSA_XANC8      NTVETVLQAPRDRWFHDVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVL-----------------
ACSA_CUPTR      --------------------------------------VLYTSGSTGKPKGVQHSTGGYLLWALMTMKWF
ACSA_BRUSU      ----------------------------------------------------------------------
ACSA_BRUSI      ----------------------------------------------------------------------
ACSA_BRUO2      ----------------------------------------------------------------------
ACSA_BRUME      ----------------------------------------------------------------------
ACSA_BRUMB      ----------------------------------------------------------------------
ACSA_BRUC2      ----------------------------------------------------------------------
ACSA_BRUAB      ----------------------------------------------------------------------
ACSA_BRUA2      ----------------------------------------------------------------------
ACSA_BRUA1      ----------------------------------------------------------------------
ACBG2_MOUSE     PLMESMAN--LYSWNDFMELGNDIPNIQLDRVANQCAVILYTSGTTGTPKGVLLSHDNITWTAGAMSQEM
BGM_DROME       SPYLK-KEDGYYRWSEIESMNVSDVEDQYMRLENECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAM
ACSL3_MOUSE     PTWSEFPKGVIVAAVQALGVKANVEKKAHSKLPSDIAVIMYTSGSTGIPKGVMISHSNIIASITGMARRI
ACSA_SINMW      VTVGKVLAPERDLWYHQETAAVEPHCPPERMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYV
VRAA_STAES      -------------------------------IPRNVIHIGFTSGTTGLPKAFYRNEHSWIVSFKENEKLL
S27A4_HUMAN     ---------------------------------TDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGF
ACBG2_XENLA     ELKEK--RPNLYTWKEFMQLGKDIPDSQLDQIISSQCTLIYTSGTTGQPKGVMLSHDNITAAGKTVRLRE
S27A2_MOUSE     NTLDKVAEPTPESWRSEVTFTTP-------------AVYIYTSGTTGLPKAATINHHRLWYGT-GLAMSS
FAD28_MYCBO     ------------------------------------AYLQYTSGSTRTPAGVVMSHQNVVNFEQLMSGYF
FAD26_MYCTU     -----------------------RQMPAFSRQHTGAAYLQYTSGSTRTPAGVIVSHTNVIANVQSMYGYF
ACSA_STRAW      QEVA-WTEGRDVWWHEITAKQSAEHTP--EAFDAEHPLILYTSGTTGKPKGILHTSGGYLTQTSYTAVFD
ACSA_AGRRH      GSPLSWA-PGRDLWHHEEAATVSADCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHEYV
S27A1_RAT       ------------------------QAPGKGM--DDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSY
PRPE_SALTY      ---RGLAK-MAWVDGRDLDFATLRQQPVAWLESNETSCILYTSGTTGKPKGV---QRDVGGYAVALATSM
MBTM_MYCSS      ---------------------------GHARRDSEFAVLQGTAGSTGIPRTAQLSPEAVLANLRGLVACI
ACSA_PSEU5      RCVQKIIVVRRIRWHRDVSYDDLMRVAGEVCAPKEMGAILYTSGSTGKPKGVL-----------------
ACSB_DICDI      --------------------------------------ILYTSGTTGMPKGVVRDTGGYVALNYSIRNCY
ACSA_SHEB9      GGIVDWVEDRDVWWHSLMETASEYCQPEEMDAEAPLF-LLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_SHEB8      RTGGKVVEGRDVWWHSLMETASEYCQPEEMDAEAPLF-LLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
ACSA_SHEB5      RTGGKVVEGRDVWWHSLMETASEYCQPEEMDAEAPLF-LLYTSGSTGNPKGVLHTTGGYMVYASMTHEYV
S27A1_MOUSE     ------------------------QAPGKGM--DDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSY
LCF1_YEAST      ------------SFDDILKLGSCNEIDVHPPGKDDLCCIMYTSGSTGEPKGVVLKHSNVVAGSLNVLKFV
Y3568_PSEAE     QAPARLHPGRDLDWQDCLA--AAEPADPLPVASGDPLYIMYTSGTTGKPKGIV-----------------
ACSL6_MOUSE     DALRERGKKCGVDIKSMQAIEDCGRENHHAPVPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGFLKVT
ACSA_OCHA4      ----------------------------------------------------------------------
ACSL6_HUMAN     EALKERGQKCGVSMQAVEDCGQNHQAPVPPQPD-DLSIVCFTSGTTGNPKGAMLTHGNVVADFSGFLKVT
VRAA_STAHJ      -TIDKLIEHFHIEYKRTTSFGTYEKYISEQLKVDDLLHIGFTSGTTGLPKAY---YRN---EPSWIASYV
S27A2_RAT       NTLDKVADPIPESWRSEVTFTTP-------------AVYIYTSGTTGLPKAATINHHRLWYGT-SLALRS
ACSL1_MOUSE     SDLVERGKKCGISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSGFIKAT
S27A1_HUMAN     ----------------------------------DRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAY
S27A1_BOVIN     ----------------------------------DRLFYIYTSGTTGLPKAAIIVHSRYYRIAAFGHYSY
FAD25_MYCTU     QNAPAVIEVDRLDLDARPSSGSRSAAHGH----PDILYLQYTSGSTRTPAGVMVSNKNLFANFEQIMTSY
ACS2L_HUMAN     NKVHM--GDLDVPLEQEMAKEDPVCAPESMGSE-DMLFMLYTSGSTGMPKGIV-----------------
LCF3_YEAST      ------------SFEEVVKIGKKSKDEVHPPEPKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNV
ACSL5_RAT       DDLMKRGEKCGIEMLSLHNLGKENFKKPMPPNPEDLSVICFTSGTTGDPKGAMLTHQNIVSNMAAFLKFL
ACSL5_MOUSE     DDLMKRGEKCGVEMLSLHDAENIGKENFKKPVPEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFL
ACSL1_RAT       NDLVERGQKCGIGLKALEDLGRVNRTKPKPPEPEDLAIICFTSGTTGNPKGAMVTHQNIMNDCSGFIKAT
ACSL1_CAVPO     ELVEKKCGVEVISLKAMEGLGRANRRKPKPPEPDDLAVICFTSGTTGNPKGAMITHKNVVSDCSAFVKAT
AACS_CHICK      ETIDISKIPNSVFLEDFLATGKGDQAPQEQLPFSHPLFIMYSSGTTGAPKCMVHS-----AGGTLIQHLK
ACS1_YEAST      NPSVAFHAPRDLDWEXXXXXXXXPCTP----VDSDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRY-
ACBG2_RAT       PLMENSTN--LYSWQDFMELGNAIPNIQLDRVANQCAVIIYTSGTTGSPKGVMLSHDNITWTAGAMAREI
S27A6_HUMAN     QGV--------ISLKEKLSTSPDEPVPRSHHVVSLLKSTIFTSGTTGLPKAAVISQLQVLRGS-AVLWAF
BGML_DROME      ---------------------------------NECAMLIFTSGTVGMPKAVMLSHDNLVFDTKSAAAHM
MENE_HAEIN      ------------------------------------ATMTLTSGSTGLPKAVVHNVQAHLDNAKGVCNLM
ACSA_MOUSE      QSVKRPCPDVQICWNEGVDLWLMQQAGDECEPEEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYV
ACSL6_RAT       DALRERGKKCGVDIKSMQAIEDSGQE-NHRRPD-DLSIVCFTSGTTGNPKGAMLTHGNVVA---------
AAS_PHOLL       ----------------------------------DDALVLFTSGSDAVSKGVVHSHASLLANVEQIKTIT
ACSS3_HUMAN     MEAVPLAPGRDLDWDE--EMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVI-----------------
ACSS3_PONAB     MEAVPLAPGRDLDWDE--EMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVI-----------------
ACBG2_HUMAN     ------------SWDDFMELGTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNIIAGAVT-KDFK
ACSS3_MOUSE     MEKVPLMSGRDLDWEE--EMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVV-----------------
ACSA_CAMJJ      EPIEYIKGRDYV-YNELVKNESYKCEP--EIMDSDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWV
ACSA_CAMJE      EPIEYIKGRDYV-YNELVKNESYKCEP--EIMDSDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWV
ACSA_CAMJ8      EPIEYIKGRDYV-YNELVKNESYKCEP--EIMDSDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWV
FAT1_COCHE      --------------------------------------LIYTSGTTGLPKGVFISTGRELRTDWSISKYL
LCF2_YEAST      HDELRMLNESLLSLEQVEQVGCFNKIPAIPPTPDSLYTISFTSGTTGLPKGVEMSHRNIASG--------
FCSB_DICDI      -----------------------------------LSTIMYTSGTTGPPKGVMITHKNLTSVVCAVSDFI
ACSA_HUMAN      QSIKRSCPDVQISWNQGIDLWWHEQEAGDECEPEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYV
AACS_RAT        EKIDISKIPNSMFLDDFLASGTGAQAPQEQLPFSHPLFIMFSSGTTGAPKCMVHSGGTLIQHLKEHVLHG
S27A2_HUMAN     YYVSRTSNTDGISFLDKVDEVSTEPIPESWRSESTPALYIYTSGTTGLPKAAMITHQRIWYGT-GLTFVS
AACS_MOUSE      EKIDISKIPNSVFLDDFLASGTGAQAPQEQLPFSHPLFIMFSSGTTGAPKCMVHS-----AGGTLIQHLK
FAD21_MYCLE     ----------------------------------------------------------------------
PCL_RHOS4       ----------------------------------------------------------------------
ORA_PLAFN       -----------------------------------IASIVYTSGTSGKPKGVMLSNRNLYNG--------
ACSS3_BOVIN     TDMVPLAPGYYLDWDEELS--KAQSHDCVPVLSEHPLYILYTSGTTGLPKGVV-----------------
MBTM_MYCPA      ----------------------------------------------------------------------
FAT1_YEAST      --------------------------------DFKPSMLIYTSGTTGLPKSAIMSWRKSSVGCQVFGHVL
ACSA_NOSLI      GNVAM--QEGRDHWWADACDNQPKTSTPEPMGAEDPLFILYTSGSTGKPKGVL-----------------


                         .         .         .         +         .         .         .:280
query           ENNSNDRLLAVLPLSFDAGFSQLTTAFSVGASVVLMEYLLPKDVIKSITRHGITGITAVPPLWVQLASLA
LCFB_BACSU      GMDERDNVVCALPMFHVFCLTVCMNALMSGATVLIEPQFSPASVFKLVKQQQATIFAGVPTMYNYLFQHE
GRSB_ANEMI      QVREDDRIIQTGAIGFDALTFEVFGSLLHGAEL----YPVTKDVLKFLQANQITIMWLTSPLFNQLSQ--
SRFAB_BACSU     GLTENDKTVLLSSYAFDLGYTSMFPVLLGGGELHIVQYTAPDEIAHYIKEHGITYIKLTPSLFHTIVNTA
LGRD_BREPA      GLDESSRVLQFTSFSFDVSVSEIWQALLSGGTLVIRESLLPPDLVRTLRERRISKVSMASSLLASLPVAE
LGRC_BREPA      QIDATSRVLQFISFSFDVSVSEIVMSLLAGATLVIRESLLPPELIRVLQEQRITTFAMVSSVXXXXXXXX
GRSB_BREBE      QVREDDRIIQTGAIGFDALTFEVFGSLLHGAEL----YPVTKDVLKFLQANQITIMWLTSPLFNQLSQ--
BACC_BACLI      GYSTADATLQVPSFSFDSSVEDIFTTLISGAKLVLIRDLRPREIIGVLRTHKATNLLAVPSFYLNLLDTI
LGRA_BREPA      QD---DAFLLKTTYIFDISVAEIFGWVPGRGKLVILEPEAPKAIWQAVVGAGITHINFVPSMLIPFVEYL
LCFA_SALTY      LHPGKELVVTALPLYHIFALTMNCLLFELGGQNLLITN--PRDIVKELAKYPFTAMTGVNTLFNALLNNK
LCFA_SALTI      LHPGKELVVTALPLYHIFALTMNCLLFELGGQNLLITN--PRDIVKELAKYPFTAMTGVNTLFNALLNNK
LCFA_ECO57      LHPGKELVVTALPLYHIFALTINCLLFELGGQNLLITN--PRDIVKELAKYPFTAITGVNTLFNALLNNK
DHBF_BACSU      SLGEEDRLLAVTTVAFDISALELYLPLISGAQIVIAKIREPQALAQMIENFDINIMQATPTLWHALVTS-
LCFA_ECOLI      LHPGKELVVTALPLYHIFALTINCLLFELGGQNLLITN--PRDIVKELAKYPFTAITGVNTLFNALLNNK
LCFA_ECOL6      LHPGKELVVTALPLYHIFALTINCLLFELGGQNLLITN--PRDIVKELAKYPFTAITGVNTLFNALLNNK
LCFA_BACSU      YDEGAEKVLGIVPFFHVYGLTAVMNSIKLGFEMILLPKFDPLETLKIIDKHKPTLFPGAPTIYI---GLL
LCFA_YERPE      LQPGRDLVVTALPLYHIFALTVNCLLFELGGRSLLITN--PRDIVKELSRYPFTAITGVNTLFALLNNEE
TYCC_BREPA      QVRESDRMIQTGAIGFDAMTFEIFGALLHGASL----YLVSKDVLLDAEKLGITTMWLTSPLFNQLSQ--
TYCB_BREPA      GVTPQDRAGHFASISFDASVWDMFGPLLSGATL----YVLSRDVINDFQRNAITFLTLPPTYAIYLE---
MYCC_BACSU      PLDERDAILQKTAITFDVSVWELFWWSIVGSKVVLLPEKNPELILDTIEQKGVSTLHFVPALHAFLESME
PPSD_BACSU      AFNETDTILQLFSFSFDGFITSMFTPLLSGAKAVLLHEEEAKDILHQLSRQRITHMIIVPVLYRALLDVV
BACA_BACLI      EVGQNDNSSIYASISFDAFVWELFPYITAGATVHVLNQETRLDVEKYFHDHHITISFLPTPVCEQFTAL-
LGRB_BREPA      EN---DAYLLKTTYTFDVSVAEIFGWILGSGRLVILDPGAEKEIWETMVNHGVTHVNFVPSMLIPFVDYV
SRFAA_BACSU     SITEQDTILGLSNYVFDAFMFDMFGSLLNGAKLVL----IPKETVRVIERENISILMITTALFHLLVDLN
GRSA_BREBE      ENSLNDRIGQFASISFDASVWEMFMALLTGASL----YIILKDTINDINQKEITVITLPPTYVVHL----
GRSA_ANEMI      ENSLNDRIGQFASISFDASVWEMFMALLTGASL----YIILKDTINDINQKEITVITLPPTYVVHL----
DLTA_BACCN      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLKQSNIQVWTSTPSFEMCLMETS
PPSC_BACSU      RLSEDDIVMVKTSFSFDASVWQLFWWALSGASAYLLPPGWEKDIVQAIHQENVTTAHFIPAMLNSFLDQA
MYCA_BACSU      VNDEKTNFPLYSSISFDLTVTSIFTPLVTGNTIIVFDGEDKSAVLSTIMQDPRIDIIKLTPAHLHVLKEM
ACSF2_MOUSE     KMPTKTRLVLPSPLYHCLG--------SVGGTMVSMMHLLSKKALEAISREKGTLLYGTPTMFVDILN--
4CLL4_ORYSJ     RLEGSDKFLCTVPMFHVYGLVAFATGLGCGATVVVLKYELP-EMLRSINAYGVTYLPLVPPILV--AMVA
PPSA_BACSU      PLSEDDIVMVKTSFSFDASVWQLFWWSLSGASAYLLPPGWEKDIVQAIHQENVTTAHFIPAMLNSFLDQA
4CLL6_ARATH     YPGSSNVYLAALPLCHIYGLSLFVMGLSLGSTIVVMKRFDASDVVNVIERFKITHFPVVPPMLMALTKKA
ACSF2_RAT       KMPAKTRMVLPCPLYHCLGSVGGTMVSVVHGATLLLSSFNGKKALEAISREKGTLLYGTPTMFVDILN--
ACSF2_HUMAN     KEKTPEQLRMILPLGSVAGTMM---CLMYGATLILASPIFNKKALEAISRERGTFLYGTPTMFVDI--LN
TYCA_BREPA      QNSEQDRIGLFASMSFDASVWEMFMALLSGASL----YILSKQTIHDFAEHYLSENEXXXXXXXXXXXXX
LCFA_HAEIN      IGDHSRTRSAILALPLYHVFALTVNCLELGVTAILITN--PRDIVKELKKYRFEAITGVNTLFNALLNNE
MBTB_MYCSS      GIGPSDRSLALSTLEGDLSVLDVFGMLRAGGSLVVVDEAQRRDPARLIAEHSVTVLHWMPG-WLEM--LL
ANGR_VIBAN      QIGKNDRVLALSALHFDLSVYDIFGLLSAGGTIVLVSELERRDPIQAIEEHNVTMWNSVPALFDMLLTYA
4CL1_TOBAC      DGHSEDVLMCVLPLFHIYSLSILLCGLRVGAAILIMQKFDIAPFLELIQKYKVSIGPFVPPIVLAIASPI
4CL2_SOLTU      DGHSDDVLMCVLPLFHIYSLSVLLCALRVGAAILIMQKFDIAQFLELIPKHKVTIGPFVPPIVLAIASPL
FADK_ECOLI      NLTWQDVFMMPAPLGHATGFLHVTAPFLIGARSVLLDIFTPDACLALLEQQRCTCMLGATPFVYDLLNLE
DLTA_BACHK      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACCZ      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACC3      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACC0      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACAH      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
ACVS2_PENCH     AGQHHEAILLFSACVFEPFVRQTLMALVNGHLLAVINDVEKYDLLPFIRRHSITYLNGT-------ASVL
ACVS1_PENCH     AGQHHEAILLFSACVFEPFVRQTLMALVNGHLLAVINDVEKYDLLPFIRRHSITYLNGT-------ASVL
PPSB_BACSU      SMTEQDISLHLFSYVFDGCVTSLFTPLLSGACVLLTTDDEAKDVLRKIARYKVSHMIIVPSLYRVLLEV-
DLTA_BACAN      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACAC      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACAA      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
ACVS_CEPAC      VAGEDDEVILVFSAYFEPFVRQMLMALTTGNSLAIIDKFDPDTLIPFIQKHKVTYIHATSSVLQEYDFGS
4CL1_SOLTU      DGHSDDVLMCVLPLFHIYSLSVLLCALRVGAAILIMQKFDIAQFLELIPKHKVTIGPFVPPIVLAIASPL
4CLL7_ARATH     MGEYHGVFLCFLPMFHVFGLAVITSQLQRGNALVSMARFELELVLKNIEKFRVTHLWVVPPVFLALSKQS
CAIC_SALAR      ALREDDVYLTVMPFHIDCQCTAAMAAFSVGATFVLIEKYSARAFWGQVRKYCATVTECIP---MMIRTLM
DLTA_BACC2      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACCR      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACC4      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
ACSF2_MACFA     KEKTPEQLRMILPSPLSVGGTMMCLMY--GATLILASPVFGKKALEAISRERGSFLYGTPTMFVDILNQP
ACVS_EMENI      TGDHHEAILLFSAYVFEPFVRQMLMALVNGHLLAMVDDAEKYDLIPFIREHKITYLNGTASVLQEYDFSS
DLTA_BACCQ      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
DLTA_BACC1      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
PKSJ_BACSU      GLTAEDKMLAVTTYCFDIAALELFLPLIKGAHCYICQTEHTKDVEKDIRAIKPTVMQATPATWKMLFYSG
PPSE_BACSU      SASGDDRFIMTGSISFDAVTFEMFGALLNGASLHIIDMLTPDRFGAYLLENDITVLFLTTALFNQLAQV-
4CLL9_ARATH     QDPVNDRVLFSLPLFHVFGFMMMIRAISLGETLVLLGRFELEAMFKAVEKYKVTGMPVSPPLIVALVSEL
BACB_BACLI      PLSEHDTVLQVVSFSFDAFSEEVYPILACSGRLVIVSDLNIDELVKTIGKYRVTLVSCSPLLLNEIQHLT
DLTA_BACC7      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
CAIC_PROSL      LREDDIYLTVMPAFHIDCQCTASLPAYSVGATIVLLEKYSARASWKQILKYQATVTECIPMMMTSMAQPV
DLTA_BACLD      PVESGQVFLNQAPFSFDLSVMDLYPCLQSGGTLVTKDMIRPKLLFEALKQSNVNVWTSTPSFQMCLMDXX
ACSF2_PONAB     KEKTPEQLRMILPSPLSVGGTMMCLMY--GATLILASPVFGKKALEAISRERGSFLYGTPTMFVDI--LN
4CL2_ARATH      DGNRDDVILCVLPMHIYALNSIMLCSLRVGATILIMPKFEITLLLEQIQRCKVTVAMVVPPI---VLAIA
MYCB_BACSU      KHSAEDRVLVLYPYVFDAFILNFFGPLISGAAL----YLLPNEAIQNVLKERITHFSTSPRL-LQAMTEQ
DLTA_BACWK      NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDIARPKDLFASLEQSDIQVWTSTPSFEMCLMEAS
MENE_BACSU      GITEQDRWLIALPLFHISGLSALFKSVIYGMTVVLHQRFSVSDVLHSINRHEVTMISAVQTMLASL--LE
DLTA_BACA2      PVGEGKTFLNQAPFSFDLSVMDIFPSLQTGGTVTKDKINKPKVLFEELEKSKLNVWTSTPS-FVQMCLMG
SRFAC_BACSU     AFSDQDTFLSVSNXXXXXXXXXXXXSMLNAARLIIADLLDTERLTDLILQENVNVMFATTALFNLLTDAG
LUCI_PHOPE      FGNAINPTTAILTIPFHHGFGMTTTLFTCGFRVALMHTFEEKLFLQSLQDYKVESTLLVPTL------MA
CAIC_SALSV      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
CAIC_PROMH      ALREDDIYLTVMPFHIDCQCTASLPAFSVGATFVLLEKYSARAFWKQILKYQATVTECIPMMMRTLAQPV
MENE_GEOKA      GLHERDCWLAAVPLFHISGLSIAMRSVIYGMPMRLQTSFDPKEANEWIMRGDVTIMSVVAAMLQRMVAEL
CAIC_SALTI      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
CAIC_SALPB      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
CAIC_SALDC      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
CAIC_SALNS      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
CAIC_SALCH      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRRYQAT-VTECIPMMIRMVQPA
CAIC_SALA4      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
ACSF2_BOVIN     KTPEESRVVLPSPLYHCLGVGGTMVSLMHGVTLILCSPVFEKKTLEAISRERGCFLYGTPTMFVDVLNQP
4CL1_PETCR      DGHSEDVMICILPLFHIYSLNALCCGLRAGVTILIMQKFDIVPFLELIQKYKVTIGPFVPPIVLAIASPV
DLTA_LACPL      PDQPNS--LSQPPYSFDLSVMDVYPTLALGGTL----YALPKAVTDDFKQLFAALPTLPINVWVSTPSFM
CAIC_SALPK      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWGQVRKYQAT-VTECIPMMIRMVQPA
CAIC_SALPC      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRRYQAT-VTECIPMMIRMVQPA
CAIC_SALPA      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWGQVRKYQAT-VTECIPMMIRMVQPA
4CLL5_ARATH     SDDGEQRFICTVPMFHIYGLAAFATGLAYGSTIIVLSKFEMHEMMSAIGKYQATSLPLVPPILVAMVNGA
4CL2_PETCR      DGHSEDVMICILPLFHIYSLNALCCGLRAGVTILIMQKFDIVPFLELIQKYKVTIGPFVPPIVLAIASPV
DLTA_LACCB      GLKEGVVAMSQPPYSFDLSVMDLYPTLVLGGTL--------KALPKEVTDNFKTLFATLPKLWVSTPSFA
DLTA_LACC3      GLKEGVVAMSQPPYSFDLSVMDLYPTLVLGGTL--------KALPKEVTDNFKTLFATLPKLWVSTPSFA
CAIC_CITK8      ALREDDVYLTVMPFHIDCQCTAAMAAFSAGSTFVLIEKYSARAFWGQVRKYRATVTECIPTLMVQPAS--
MENE_BACLD      GLQEHDRWLIALPLFHISGLSALFKSVIYGMTVVLHQRFDAEEVLRSIKDQQVTIASVVQTMLSRLA--A
HTS1_COCCA      GMTSPPRSLQFASYSFDASIGDIFTTLAVGGCLCIPEDRNPAGITTFINRYGVTWAGITPSLALHL----
DLTA_LISMC      SLSQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLDKTITKDLYREIPAQNL-------DVWVSTPSFA
CAIC_SALTY      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
CAIC_SALHS      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
DLTA_LISIN      SLRQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLDKTITKDLYREIPAQNF-------DVWVSTPSFA
DLTA_LISW6      SLQQGLRFLNQAPFSFDLSVMDLYPCLLSGGTLVPMDKTITKDLYHEIPAQSF-------DVWVSTPSFA
CAIC_SALEP      ALRDDDVYMTVMPFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQAT-VTECIPMMIRMVQPA
DLTA_LISMH      SLRQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLDKTITKDLYREIPAQNF-------DVWVSTPSFA
DLTA_LISMF      SLSQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLDKTITKDLYREIPAQNL-------DVWVSTPSFA
DLTA_LACRH      GLEEGVVAMSQPPYSFDLSVMDLYPTLVLGGTLKALPKEVTKELFATLPKLGLNEWVSTPS-FVEIALLD
FAT2_YEAST      KLTPLDRSYVVMPLFHVHGIGVLLSTFRTQGSVVVPDGFHPKLFWDQFVKYNCNWFSCVPTISMIMLNMP
DLTA_LISMO      SLSQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLDKTITKDLYREIPAQNL-------DVWVSTPSFA
BCLA_THAAR      GIREGDVVFSAAKLFFAYGLGNLIFPLAVGATAVLMERPTPAAVFERLRRHQPDIFYGVPTLYASLANPD
PKSN_BACSU      PVTAEDAYLLKTNYVFDVSISELFGWFIGDGRLVILPEKSPQLCMDYIETYKVTHINFVPAMFLEMAKDN
DLTA_BACSU      PVSGGKIFLNQAPFSFDLSVMDLYPCLQSGGTVTKDAVNKPKVLFEELKKSGLNVWTSTPS-FVQMC-LM
CAIC_ECO27      ALRDDDVYLTVMPFHIDCQCTAAMAAFSTGATFVLVEKYSARAFWGQVQKYRATITECIPTLMVQPLSAN
4CL_VANPL       DGHSDDVLLCVLPLFHIYSLSVLLCGLRAGSGILIMQKFEIVPFLELIQKYKVTIGPFVPPIVLAIASTV
MENE_BACP2      GLREDDRWLIALPLFHISGLSALFKSVIYGMTVVLHQKFDVDEVIGSIEQHRVTMISVVQTMLSRLLSRL
MENE_LISMO      GLTEKDSWLCAVPIFHISGLSIMMRSVIYGIPVYLEEHFDEEKITQLLESGKVSTISVVTSMLERLLKIH
MENE_LISIN      GLTEKDSWLCAVPIFHISGLSIMMRSVIYGIPVYLEEHFDEEKITQLLESGKISTISVVTSMLERLLKIS
DLTA_STRPZ      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
DLTA_STRPM      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
DLTA_STRPG      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
DLTA_STRPF      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
DLTA_STRPD      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
DLTA_STRP8      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
CAIC_ECOLU      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
4CLL3_ORYSJ     ARGARENVMAALPMSHVYGLSLFAVGLSIGATVVVMRRFDAGDAVAAIGRYKVTHMPLVPPIXXXXXXXX
DLTA_STRPC      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
DLTA_STRP6      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
DLTA_STRP3      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
DLTA_STRP1      DVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKELVADF-KQLFTTIAQLPVIWTSTPSFA
MENE_BACA2      GVTERDRWLIALPLFHISGLSALFKSVIYGMPVVLHQKFSVTDVLDSISSHQVTIISAVQTMLSGL--LA
CAIC_SHISS      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTL--MA
CAIC_ECO5E      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
CAIC_ECO57      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
CAIC_ECO45      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
ACVS_NOCLA      RRPGTERVALFASYVFEPHLRQTLIALINEQTLVIVDVRLDPDLFPEIERHGVTYLNATGSV-LQHFDL-
MENE_GEOSW      GLNENDCWLAAVPFFHISGLSIMMRSVIYGMSMYVMRAFDAKKANELIIGGKVTIMSVVSAMLQKMIADL
CAIC_ECOSM      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
CAIC_ECOSE      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
CAIC_ECO55      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
4CL2_TOBAC      DGHSEDVMLCVLPLFHIYSLSVLLCGLRVGAAILIMQKFDIVSFLELIQRYKVTIGPFVPPIVLAIAKSP
MENE_LISMF      GLTEKDSWLCAVPIFHISGLSIMMRSVIYGIPVYLEEHFDEEKITQLLESGKISTISVVTSMLERLLKIS
CAIC_ECOUT      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
CAIC_ECOK1      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
CAIC_ECO8A      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
MENE_BACC7      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
CAIC_ECOHS      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
ACSM5_RAT       ---SGRRLMALTESDIDTGWVKLFSAWANGACVFVHE--LPQTILNTLCRFPITTICCVPTLFRLLVQED
CAIC_ECO7I      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIR-TLMV
4CLL6_ORYSJ     ETVAREAALFPLPLFHVMGFGLLTRTISSGETAVVMXXXXXXXXXXXXXXXXVTKLSAAPPVVVALTK-S
ACSM1_BOVIN     QLKMSDVFWCLSDTGWIAALGSLLEPWTAGSTVFALPQFDPKVIIETFFKYPITQCLAAPSVYRMILQQN
FAT2_SCHPO      RLDPRDTSYVVMPLFHVHGLGLLSTLASGGCAVVPPKFSA-HSFWKEFIQYGATWYTAVPTIH-QXXXXX
CAIC_ESCF3      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTL--MV
CAIC_ECO81      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-ITECIPMMIRTL-MV
CAIC_ECO24      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRAT-ITECIPMMIRTL-MV
4CL_PINTA       DGHSDDVILCVLPLFHIYSLSVLLCALRAGAATLIMQKFNLTTCLELIQKYKVTVAPIVPPIVLDITSPI
CAIC_SHIDS      ALRDDEVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMIIRTL--MV
CAIC_ECOL6      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPTLMVQPLSAN
CAIC_ECOL5      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPTLMVQPLSAN
4CLL1_ORYSJ     RREGPNVFLCFLPMFHIFGLSVITYALHRGNAIIAMSRFDINSLMEAVQRHRVTHLFCVPPVIIALAKHG
CAIC_SHIFL      ALRDDDVYMTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRAT-ITECIPMMIRTL-MV
4CLL2_ORYSJ     RPARDNVYLAALPMFHVYGLSLFAVGLSLGCTVVVMRRFNVDDAVKAIRKYKVTHLPLVPPIMSALLR-A
CAIC_ECOLC      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTL--MV
4CL3_ARATH      DGDSNDVILCVLPLHIYXXXXXXXXXXXXGATVLLMHKFEIGALLDLIQRHRVTXXXXXXXXXXXXKNPT
MENE_BACC1      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
ACVS_STRCL      RRPGTERVALFASYVFEPHLRQTLIALINGQTLVVVEVRLDPDRFPAIEEHGVTYLNATGSVLQH-----
4CL4_ORYSJ      DGENEDVVLCLLPLFHIYSLSVLLAGLRAGSAIVIMRKFDLGALVDLTRRHGVTVAPFVPPIVVEIAKS-
MENE_BACCR      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
LUCI_LUCCR      YGNQVSPGTAVLTVPFHHGFGMFTTLLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILKSEL
ACSM3_MOUSE     DLIASDVMWNTSDTGWKSAWSSVFSPWTQGACV--FAHYLPRSILQTLSKFPITVFCSAPTAYRMLVQND
4CLL2_ARATH     RFGLEQRTICTIPMCHIFGFGGFATGIALGWTIVVLPKFDMAKLLSAVETHRSSYLSLVPPIVVAMVNGA
ACSF3_HUMAN     AWTKDDVIXXXXXXXXXXXXNALLCPLWVGATCVMMPEFSPQQVFLSSETPRINVFMAVPTIYTKLMEYF
MENE_BACWK      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDANFIHKALQTRGVTIISVVSKMLTDLLERL
DLTA_STRA5      EFSVPERMLAQPPYSFDLSVMYWAPTLAMGGTL----FALPKTVVNDFKKLFAT-INELPQVWTSTPSFA
DLTA_STRA3      EFSVPERMLAQPPYSFDLSVMYWAPTLAMGGTL----FALPKTVVNDFKKLFATINELPVQVWTSTPSFA
DLTA_STRA1      EFSVPERMLAQPPYSFDLSVMYWAPTLAMGGTL----FALPKTVVNDFKKLFAT-INELPQVWTSTPSFA
ACSF2_DANRE     GYNWRKNVRICLPVPLYHCFG------SVGGGVIMALYIFPRANLRAIEKEKCTFVYGTPTMYIDM--LG
CAIC_ECOLI      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-VTECIPMMIR-TLMV
CAIC_ECODH      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-VTECIPMMIR-TLMV
CAIC_ECOBW      ALRDDDVYLTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT-VTECIPMMIR-TLMV
MENE_BACCZ      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
ENTF_ECO57      PLTGEDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLQFFAEYGVTTTHFVPSMLAAFVASL
MENE_BACAH      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
LUCI_PHOPY      FGNQDTAILSVVP--FHHGFGMFTTLLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFASTL
4CLL7_ORYSJ     AKAREVRTLLGAPMFHSMGFLFVLQXXXXXXXXXXXXXXXXXXXIRGLVRWAVMDMTASPPVVLGMTKQR
3HBCL_THAAR     GIKPGDRVFTTSKMFFGWSLGHLMGGLQCGATVIVAPWPDAERVMATAARHRPTILFSTPVMYRNLLREG
MENE_BACHK      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
MENE_BACCQ      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
MENE_BACC0      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
MBTB_MYCPA      EIGPADRCLALSTLEGDISVMDVFVTLRTGGAIVVVDEAQRRDPARLIDTHRVTVLHFMPG-WLEM--LX
DLTA_STRE4      EFAIPERMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKEMVSDFKRLFSTGIWTSTPSFADMAMLN
YDAB_BACSU      ARMKGLRFLACHPIYHTSALICIMLGTFAETTFVFTKDQDPVHMLKVIEEEKIQTVMALPVFYTYLLE-A
DLTA_STRMU      ATPHRPQMLAQPPYSFDLSVMYWAPTLALGGTL----FALPKEITADFKQLFTTGVWTSTPSFVDMAMLS
ACSM1_MOUSE     KLKTSDILWCMSPGWILATVGCLIEPWTSGCTVFILPQFDPKVIVEVLFKYPITQCLAAPGVYRMVLQQK
4CL3_DICDI      ETSTNDSVIGVLPFFHSFGLMHIMLMVKQGYRIVTLPKFEPVRFLELIKKYKVAMSFIVPPIAIMFAKSP
MENE_BACCN      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRVLLVPKYDPDFIHQAIQTKGVTIISVVAKMLTDLLERL
ACSM5_MOUSE     ALTESDIFWNTTDTGWVKAAWTLFSAWSNGACIFVHE--LPKTILNTLCRFPITTLCCVPTLFRLLVQED
MENE_BACAN      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
MENE_BACAC      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
MENE_BACAA      GLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERL
LUCI_LUCLA      YGNQGTAILTVVP--FHHGFGMFTTLLTCGFRIVMLTKFDEETFLKTLQDYKCSSVILVPTLFAILRSEL
HMWP2_YERE8     QVGPHDRVLALSALHFDLSVYDIFGVLRAGGALVMVQRRDPHAWCELIQRHQVTLWNSVPALFDML--LT
ACS2B_HUMAN     GLQASDIMWTISDTGWILNIGSLLESWTLGACTFV--HLLPKFILKTLSSYPIKSMMGAPIVYQDLSSYK
4CL1_DICDI      ETSTNDTVMGILPFFHIYGLMLLMLMVKQGHRVVVLPKFEPVRFLELIQKYKVAISFIVPPVAIMFAKSP
ACSA_PSEA6      DYKPGDIYWCAADVGWVTGHSYIVYGLANGATSVMFEYPDVRRIGQIVDKHKVNILTAPTAIRALMAHGD
4HBCL_RHOPA     GYREDDVVFSAAKLFFAYGLGNMFCPMGIGATSVLYERPTADSVFDTLRLHQPTLLFAVPTLYA--AMLA
DLTA_STAHJ      ESEGSQEWLNQAPFSFDLSVMAIYPCLTSGGTLNLVDKEMPKLLNEMLVNTPINAWVSTPSFMEMCLLLP
ACSM3_RAT       DLIASDVMWNTSDTGWKSAWSSVFSPWTQGACV--FAHYLPRSILQTLSKFPITVFCSAPTAYRMLIQND
LUCI_LUCMI      YGNQGTAILTVVP--FHHGFGMFTTLFACGYRVVMLTKFDEELFLRTLQDYKCTSVILVPTLFAILKSEL
ENTF_ECOLI      PLTGEDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLQFFAEYGVTTTHFVPSMLAAFVASL
ALKK_PSEOL      NLSARDTILPVVPMFHVNAWGTPYSAAMVGAKLVLPGPALDASLSKLIASEGVSIALGVPVVWQLLAAQA
ENTF_SHIFL      PLTGEDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLQFFAEYGVTTTHFVPSMLAAFVASL
4CL2_DICDI      TTNKNDTVMGQLPFFHIYGLTYLILMVKQGHCVVILPKFEFVRFLDLIQKYKVAISFIVPPIAIMFAKSP
ACSA_PASMU      DNKPNDIFWCTADVGWITGHSYVCYGLANGATQVIFEYPDPGRIWRMIQRHKINVFYTSPTLIRSLTRLG
4CLL3_ARATH     DDKWKRDEIFVCTVPMFHSFGLLAFAMASGSTVVILRRFGLDDMMQAVEKYKATILSLAPPVLVAMINGA
DLTA_STAAW      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAAT      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAAS      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAAE      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAAC      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAA8      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAA3      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAAR      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
ACS2A_HUMAN     GLQASDIMWTISDTGWILNICSLMEPWALGACTFV--HLLPKFILKTLSSYPIKSMMGAPIVYRMLLQQD
4CL5_ORYSJ      DGENDDVVLCVLPMFHVYSLSILLCGMRAGAAIVVMKRFDTVKMLQLVERHGVTIAPLVPPIVVEMASDA
4CL1_ARATH      DGHSDDVILCVLPMHIYALNSIMLCGLRVGAAILIMPKFEINLLLELIQRCKVTVAPMVPPIVLAIASSE
MENE_OCEIH      GLHDNDKWLIPLPLFHVSGLSTMLKSVIYGMPIYVLEKFEVEKVHNAIMDRKXXXXXXXXXXXQRLIKRL
DLTA_STAAB      KSGNEQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTSIPI-NIWVSTPSFMEMCLLT
SID2_USTMA      PYGKDKRYLQYSAYNFDLSIMDCFYTWGLGGTICSCPRVLLQDLVEVGNSLQPTHTLLTPAVMAMTERHR
MBTB_MYCTU      ELGAADRWLALATLECDMSVLDIFAALRSGGAIVVVDEAQRRDPARLIDTYEVTALNFMPG-WLDML-LE
MBTB_MYCBO      ELGAADRWLALATLECDMSVLDIFAALRSGGAIVVVDEAQRRDPARLIDTYEVTALNFMPG-WLDML-LE
ACSM5_HUMAN     ALTESDIFWNTTDTGWVKAAWTLFSAWPNGSCIFVHE--LPKVILNTLSKFPITTLCCVPTIFRLLVQED
ACSM2_MOUSE     GLSTSD---IIWTISDTAWIMNILGAFLLGACIFV--HLLPKTVLKVLSSYPINTLVGAPIIYRMLLQQD
4CLL4_ARATH     SDNRDDIFICTVPMFHTYGL--LTFAMALGSTVVILRRFQLHDMMDAVEKHRATXXXXXXXXXXXMADLI
DLTA_STAAU      KSGNKQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAAN      KSGNKQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAAM      KSGNKQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAA9      KSGNKQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAA2      KSGNKQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
DLTA_STAA1      KSGNKQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMPKLLNEMLTATPI-NIWVSTPSFMEMCLLT
SIB1_SCHPO      EWDTNSRFLAFASFHFDVSVLEQYFSWSTGITLVAAQSLILQDLPTAISALKITHVDLTP----SLASIL
MENE_ENTFA      GITAEDCWLCAVPLFHISGLSIVVRQLVLGCSIRLYDKFDEQQVTQDLQEGRGTVISVVATMLQQLLSVY
ACSM3_PONAB     DLTPSD----VMWNTSDTGWSAWSSVFSIQGACVFTHHLPPTSILQTLSKYPITVFCSAPTVYRMLVQND
ACSM2_RAT       GLGPSDTMWTISDTGWILNIGSFLEPWVLGTCIFV--HLLPKTVLKVLSSYPINTLLGAPLIYRMLLQQD
4CLL8_ARATH     EQ-PQQTFICTVPLFHTFGLLNFVLALALGTTVVILPRFDLGEMMAAVEKYRATTLILVPPVLVTMINKA
DLTA_LACLA      MKIENNQILSQALYSFDLSIFSLYPSLTTGGTLILLFERLNKTVINTISTPSFVDICLLDPSFTE-----
ACSF3_MOUSE     AWTKNDVIXXXXXXXXXXXXNKLLCPLWVGATCVMLPEFSAQQVFLSSEAPQITVFMAVPTVYSKLLDYF
ACSM3_HUMAN     DLTPSD----VMWNTSDTGWSAWSSVFSIQGACVFTHHLPPTSILQTLSKYPITVFCSAPTVYRMLVQND
DLTA_STRZT      ETPSRPQMLAQPPYSFDLSVMYWAPTLALGGTLFTLPSVITQDF-----KQLFAAIFSLPAIWTSTPSFA
DLTA_STRPJ      ETPSRPQMLAQPPYSFDLSVMYWAPTLALGGTLFTLPSVITQDF-----KQLFAAIFSLPAIWTSTPSFA
DLTA_STRP7      ETPSRPQMLAQPPYSFDLSVMYWAPTLALGGTLFTLPSVITQDF-----KQLFAAIFSLPAIWTSTPSFA
ACSM1_HUMAN     RSLKTSDVSWCLSDSIVATIWTLVEPWTAGCTVFI--HHLPKVIIQTLLKYPINHFWGVSSIYRMILQQD
ACSA_GEMAT      DLKEEDVYWCTADIGWITGHSYLVYGLANGATCVMYEGAPDKDRFWQIERYGVTILYTAPT--AIRAFMK
4CL2_ORYSJ      HMGAGDVALCVLPLFHIFSLSVLLCAVRAGAAVALMPRFEMGAMLGAIERWRVTXXXXXXXXXXXXXKNP
DLTA_STRZP      ETPSRPQMLAQPPYSFDLSVMYWAPTLALGGTLFTLPSVITQDF-----KQLFAAIFSLPAIWTSTPSFA
DLTA_STRR6      ETPSRPQMLAQPPYSFDLSVMYWAPTLALGGTLFTLPSVITQDF-----KQLFAAIFSLPAIWTSTPSFA
DLTA_STRPN      ETPSRPQMLAQPPYSFDLSVMYWAPTLALGGTLFTLPSVITQDF-----KQLFAAIFSLPAIWTSTPSFA
DLTA_STRP2      ETPSRPQMLAQPPYSFDLSVMYWAPTLALGGTLFTLPSVITQDF-----KQLFAAIFSLPAIWTSTPSFA
ACSM4_RAT       DLTSSDIMWNMSDTGWKAAIGSVFSTWLRGACVFVMAQFNTDTFLDTLTSYPITTLCSAPTVYRMLVQQD
ACSM4_HUMAN     DLKSSDIIWNMSDTGWKAAIGSVFSSWLCGACVFVMAQXXXXXXXXXXXXYPITTLCSPPTVYRMLVQKD
ACSA_NITEU      DYHADDVFWCTADVGWVTGHSYVAYGLAIGATQVIFEHPHAGRFWEIIQKHRITTFYTAPTAIRSLIKLG
ACSA_RUBXD      DLKEDDVYWCTADIGWVTGHSYIVYGLSNGATALMFEYPANDRWWDIIERHGVTILTAPTAIRAFMKQGP
ACSA_PHYBL      DYQENDIYACMADIGWVTGHSYIVYGLTLGATTVLFEYPNPSRFWQLIEKHKITQFYTAPTAIRALQRLG
DLTA_STAES      KTGTGKEWLNQAPFSFDLSVMAIYPCLTSGGTLNLVD----KDMIKKPKLLNEMLVQTPMNVWVSTPSLL
ACSF3_XENLA     GWTKEDSIXXXXXXXXXXXXNKLMCPLWVGATCVILPEFCPKTVWQHFLGRDVPSINAVPTIYSKLIAYY
ACSA_LARHH      DYKPNDIYWCTADVGWITGHSYICYGLAMGATQVVFEYPDAGRFWRMIEQHKVNIFYTAPTAIRSLIKLA
4CL3_ORYSJ      DGENDDVILCLLPLFHIYSLSVLLAGLRAGSTIVIMRKFDLGALVDLVRKHNITIAPFVPPIVVEIASPR
MENE_STAAR      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
BAIB_EUBSP      GMGFEQRQLLVGPLFHGAPHSAAFNGLFMGNTLVLTRNLCPGNILNMIKKYKIEFIQMVPTLMNRLAKLE
ACSA_CHRVO      DYKPNDVFWCTADVGWITGHSYVCYGLANGATQVIFEYPDAGRFWKMIEQHKVTAPTAIRSL-IKLGSDL
ACSA_BACSU      DLKEEDIYWCTADPGWVTGYGIFAPWLNGATNVIVGGRFSPESWYGTIEQLGVNVWYSAPTAFRMLMGAG
DLTA_STAEQ      KTGTGKEWLNQAPFSFDLSVMAIYPCLTSGGTLNLVD----KDMIKKPKLLNEMLVQTPMNVWVSTPSLL
MENE_STAES      GFEQNTVWLSVLPIYHISGLSVILRAVIEGFTVRLVKKFQTDDMLTQIKTYPITHMSLVPQTWLMDAGLT
ACSA_COPC7      DVHPDDRFACMADVGWITGHTYIVYGLAIGVTTTVFEYPTPSRYWETVEKYKLTQFYSAPTAIRLLRRLG
CAIC_SHIF8      ALRDDDVYMTVMPFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRAT-ITECIPMMIRTL-MV
4CL2_SOYBN      DGTTEDVLLCVLPLFHIFSLSVLLCALRAGSAVLLMQKFEIGTLLELIQRHRXXXXXXXXXXXXXXXK--
MENE_STAEQ      GFEQNTVWLSVLPIYHISGLSVILRAVIEGFTVRLVKKFQTDDMLTQIKTYPITHMSLVPQTWLMDAGLT
ACSA_SYNFM      DYHDGDIYWCTADIGWVTGHSYIIYGLANGATTVMFEYTAPT-AIRALMRQGEAPVRATSRKSLKLLGTV
MENE_STAAN      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAAM      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAA9      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAA2      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAA1      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
ACSA_DICDI      DYHDSDVYACMADVGWITGHSYIVYGLANGATTFIFEYPTPARYWEMVQRHKITQFYTAPTAIRSLMKIS
ACSA_COPCI      DVHPDDRFACMADVGWITGHTYIVYGLAIGATTTVFEYPTPSRYWETVEKYKLTQFYSAPTAIRLLRRLG
ACSM4_MOUSE     DLTSSDIMWNMSDTGWKAAIGSVFSTWLRGACVFVMAQXXXXXXXXXXXXYPITTLCSAPTVYRMLVQKD
ACSA_XYLFA      DLRENDIYWCTADIGWITGHSYIVYGLANGATVLLFEYPTVSRFWEVIDKHHVTLFYTAPTAIRALMREG
ACSA_SCHPO      DLHPTDRMGCAGDVGWITGHTYIVYGLMLGAATLVFEYPDYSRYWSVVERHRLTQWYIAPTALLQRAGNE
ACSA_PSYIN      DYQEGDIYWCTADVGWITGHTSVYGPLANGATSLIFEYPTPARMSEVVDKHKVTAPTAIRALMAK-GDQA
ACSA_NOVAD      FDYRPGQIYCAADIGWVTGHSYVVYGLMNGATTVMFEFWQVVDKFKVEIFYGAP--TALRALWVKKTSRA
ESYN_FUSEQ      GITSDTRALQFGSHAFGACILEIMTTLIHGGCV-----CIPSDVLEFINRTNVQLGHATPSYMG-----T
ACSA_PYRAE      FDIRDDDIFCTADIGWVTGHSYVVLGLLMGATEVIYEYPQPDRWWSIIERYGVT-IFYTSPTAIRMFMRE
ACSA_XYLFT      DLRENDIYWCTADIGWITGHSYIVYGLANGTTVLLFEYPTVSRFWEVIDKHHVTLFYTAPTAIRALMREG
ACSF3_BOVIN     AWTKDDVIXXXXXXXXXXXXNKLLCPLWVGATCVMLPEFLVWEKFLSSEAPQINVFMAVPTIYSKLMDYF
ACSA_VIBCH      DYQPNEVFWCTADVGWITGHSYLVYGLANGAKTILFEYPTTARMSEVVDKHKVTAPTAIRALMAK-GDEA
MENE_LACLA      GAYDNDNWLVILPMFHVSGLSIIMRTLYNATSATVVDKFDENQLLEMINSGKINMVSLVPTLLTRIADKL
DLTA_STAXY      KIGENQQWLNQAPFSFDLSVMAIYPCLATAGTLNLVDKTMPK-LLNDMLEQSKINVWVSTPSFMEMCLML
ACSA_SALTI      DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
ACSA_BDEBA      DYHEDDIYWCSADVGWVTGHSYIVYGLANGATSLFFEYPTPSRFWEVVDKHKVTSPTAIRSL-MREGDAA
ACS1_DEBHA      DVHEDDVLFTAGDVGWITGHTYVVYGLLCGATTVVFEYVAPT-ALRLLKRAGTKYIENYKLDSLRVLGSV
4CL1_ORYSJ      DGHAGDVILCALPMFHIYSLNTMMCGLRVGAAIVVMRRFDLAAMMDLVERHXXXXXXXXXXXXXXXXXXX
ACSA_SYNY3      DLKDTDVYWCTADVGWITGHSYIVYGLSNGATTVMYEGVPPGCFWDVIERYGVNIFYTAPTAFIRMGEAV
ACSA_CAUCR      DYKPGEVFWCTADVGWVTGHSYVVYGLANGGTSLIFEYPTPSRFWEVIDKHQVSIFYTAP---TALRALM
4CLL9_ORYSJ     ETAGQVVTLGLMPFFHIYGITGICCALRHKGTVVVMDRFDLRTFLRALVDHRVMFAPLVPP--VMLAMVK
MENE_STAAU      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAAT      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAAE      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAAC      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAA8      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
MENE_STAA3      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
ACSA_PYRAR      FDIRDDDIYCTADIGWVTGHSYVVLGLLMGTTEIIYEYPQPDRWWSIIERYGVTILYTSPTMFMRYGE-A
ACSA_SALTY      DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMCQVVDKHQVTAPTAIRALMAE-GDKA
ACSA_NITEC      DYHSEDIFWCTADVGWVTGHSYVTYGLAIGATQVIFEYPHAGRFWEIIQKHRVTTFYTAPTAIRSLIKLG
ACSA_BRAJA      DYHDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPDNSIDKHKVNTFYTAPTAIRALMQGG
VIBE_VIBCH      RFDQHTRYLCVLPAAHNFPLSSALGVFWAGGCVVLSQDASPQHAFKLIEQHKITVTALVPPL-----ALL
ACSA_RHOBA      DHREGDVYWCTADCGWITGHSYVVYGLSAGATCLMYENFPAEDRFWDIVERHKVSILYTAPTAVR-AFIK
ACSA_CITK8      DYHPDDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMAQVVDKHQVTILTAPTAIRALMAEGD
ACSA_SHEFN      FDYKADEVYCTADVGWITGHSYMVYGPFANAATVLIHHPTPARLGEMIDRHKVNILYTAPTLIRALMAEG
ACSA_AERS4      DYHEEDIYWCTADVGWVTGHSYLVYGLANGATTIMFEYPATNRMSQVVDKHQVTILYTAPTAIRALMAKA
ACSA1_PSEAE     DYRPGEVYWCTADIGWVTGHTYIVYGLANGATTILFEYPDVTRVAKIIDKHKVNILTAPTAIRAMMAEGK
MENE_STAAW      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTIIKNERITHISLVPQTWLMQQGLH
MENE_STAAS      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTIIKNERITHISLVPQTWLMQQGLH
ACSA_THEEB      DLQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRDVIE---KYGVTIFYTAPTAIRAFIKMG
ACSA_BEII9      DYHDGDVYWCTADVGWVTGHSYIVYGLANGATTLMFEYPSVSRFWEVIDKHKVTIFYTAPTAIRALMGSG
MENE_STAAB      GFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQILTMIKNERITHISLVPQTWLMQQGLH
ACSA_SHEDO      DYKENEVYWCTADVGWITGHSYMVYGFANGATVLMHEYPTPARLGEIVDRHKVNILYTAPTLIRALMAEG
ACSA_PHOPR      DYQEGDVYWCTADVGWITGHSYLVYGLANGATTVLFEYPSTSRMSEVVDKHNVTAPTAIRALMAK-GTEA
4CLL5_ORYSJ     EKVARXXXXXXXXXXXXXGFMMVLRSVSMGETSVLMERFDFIAALRAIERYRVTLLPAAPPVLVAMVKYE
ACSA_DESAA      DYHDGDIYWCTADIGWVTGHSYIIYGPLANGAVTIMFEGIPNYPDFSCDKHQVNIFYTAPTVVRALMQQG
ACSA_SODGM      DYHPGDVYWCTADVGWVTGHSYLLYGPLACCAITLMFEGVPNRMAQVVDKHQVTAPTAIRALMAE-GDKA
ACSA_SHEHH      DYKENEVYWCTADVGWITGHSYMVYGLANGATVLIHEYPSPARLGEMVDRHKVNILYTAPTLIRALMAEG
ACSA_ECOLI      DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMAQVVDKHQVTAPTAIRALMAE-GDKA
ACSA_AERHH      DYHEEDIYWCTADVGWVTGHSYLVYGLANGATTIMFEYPATNRMSQVVDKHQVS-ILYTAPTAIRALMAK
ACSA_PSESM      DYKPGEIYWCTADVGWVTGHSYIVYGLANGATTLLFEYPDITRVSKIIDKHKVNILTAPTAIRAMMAEGT
ACSA_BRASO      DYHEGDVYWCTADVGWVTGHSYILYGPLANGAVTLMFEGVPNYPDNSIDKHKVTAPTAIRAL-MQGGDGP
ACS2_CANAL      DIHPEDILFTAGDVGWITGHTYLYGPLLLGVPTIIFEYPDYGRFWQIVEKHKATHFY-VAPTALRLLRKA
LCF2_SCHPO      SQHINDYVLAYLPLAFEFIFEMLTDASVVNCKGDLTEFLIGVPAVYELIKKGILAKVSSMPAHRQLIERN
ACSA_METFK      DHKATDIFWCTADVGWITGHSYVAYGLALGSTQVVFEYPDAGRFWQMIERHKVSIFYTAPTAIRSLIKLG
ACSA_RHOCA      DYKDGDVFWCTADVGWVTGHSYIIYGPLANGATTLMFEGVPTFPDAGCEKHKVNQFYTAPPEWVEKYDLS
ACSA_EMENI      DIHDDDRYFCGGDVGWITGHTYVVYALLLGCSTVVFEFSRYWDVIE---KHKVTQFY-VAPTALRLLKRA
ACSA_SYNAS      DYHDGDIYWCTADIGWVTGHSTIYGPLANGATTVMFEYPDWSRFWRIVDKHGVTILYTAPTAIRALMRQG
ACSA_ECOL6      DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMAQVVDKHQVTAPTAIRALMAE-GDKA
ACSF4_MOUSE     DITQEDILFLASPLTFDPSVVEIFVSLSSGACLLIVPKVLPSKLADILSRHRVTVLQATPTLLRRFGSKS
LYS2_SCHPO      NLSESDRFTMLSGIAHDPIQRDIFTPLFLGASLIVPDIGTPGQLAQWANKYKVT-VTHLTPAMGQLLA-A
ACSA_YERPP      DYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNRLSQVVDKHKVTAPTAIRALMAE-GDKA
ACSA_YERPN      DYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNRLSQVVDKHKVTAPTAIRALMAE-GDKA
ACSA_YERPE      DYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNRLSQVVDKHKVTAPTAIRALMAE-GDKA
ACSA_YERPA      DYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNRLSQVVDKHKVTAPTAIRALMAE-GDKA
ACSA_SHEPA      DYKENEVYWCTADVGWITGHSYMVYGLANGATVLIHEYPTPARLGEMVDRHKVNILYTAPTLIRALMAEG
ACSA_LEPIN      DIKPEDTYWCTADIGWVTGHSYLVYGLSNGASSVMFEYTAPT-AIRALMREGLNHIQKRDLSSLRLGSVG
ACSA_LEPIC      DIKPEDTYWCTADIGWVTGHSYLVYGLSNGASSVMFEYTAPT-AIRALMREGLNHIQKRDLSSLRLGSVG
ACSA_HALHL      FDYQDGEVYCTADVGWVTGHSYIVYGLANGAKTLMFEYPDAGRFWQVVDKHEVTAPTAIRALMGQGDDHV
ACSA_ENTS8      DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPSANRMAQVVDKHKVTAPTAIRALMAE-GDKA
ACSA_YERPS      DYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNRLSQVVDKHKVTAPTAIRALMAE-GDKA
ACSA_YERP3      DYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNRLSQVVDKHKVTAPTAIRALMAE-GDKA
ACSA_PSEU2      DYRPGEVYWCTADVGWVTGHSYIVYGLANGATTLLFEYPDITRVSKIIDKHKVNILTAPTAIRAMMAEGT
ACS1_CANAL      FDVHEDDIL------FTAGDIGWITGHT---------YCVYGPLLAGATSVVFEGTPAYPNY-----SRY
AAS_SHIFL       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPDLVYDRSCTVLFGTSTFLGHYARFAN--
AAS_SHIF8       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPDLVYDRSCTVLFGTSTFLGHYARFAN--
ACSA_BURPS      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVTVFYTAP---TAIRSLI
ACSA_BURP6      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVTVFYTAP---TAIRSLI
ACSA_BURP1      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVTVFYTAP---TAIRSLI
ACSA_BURP0      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVTVFYTAP---TAIRSLI
ACSA_BURMS      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVTVFYTAP---TAIRSLI
ACSA_BURMA      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVTVFYTAP---TAIRSLI
ACSA_BURM9      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVTVFYTAP---TAIRSLI
ACSA_BURM7      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVTVFYTAP---TAIRSLI
AAS_SALDC       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
ACSA_PENCH      DIHDDDRYFCGGDVGWITGHTYVVYALLLGCATVVFEYPNFSRYWDVIDKHDVTQFY-VAPTALRLLKRA
ACSA_MARMS      DLKPDDVYWCAADVGWITGHSYMVYGLANGTTSILFEYPDSGRIGRVVDKFDVTILYTAPTAIRALMAKA
ACSA_MAGSM      DYHEDDIYWCTADVGWVTGHTYIVYGLANGATTLMFEYPDASRFWQVVDKHQVTAPTAIRSIMSQGDALV
AAS_ECOUT       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECOK1       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECO45       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
4CLL1_ARATH     RSEMIGQILGLIPFFHIYGIVGIATMKNKGKVVAMSRYDL-RIFLNALIAHEVSFAPIVPPIILNLVKNP
ACSA_VIBPA      DYQPGETFWCTADVGWITGHTYLIYGLANGAKTILFEYPNTSRMSEVVDKHQVTAPTAIRALMAK-GNEA
ACSA_PSEHT      DVKEDDVFWCSADVGWITGHSYIAYGPLVGCTQVVFEYPTAGRMGEVVDKHGVTILYTAPTAIRALMAKG
ACSA_PSE14      DYKPGEIYWCTADVGWVTGHSYIVYGLANGATTLLFEYPDITRVSKIIDKHKVNILTAPTAIRAMMAEGT
ACSA_ECO57      DYHPGDIYWCTADVGWVTGHSYLLYGLACGATTLMFEWPTPARMAQVVDKHQVTAPTAIRALMAE-GDKA
ACSA1_PSEPK     DYRPGEVYWCTADVGWVTGHSYIVYGLANGATTLLFEYPDITRVSKIVDKHKVNILTAPTAIRAMMAEGQ
ACSA_METSO      DLKDDDVWWCTADIGWVTGHSYIVYAPLILGMTSLMDYPDFGRWWKNIQDHKVTVLYTAPTAMFMKQGAE
AAS_SHISS       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_SHIB3       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_SALTI       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALSV       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALPK       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALPB       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALPA       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALHS       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALG2       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALEP       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALA4       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_ECOSM       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECOSE       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECOLU       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECOLI       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECOLC       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECOL6       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECOHS       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECODH       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECOBW       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECO5E       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECO57       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECO55       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECO27       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECO24       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
ACSA_SERP5      DYHDGDVYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNRLSQVIDKHQVTAPTAIRALMAE-GDKA
AAS_SALTY       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALPC       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALNS       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_SALCH       DFTANDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN--
AAS_ECOL5       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN--
AAS_ECO7I       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRSCTVLFGSSTFLGHYARFAN--
ACSA_ALHEH      DYQEGEVYWCTADVGWVTGHSYIVYGLANGATTLMFEYPSAARCWEVVDKHNVTAPTAIRALMGQ-GNEH
AAS_KLEP3       DFTANDRFMSALPLFHSFGLTGLLTPLFTGAEVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLANYARFA
AAS_ENT38       DFTAKDRFMSALPLFHSFGLTGLFTPLFTGAEVFLLHYRVVPELVYDRNCTVLFGTSTFLGHYARFAN--
4CLL8_ORYSJ     -DDHDEAYGCVLPMFHMFGFSSFXXXXXXXXXXXXXXRFSVEKTMAAVEEYGVTRLLXXXXXXXXXXXXX
ACSA_YERE8      DYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNRLGQVIDKHQVTAPTAIRALMAE-GDKA
ACSA_VIBVY      DYQPGETFWCTADVGWITGHTYLVYGLANGAKTILFEYPNTSRMSEVVDKHQVTAPTAIRALMAK-GNEA
ACSA_VIBVU      DYQPGETFWCTADVGWITGHTYLVYGLANGAKTILFEYPNTSRMSEVVDKHQVTAPTAIRALMAK-GNEA
ACSA_THIDA      AKADNDVYWCTADVGWITGHTYVAYGLALGMTEVIFEYPHAGRFWETIAKHKVTTFYTAPTAIRSLIKLG
ACSA_SHESH      FDYKDGEVYCTADVGWITGHSYMVYGLANGATVLIHEYPTPARLGEMVDRHKVNILYTAPTL-IRALMAE
ACSA_PHOLL      DYQPGEVYWCTADVGWVTGHSYLLYGLSCGAITLMFEYPAVNRLSQIIDKHQVTAPTAIRALMAE-GDKA
ACSA_BURTA      DWKPDDVFWCTADIGWVTGHSYITYGLAVGATQVVFEYPNAGRFWKMIGDHKVSVFYTAPTAIRSLIKAA
4CL1_SOYBN      ------------------------------ATILLMPKFDINSLLALIHKHKVTIAPVVPPI---VLAIS
ACSA_XANP2      DYHPGDIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPNYPSVSIDKHKVNIFYTAPTAIRSLMQAG
AAS_YERE8       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
ACSA_THET2      DLKDEDVYWCTADVGWITGHSYVVYGPLLGATTVMYEWPEPDRFWRIVDKYGVTVFYTAPTAIRSFMKWG
ACSA_PARL1      DYHDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPDASIDKHEVNIFYTAPTALRALMREG
ACSA_NEUCR      DIHDGDRYFCGGDVGWITGHTYVLYALLLGVSTVVFEYPNFSRYWDIIEEHKVTQFY-VAPTALRLLKRA
ACSA_MARAV      DYHDGDVYWCTADFGWVTGHSYILYGPLANGAITLLFEGVPNYPDSSVDKHKVTAPTAIRALMAQGES-C
AAS_PECCP       DFTPRDRFMSALPLFHAFGLTGLLTPLMTGARIFLYPSPLHYRIVPELVDQNCTVLFGTSTFLGNYARFA
AAS_ESCF3       DFTTNDRFMSALPLFHSFGLTGLFTPLLTGAEVFLLHYRIVPELVYDRNCTVLFGTSTFLGHYARFAN--
ACSL4_HUMAN     PGGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKP-----TLMA
ACSA_THET8      DLKDEDVYWCTADVGWITGHSYVVYGPLLGATTVMYEWPEPDRFWRIVDKYGVTVFYTAPTAIRSFMKWG
ACSA_BART1      DYHPGEIYWCTADIGWITGHSYLVYGPLCNGATTLMFEGTPTFPDKGVDKHKVNTLYTAPTAIRALAGNS
ACS2_DEBHA      DIHPEDVLFTAGDVGWITGHTYLYGPLSLGVPTVVFEGTFPDRLWQIVEKHKATHFY-VAPTALRLLRKS
4CL4_ARATH      DGTANDVILCFLPMFHIYALDALLSAMRTGAALLIVPRFELNLVMELIQRY--KXXXXXXXXXXXLAFIK
ACSA_RHOP5      DYHDGDVYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPTNSIDKHQVTAPTAIRAL-MQGGDEP
AAS_ERWCT       DFTPGDRFMSALPLFHAFGLTGLLTPLITGARVFLYPSPLHYRIVPELVDQNCTVLFGTSTFLGNYARFA
ACSA_SHEAM      DYKPGEVYWCTADVGWITGHSYMVYGLANGATILIHEFPSPARLGEIVDRHQVNILYTAPTLIRALMAEG
ACSA_RHILO      DYHDGDIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPSQSIDKHKVNIFYTAPTALRALMGAG
ACSA_LEPBJ      DIKPEDTYWCTADIGWVTGHSYLVYGLSNGASSVMFEYPDAGRFWDVIDKYGVTAPTAIRALMVQKRNLS
ACSA_BURS3      DWKPTDVFWCTADIGWVTGHTYITYGLACGGTQVVFEYPDAGRFWKMIGDHKVTVFYTAP---TAIRSLI
ACSF4_HUMAN     DITQEDVLFLASPLTFDPSVVEIFLALSSGASLLIVPKLLPSKLASVLSHHRVTVLQATPTLLRRFGSKS
AAS_CITK8       DFTANDRFMSALPLSFXXXXXXXXXXXXXAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFA
LYS2_CANGA      NLSENDKFTMLSGIAHDPIQRDMFTPLFLGAQLYVPDIGTPGRLAEWMGKYGCTVTHLTPAMGQLLTAQA
ACS2_ASHGO      DIHPEDVLFTAGDVGWITGHTYLYGPLCLGTATIIFEYPDYGRYWRIIQRHKATHFY-VAPTAMRLIKTV
ACSA_CRYPV      FNHPGDIFGCAGDIGWITGHSYLVYALCNGITTLIFEYPNAGRYWEMVERHRITHFYAAPTAIRTLKRLG
AAS_YERPY       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
AAS_YERPS       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
AAS_YERPP       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
AAS_YERPG       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
AAS_YERPB       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
AAS_YERP3       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
ACSA_BARQU      DYHPGEIYWCTADIGWISGHSYLIYGPLCNGATTLMFEGIPTFPDQGVDKHKVNTLYTAPTAIRALAGNS
ACSA_BARHE      DYHAGEIYWCTADIGWITGHSYLVYGPLCNAATTLMFEGTPTRFWEIVDKHQVTAPTAIRALMGAGNSFV
ACS2_ZYGBA      DIHPEDVLFTAGDVGWITGHTYLYGPLVLGTASIIFEYPDYGRYWRIIQRHKATHFYVAPTLIKRVGEAE
ACSA_METSB      DYRPGEVYWCTADVGWVTGHSYIVYGLANGATTLMFEGVPSYPTISRVDKHQVNIFYTAPTAIRSLMGAG
ACSA_LEPBL      DIKPEDTYWCTADIGWVTGHSYLVYGLSNGASSVMFEYPDAGRFWDVIDKYGVTAPTAIRALMVQKRNLS
ACSA_AGRT5      FDYKDGEVFCTADVGWVTGHSYIVYGPLANCATTLMFEGVPNFPDQGIDKHKVNIFYTAPTALRSLMGAG
ACS2_YEAST      DIHPEDVLFTAGDVGWITGHTYLYGPLTLGTASIIFEYPDYGRYWRIIQRHKATHFY-VAPTALRLIKRV
DHBE_BACSU      WLDHSTVYLAALPMAHNYPLSSVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLAMVWMXXX
ACSA_SHESA      DYKPGEIYWCTADVGWITGHSYMVYGLANGATVLIHEYPSPARLGEMIDRHKVNILYTAPTLIRALMAEG
ACSA_METPB      DYHDGDVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSNSIDKHKVNIFYTAPTAIRSLMGGG
ACS1_CANGA      -------LGALLTMRYTFDVHQEDVFFTAGGWITGHTYCVYGPLLYGCTTLVFEGTPAYPNF-----SRY
AAS_YERPE       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
AAS_YERPA       DFTPRDRFMSSLPLFHAFGLTGLFTPLMTGSRVFLYPSPLHYRVVPELVDRNCTVLFGTSTFLGNYARFA
LYS2_PENCH      KLTPDEKFTMLSGIAHDPIQRDIFTPLFLGAQLLVREDIQNEKLAEWIEKYGAT-ITHLTPAMGQIASAQ
ACSL4_MOUSE     PGGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKP-----TLMA
ACBG1_BOVIN     AEIQQEVVVSYLPLSHIAAIYDLWTGIQWGAQVCFAEPALKGSLVNTLREVEPTSHMGVPRVWEKIMELA
LCF1_SCHPO      EVTSKDYLLAYLPLALEFAFENICLAWTIGANVRTLVDTNCRNCKGDINTFRPTIMVGVPAVWEMVRSVF
AAS_ENTS8       DFTADDKFMSALPLFHSFGLTGLFTPLLTGAEVFLYPSPLHYRVVPELVDRNCTVIFGTSTFLGHYARFA
ACSA_LEPBP      DYKDTDTYWCTADIGWITGHSYILYGLSNGATSLMFEYTAPT-AIRALMREGLEHIKKRSLASLRLGSVG
ACSA_LEPBA      DYKDTDTYWCTADIGWITGHSYILYGLSNGATSLMFEYTAPT-AIRALMREGLEHIKKRSLASLRLGSVG
ACSL4_RAT       PGGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKP-----TLMA
ACSL3_PONAB     ELGEEDVYIGYLPLAHVLELSAELVCLSHGCRI-------------------------------------
ACSL3_HUMAN     ELGEEDVYIGYLPLAHVLELSAELVCLSHGCRI-------------------------------------
ACSA_XANAC      HEREDDIYWCTADVGWVTGHSYIVYGLANGATAVMFEYPNVSRFWEVIDKHQVTIFYTAPTAIRALMRDG
ACSA_SHESR      DYKPGEIYWCTADVGWITGHSYMVYGLANGATVLIHEGISPARLGEMIDRHKVNILYTAPTLIRALMAEG
ACSA_SHESM      DYKPGEIYWCTADVGWITGHSYMVYGLANGATVLIHEGISPARLGEMIDRHKVNILYTAPTLIRALMAEG
ACSA_METEP      DYHDGDVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSNSIDKHNVNIFYTAPTAIRSLMGGG
MENE_SALTY      PFGPQDDWLLSLPLFHVSGQGIMWRWLFAGARMTVRD----KQPLEQMLA-GCTHASLVPQLWRLLAN--
ACSA_DEIRA      FDLRDDDIYCTADIGWITGHSSVYGPLLNGATVVMYEYTAPT-AIRSFMQHGIPGRYDLASLRL-LGSVG
ACS2_KLULA      DIHPEDVLFTAGDVGWITGHTYLYGPLTLGTATIIFEYPDYGRYWRIIERHRATHFY-VAPTALRLIKRV
AAS_KLEP7       DFTANDRFMSALPLSFXXXXXXXXXXXXXAEVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLANYARFA
LYS2_YEAST      NLTENDKFTMLSGIAHDPIQRDMFTPLFLGAQLYVPDIGTPGRLAEWMSKYGCTVTHLTPAMGQLLTAQA
ACSA_XANOM      HEREDDIYWCTADVGWVTGHSYIVYGLANGATAVMFEYPNVSRFWEVIDKHQVTIFYTAPTAIRALMRDG
ACSA_SHEON      DYKPGEIYWCTADVGWITGHSYMVYGLANGATVLIHEHPSPARLGEMIDRHKVNILYTAPTLIRALMAEG
ACSA_METRJ      DYREGDVYWCTADVGWVTGHSYIVYGLANGATTLMFEYPSTSRFWEVVDKHKVNIFYTAPTAIRSLMGGG
ACSA_BURP8      DWKPTDVFWCTADIGWVTGHSYITYGLTLGGTQVVFEYPNAGRFWDMIQKHKVTVFYTAPTAIRSLIKAA
ACS1_ASHGO      DVHSDDIFFTAGDIGWITGHTYVVYGFS-GCTTVVFE---GTPAYPSYSRYDIIDKYSVTQFYVAPTALR
ENTE_ECO57      QFTQQTRYLCAIPAAHNYAMSSPGSVFLAGGTVVLAADPSATLCFPLIEKHQINVTALVPPLWLQALTEG
ACSA_WOLSU      DVKENDTYWCTADVGWITGHTYIVYGLAMGATTVMYEYPDTGRWWKMIEHYRVNQFYTAPTA-IRLLHKE
ACSA_SHELP      FDYKEGEIYCTADVGWITGHSYMVYGLANGATILIHEYPTPARLGEMIDRHKVNILYTAPTLIRAL--MA
ACSA_HELAH      DIRDNDNFWCTADIGWITGHTYVVYGLACGATTLILEGTMSYPDYRMIEEYRVDKFYTSPTA-IRMLHAK
ACS1_KLULA      FDIQNDDIF------FTAGDIGWITGHT---------YCVYGPLLQGCTTLVFEGTPAYPNF-----SRY
ENTE_ECOLI      QFTQQTRYLCAIPAAHNYAMSSPGSVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPLWLQALIEG
ACSM6_HUMAN     DLQPTDVLWSLGDFGGSLSLSAVLGTWFQGACVFLMPTFCPETVLNVLSRFPITTLSANPEMYQELLQKC
ACSA_METC4      DYHDGEVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSNSIDKHKVNIFYTAPTAIRSLMGGG
ACSA_HERAR      DIKPNDVYWCTADIGWVTGHTYVTYGLAVGATQIVFEYPNAGRFWEMVQKHKVSIFYTAPTAIRSLIKAA
ESYN_GIBPU      NFPSPARMSHVFNAAFDGASWEMFWMLLNGGTVVCIDYLATLDELAAVFAKERVNCAFLAPAMLKL-YLT
AAS_ERWT9       DFTPCDRFMSALPLFHAFGLTGLFTPLMTGARVFLYPSPLHYRIVPELVDRNCTVLFGTSTFLGNYARFA
S27A5_HUMAN     GATADDVVYTVLPLYHVMGLVVILGCLDLGATCVLAPKFSTSCFWDDCRQHGVTVILYVGELLRYLCNIP
ACSA_BARBK      DYHPGEIYWCTADIGWITGHSYLTTLMFEGSPTFPDEGRFWEIVDKHKVNIFYTAPTAIRALMGAGDSFV
ACBG1_RAT       AEVQQEVVVSYLPLSHIAAIYDLWTGIQWGAQVCFADPALKGTLVNTLREVEPTSHMGVPRVWEKIMELL
S27A5_MOUSE     GCRADDVVYDVLPLYHTIGLVLFLGCLQVGATCVLAPKFSASRFWAECRQHGVTVILYVGEILRYLCNVP
ACSA_SHESW      DYKAGEVYWCTADVGWITGHSYMVYGLANGATVLIHEHPSPARLGEMIDRHKVNILYTAPTLIRALMAEG
ACSA_SHEPC      DYKAGEVYWCTADVGWITGHSYMVYGLANGATVLIHEHPSPARLGEMIDRHKVNILYTAPTLIRALMAEG
ACSA_HELPY      DIRDNDNFWCTADIGWITGHTYVVYGLACGATTLILEGTMSYPDYRMIEEYRVDKFYTSPTA-IRMLHAK
ACSA_HELPH      DIRDNDNFWCTADIGWITGHTYVVYGLACGATTLILEGTMSYPDYRMIEEYRVDKFYTSPTA-IRMLHAK
ACSA_HELPG      DIRDNDNFWCTADIGWITGHTYVVYGLACGATTLILEGTMSYPDYRMIEEYRVDKFYTSPTA-IRMLHAK
ACSA_ALCBS      DYQDGDIYWCTADVGWITGHSYIVYGLANGATTLMFEYPDASRCWQVVDKHKVNIFYTAPTAIRALMGLG
ACSA_RALSO      DLKPDDVFWCTADIGWVTGHTYIAYGLAAGATQVVFEYPNAGRFWDMIQKHRVNTFYTAPTAIRSLIKAA
ACSA_DROME      ----------------------------------------------------------------------
ACBG1_MOUSE     AEVQQEVVVSYLPLSHIAAIYDLWTGIQWGAQVCFADPALKGTLVNTLREVEPTSHMGVPRVWEKIMELL
ACSA_HELP2      DIRDNDNFWCTADIGWITGHTYVVYGLACGATTLILEGTMSYPDYRMIEEYRVDKFYTSPTA-IRMLHAK
ACSA_STRCO      LKPETDVFWCTADVGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGVQKYGVTILYTAPT--AIRTFMK
LCF4_YEAST      IGGPTDRIIAFLPLAFEAFYKTLTPTSTRNCQGDLMEFMVGVAAVWETVRKGILAKINELPGWSQ--TLF
ACSF4_DANRE     KMTPEDVVFLSSPLTFDPSVVEVFLALSSGACLLIVPSAVKKMPRRLFKRNTTTVLQATPTLVRRFGKVV
ACSA_PSYA2      XXXXXXXXYCTADVGWVTGHTYATYAPLANGTTTVMEYPTWARIGHIIDKHQITVLTAIRAMMKELGTVG
ACSA_MYCTU      FDVKPDS--DVFWCTADIGWVTGHTYGVYGPGVTEVLYEGTPDTFQIIEKYGVTIYYTAPTLIRMF--MK
ACSA_MYCBO      FDVKPDS--DVFWCTADIGWVTGHTYGVYGPGVTEVLYEGTPDTFQIIEKYGVTIYYTAPTLIRMF--MK
ACSA_CHLTE      DIKDEDIYFCTADIGWITGHTYIIYGPLLNGATVFMYEGAPNDIIN---RHKITILYTAPTAFIRAGNEW
ACSA2_PSEAE     ----------------------------------------------------------------------
ACS2L_MOUSE     DYQPGDVFGCVADIGWITGHSYVVYGLCNGATTVLFESVYPDETVQRLKINQFYGAPTAVRLLLKYGDAW
ACBG1_MACFA     DIRQQEVVVSYLPLSHIAAIYDLWTGIQWGAQVCFAEPALKGSLVNTLREVEPTSHMGVPRVWEKIMELL
ACSA2_RHIME     DYQDGDIYWCTADVGWVTGHSYIVYGPLANAATTLM----------------------------------
ACBG1_HUMAN     DIRQQEVVVSYLPLSHIAAIYDLWTGIQWGAQVCFAEPALKGSLVNTLREVEPTSHMGVPRVWEKIMELL
S27A5_RAT       GRTADDVVYNVLPLYHSMXXXXXXXXXXXXATCVLAPKFSASRYWAECRQYSVTVVLYVGEVLRYLCNVP
S27A3_MOUSE     GVHQEDVIYLALPLYHMSGLLGIVGCLGIGATVVLKPKFSASQFWDDCQKHRVTVFQYIGELCRYLVNQP
LCFH_HAEIN      NVTDQDISLSFLP--FSHIFERAWAAYILHRGAILCYLEDTNQVRSALTEIRPTLMCAVPRFYEKIAAVL
ACSA_RHILW      ----------------------------------------------------------------------
ACSA_RALME      DIKPDDMFWCTADIGWVTGHTYITYGLAAGATQIVFEGVFPNAFWDMIQRHKVSIFYTAPTAIRSLIKAA
ACSA2_PSEPK     DYRDGEVFWCTADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDTSVDKHQVTAPTALRAL-MREGSAP
VRAA_STAEQ      QH-CEETIVAPGPLSHSLSLYACIYALSTGKTFIGQKNFNPLSLMRLINQNKATAIFVVPTMVQQLISTQ
MENE_ECOLI      PFGDHDDWLLSLPLFHVSGQGIMWRWLYAGARMTVRD----KQPLEQMLA-GCTHASLVPQLWRLLVN--
ACBG2_CHICK     ATEKQELVVSYLPLSHVAAMIDIWLPVTFGGQVFFAQDALKGTLVDTLREVRPTAFLGVPRVWEKIEEKM
FCSA_DICDI      ---PEDVHMSYLPLAHSFERAVVSLMCYVGGQIGFFSGLIP-ELFNDIQVLRPTFLCGAPRVWQRLHDKL
FAD21_MYCTU     SNYFGDRIVSWLPFYHDMGIAPILGGYRSELTSPLAFLQRPARWLHSLA-NGSPSWSAAPNFAFELATTD
FAD21_MYCBO     SNYFGDRIVSWLPFYHDMGIAPILGGYRSELTSPLAFLQRPARWLHSLA-NGSPSWSAAPNFAFELATTD
ACSA_RHISN      DYHDGDIYWCTADVGWVTGHSYIVYGPLANAATTLM----------------------------------
ACSA_RALEJ      DIKPDDLFWCTADIGWVTGHTYIAYGLAAGATQIIFEYPNAGRFWDMIARHKVSIFYTAPTAIRSLIKAA
ACSA_PRB01      ----------------------------------------------------------------------
ACS2_CANGA      ----------------------------------------------------------------------
S27A4_PONAB     RMRPNDIVYDCLPLYHSAGIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYL--LN
ACSA_PSYCK      DIKEDDVYWCTADVGWVTGHTYATYAPLANGTTTVMEYPTWARIGHIIDKHQITVLYTAPTAMMKEGDTF
ACSA_RALEH      DIKPDDLFWCTADIGWVTGHTYIAYGLAAGATQVVFEYPNAGRFWDMIARHKVSIFYTAPTAIRSLIKAA
S27A4_MOUSE     RMRPDDIVYDCLPLYHSAGIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYL--LN
PRPE_ECOLI      DTIFGGKAGSVFFCASDIGWV-------VGHSYIVYAPLLAG--MATIVYEGLPTWPDCGVWWTQVSRMF
ACSA_SACD2      ----------------------------------------------------------------------
ACSA_RALPJ      DLKPDDIFWCTADIGWVTGHSYIAYGLAAGATQVVFEYPNAGRFWDMIQRHKVNTFYTAPTAIRSLIKAA
S27A4_MACFA     RMRPNDIIYDCLPLYHSAGIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYKCTIVQYIGELCRYL--LN
ACSL1_HUMAN     ENTVNDTLISFLPLA-------------------------------------------------------
ACSA_AGRRK      ----------------------------------------------------------------------
S27A3_HUMAN     GVHQEDVIYLALPLYHMSGLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQYIGELCRYLVNQ-
ACSL3_RAT       PRGEEDVYIGYLPLAHVLELSAELVCLSHGCRI-------------------------------------
ACSA_RHIEC      ----------------------------------------------------------------------
ACSA_RHIE6      ----------------------------------------------------------------------
ACSA_AGRVS      ----------------------------------------------------------------------
FAD11_MYCTU     GIRFGDRVTSFLPSAHIADMTGLYLQEMFGTQXXXXXXXXXXXXXLPDVRPTVWG--AVPRVWEKLQALA
ACSL5_HUMAN     EHTPDDVAISYLPLAHMFERIVQAVVYSCGARVPLKKFLL-KLAVSSKFKELQKGIIRHDSFWDKLIFAK
ACSA_XANCP      ----------------------------------------------------------------------
ACSA_XANC8      ----------------------------------------------------------------------
ACSA_CUPTR      DIKPDDLFWCTADIGWVTGHTYIAYGLAAGATQVVFEYPNAGRFWDMIARHKVSIFYTAPTAIRSLIKAA
ACSA_BRUSU      ----------------------------------------------------------------------
ACSA_BRUSI      ----------------------------------------------------------------------
ACSA_BRUO2      ----------------------------------------------------------------------
ACSA_BRUME      ----------------------------------------------------------------------
ACSA_BRUMB      ----------------------------------------------------------------------
ACSA_BRUC2      ----------------------------------------------------------------------
ACSA_BRUAB      ----------------------------------------------------------------------
ACSA_BRUA2      ----------------------------------------------------------------------
ACSA_BRUA1      ----------------------------------------------------------------------
ACBG2_MOUSE     EINKQNTIVSYLPLSHIA--AQLTDIW-IPIKIGALTFFAQPDALRGTLVYTLTLFMGVPRIWEKMKAFA
BGM_DROME       DRVGAESIVSYLPLSHVAAVDIYTCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRVYVAVASAS
ACSL3_MOUSE     PRGEEDVYIGYLPLAHVLELSAELVCLSHGCRI-------------------------------------
ACSA_SINMW      DYQDGDIYWCTADVGWVTGHSYIVYGPLANAATTLM----------------------------------
VRAA_STAES      QH-CEETIVAPGPLSHSLSLYACIYALSTGKTFIGQKNFNPLSLMRLINQNKATAIFVVPTMVQQLISTQ
S27A4_HUMAN     RMRPNDIVYDCLPLYHSAGIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYL--LN
ACBG2_XENLA     ATDLQEIVVSYLPLSHIAAMIDIWLTMKYGGAT----YFAQPDALKAITLREVTAFMGVPRVWEKMQEMA
S27A2_MOUSE     GITAQDVIYTTMPLYHSAALMGLHGCIVVGATLALRSKFSASQFWDDCRKYNVTVIQYIGELLRYLCNTP
FAD28_MYCBO     ADTDNSALVSWLPFYHDMGLVIGICAPILGGYPAVLSFLQRPARWMHLMASDFHAFSAAPNFAFELAARR
FAD26_MYCTU     GDPAKGTVVSWLPLYHDMGLILGICAPLVARRRAML--MSPMSFLRRPARWATSGFSAAPNFAFELAVRR
ACSA_STRAW      LKPETDVYWCTADIGWVTGHSYITYGLSNGATQVMYEGTPDTPFWEIVQKYGVTILYTAPT--AIRTFMK
ACSA_AGRRH      ----------------------------------------------------------------------
S27A1_RAT       SMRANDVLYDCLPLYHSAGIMGVGQCIIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYL--LR
PRPE_SALTY      DTIFGGKAGGVFFCASDIGWV-------VGHSYIVYAPLLAG--MATIVYEGLPTYPDCGVWWYQVNRMF
MBTM_MYCSS      DITPADTGCSWLPLYHDMGLAFLLTNALGGA---------------ELWQAPTTAFSASPFSWLQTATLT
ACSA_PSEU5      ----------------------------------------------------------------------
ACSB_DICDI      GMKSGDTFFAGSDVGWVVGHTSVYGPLMVGLTSIIFEGTVPSTYWKLIEKHRVNALFSAPT-----AIRA
ACSA_SHEB9      DYKAGEVYWCTADVGWITGHSYMVYGLANGATVLIHEHPSPARLGEMIDRHKVSILYTAPTL--------
ACSA_SHEB8      DYKAGEVYWCTADVGWITGHSYMVYGLANGATVLIHEHPSPARLGEMIDRHKVSILYTAPTL--------
ACSA_SHEB5      DYKAGEVYWCTADVGWITGHSYMVYGLANGATVLIHEHPSPARLGEMIDRHKVSILYTAPTL--------
S27A1_MOUSE     SMRAADVLYDCLPLYHSAGIMGVGQCVIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYL--LR
LCF1_YEAST      GN--TDRVICFLPLAFELVFELL--SFYWGACI---GYATVKTLTSSSVRNCQGDLQEFKPTIMVGVAAV
Y3568_PSEAE     ----------------------------------------------------------------------
ACSL6_MOUSE     EKRQDDVLISFLPLA-------------------------------------------------------
ACSA_OCHA4      ----------------------------------------------------------------------
ACSL6_HUMAN     EKRQDDVLISFLPLA-------------------------------------------------------
VRAA_STAHJ      ENNYEKALAAPGPLAHSLSLYTCIYALYSGRTFIGQRQFDAKRFISILNQHSNIALFLVPTMLHQLLNV-
S27A2_RAT       GIKAHDVIYTTMPLYHSAALMGLHGCIVVGATFALRSKFSASQFWDDCRKYNATVIQYIGELLRYLCNTP
ACSL1_MOUSE     ESSTDDVLISFLPLA-------------------------------------------------------
S27A1_HUMAN     RMQAADVLYDCLPLYHSAGIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYL--LK
S27A1_BOVIN     SMQAADVLYDCLPLYHSAGIMGVGQCLIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYL--LK
FAD25_MYCTU     YGPPGSTVVSWLPFYHDMGFXXXXXXXXXXXXXXXXTSPIPARWIQMLASNTLA-FTAAPNFAFDLASRK
ACS2L_HUMAN     ----------------------------------------------------------------------
LCF3_YEAST      FGGSTDRVLSFLPLA-------------------------------------------------------
ACSL5_RAT       EPTPEDVTISYLPLAHMFERLVQGVIFSCGGKIGFFQRLLPDDM--------------------------
ACSL5_MOUSE     EPTSDDVTISYLPLAH--MFERLVQGFSCGGKIGFFQRLLPDDM--------------------------
ACSL1_RAT       ESSPEDVLISFLPLA-------------------------------------------------------
ACSL1_CAVPO     EKNASDIHISFLPLA-------------------------------------------------------
AACS_CHICK      ENMSSNDIIMYYTTTGWMMWNWLVTALATGASVVLYDPLVPSPNVDLIDRLGITILTGAKWLAVLEEKNL
ACS1_YEAST      ----------------------------------------------------------------------
ACBG2_RAT       ESGKQDTIVSYLPLS-------------------------------------------------------
S27A6_HUMAN     GCTAHDIVYITLPLHSSAAILGISGCVELGATCVLKKKFSASQFWSDCKKYDVTVFQYIGELCRYLCKQS
BGML_DROME      QDVGKESFVSYLPLSHVAAFDVFLGLSHAGCVTFADKDALKGTLIKTFRKARPTKMFGVPRVFEKLQERL
MENE_HAEIN      KFDCNQSWLLSLPLYHVSGQGIVWRWLYCGAQLHFPEDDFYASLLKT------THVSLVPTQLQRLLDLQ
ACSA_MOUSE      DFHPEDVFWCTADIGWITGHSYVTYGLANGATSVLFEGIYPDELWSIVDKYKVTKFYTAPTAIRMLMKFG
ACSL6_RAT       ----------------------------------------------------------------------
AAS_PHOLL       DFNPLDRFMSSLPLFHAFGLTGLFTPLLSGSRIFLYPNPLHYRVVPELVYENCTVLLGTSSFLENYAYSA
ACSS3_HUMAN     ----------------------------------------------------------------------
ACSS3_PONAB     ----------------------------------------------------------------------
ACBG2_HUMAN     LTDKHETVVSYLPLSIAAQMMDIWVPIKIGALTYFAQAALKGTLVSTLKEVKPTVFIGVPQIWEKI----
ACSS3_MOUSE     ----------------------------------------------------------------------
ACSA_CAMJJ      ----------------------------------------------------------------------
ACSA_CAMJE      ----------------------------------------------------------------------
ACSA_CAMJ8      ----------------------------------------------------------------------
FAT1_COCHE      NLKPTDRMYTCMPLYHAAAHSLCTASVIHGGGTVVL----------------------------------
LCF2_YEAST      ----------------------------------------------------------------------
FCSB_DICDI      KVYDTDVHYSYLP---------------------------------------------------------
ACSA_HUMAN      DFHAEDVFWCTADIGWITGHSYVTYGLANGATSVLFE---------------------------------
AACS_RAT        NMTSSDILLYYTTVGW-MMWNWMVSALATGASLVLYDVPTPNVLWDLVDRIGIT-ILGTGAKWLSVLEEM
S27A2_HUMAN     GLKADDVIYITLPFYHSAALIGIHGCIVAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSP
AACS_MOUSE      EHTSSDILLYYTTVGW-MMWNWMVSALATGASLVLYDVPTPNVLWDLVDRIGIT-ILGTGAKWLSVLEEM
FAD21_MYCLE     ----------------------------------------------------------------------
PCL_RHOS4       ----------------------------------------------------------------------
ORA_PLAFN       ----------------------------------------------------------------------
ACSS3_BOVIN     ----------------------------------------------------------------------
MBTM_MYCPA      ----------------------------------------------------------------------
FAT1_YEAST      HMTNESTVFTAMPLFH-------STAALLGACAIL-----------------------------------
ACSA_NOSLI      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WPPEAADTLRYIANTGGRMPKAATTALRRSLPQTKVFLMYGLTEAFRSTYLPPEEVDKRPDSIGKAIPNV
LCFB_BACSU      GKKDDFSSIRLCISGGASMPVALLTAFEEKFGVT-ILEGYGLSEASPVTCFNPFDRGRKPGSIGTSILHV
GRSB_ANEMI      GTEEMFAGLRSLIVGGDALSPKHINNVKRKCPNLTMWNGYGPTETFSTCFLIDKEYDDN-IPIGKAISNS
SRFAB_BACSU     SFAKDAESLRLIVLGGEKIIPTDVIAFRKMYGHTEFINHYGPTEATRVDLYEPDAFAKRP-TIGRPIANA
LGRD_BREPA      YPDLA------VLEVGG--DACSRELVARYATGRKFFNCYGPTEATVGTVIKQLTLDDDTPTIGRPFPNT
LGRC_BREPA      XXXXRTIIV------GGEAPSRELVA--RYATGRQFINCYGPTETTVTATLKHCQDDGKNPPIGRPIANT
GRSB_BREBE      GTEEMFAGLRSLIVGGDALSPKHINNVKRKCPNLTMWNGYGPTETFSTCFLIDKEYDDN-IPIGKAISNS
BACC_BACLI      EQP--LDDLRFVTVAGEGFNESLIRQHFEKLPNVKLFNEYGPTENSVCSTRGELRKDDEKVVIGRPISNH
LGRA_BREPA      EGRTEANRLRYILACGEAMPDELVPKVYEVLPEVKLENIYGPTEAYASRYSLAKGSQESPVPIGKPLPNY
LCFA_SALTY      -EFQQLDFSSLHLSAGGGMPVQNVVA-ERWVKLTGQYLLYGLTECAPLVSVNPHDIDYHSGSIGLPVPST
LCFA_SALTI      -EFQQLDFSSLHLSAGGGMPVQNVVA-ERWVKLTGQYLLYGLTECAPLVSVNPHDIDYHSGSIGLPVPST
LCFA_ECO57      -EFQQLDFSSLHLSAGGGMPVQQVVA-ERWVKLTGQYLLYGLTECAPLVSVNPYDIDYHSGSIGLPVPST
DHBF_BACSU      -EPEKLRGLRVLVG-GEALPSGLLQELQDL--HCSVTNLYGPTETIWSAAAFLEEGLKGVPPIGKPIWNT
LCFA_ECOLI      -EFQQLDFSSLHLSAGGGMPVQQVVA-ERWVKLTGQYLLYGLTECAPLVSVNPYDIDYHSGSIGLPVPST
LCFA_ECOL6      -EFQQLDFSSLHLSAGGGMPVQQVVA-ERWVKLTGQYLLYGLTECAPLVSVNPYDIDYHSGSIGLPVPST
LCFA_BACSU      HHPELQSSIKSCLSGSAALPVEVKQKFEK-VTGGKLVEGYGLSEASPVTHANFIWGKNKPGSIGCPWPST
LCFA_YERPE      FTHLDFSTLRL--SVGGGMPVQKAVAEKETLTGKHLLEGYGLTECSPLVTGNPYDLKHYSGSIGLPVPST
TYCC_BREPA      DNPAMFDSLRALIVGGEALSPKHINRVKSALPDLEIWNGYGPTETFSTCYLIEQHFEEQ-IPIGKPIANS
TYCB_BREPA      --PEQVPSLRTLITAGS----ASSVALVDKWKEKVTYVNYGPTESTVCATLWKAKPDEPVETIGKPIQNT
MYCC_BACSU      QTPSGLASLRYVFASGEALTPKHVDGFQRPVSHAQIINLYGPTEATIDVSYFECEADKRYNSIGKPISNI
PPSD_BACSU      -QPEDVKTLRVVTLAGEAADRELIARSLAICPHTELANEYGPTENSVATTVMRHMEKQAYVSIGQPIDGT
BACA_BACLI      ----DNHSLRTLLTGGDKLNVFKEKSY-------QIVNNYGPTENTVVATSFPIDKSHQNIPIGKPIDNV
LGRB_BREPA      RDQQQESPLRYIFAAGEAMPSELVGKVYEALPGVILENIYGPTESYATKYSLAKDSQDVLVPIGKPLANI
SRFAA_BACSU     --PACLSTLRKIMFGGERASVEHVRKALQTVGKGKLLHMYGPSESVFATYHPVDELEEHTLSIGKPVSNT
GRSA_BREBE      -DPERILSIQTLITAGSATSPSLVNKWKEKVTYINA---YGPTETTATTWVATKETTGHSVPIGAPIQNT
GRSA_ANEMI      -DPERILSIQTLITAGSATSPSLVNKWKEKVTYINA---YGPTETTATTWVATKETIGHSVPIGAPIQNT
DLTA_BACCN      FSESMLPNMKTFLFCGEVLPNEVAKKLMERFPKATIMNTYGPTEAVTSIPVTQEVIDTYQSPVGYCKSDC
PPSC_BACSU      EIERLSDRTSLKRVFAGGEPLAPRTAARFALPQVSLIHGYGPTEATVDAAFPERDRDRLRIPIGKPVPGA
MYCA_BACSU      KIADGTTIRKMIVGGENLSTRLAQSVSEQFKGQLDIFNEYGPTEAVVGIYRYDTKRDRREVPIGSPAANT
ACSF2_MOUSE     -QPDFSSSIRGGVIAGSPAPPELIRAIINKMNMKELVVVYGTTENSPVTFMPEDTLEQKAGSVGRIMPHT
4CLL4_ORYSJ     HPPLPLGQMRKVLSGGAPLGKELIEGFREKYPQVEILQGYGLTESTAGASTDSAEESRRYGTAGLLSPNT
PPSA_BACSU      EIERLSDRTSLKRVFAGGEPLAPRTAARFALPQVSLIHGYGPTEATVDAAFPERDRDRLRIPIGKPVPGA
4CLL6_ARATH     KGGEVFKSLKQVSSGAAPLSRKFIEDFLQTLPHVDLIQGYGMTESTAGTRGFNSEKLSRYSSVGLLAPNM
ACSF2_RAT       -QPDFSSTIRGGVIAGSLAPPELIRAIISKMNMKELVVVYGTTENSPVTFMPEDTLEQKAGSVGRIMPHT
ACSF2_HUMAN     QPDFSSYDISTMCGAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFFPEDTVEQKAESVGRIMPHT
TYCA_BREPA      XXXERITSLRIMITAGSA---SSAPLVNKWKDKLRYINAYGPTETSICATIPSNQLSVQSVPIGKPIQNT
LCFA_HAEIN      NFKEVDFSALKLSVGGGMAIQQSVATRWHELTGCNIIEGYGMTECSPLIAACPINVVKHNGTIGVPVPNT
MBTB_MYCSS      EVGGALPSVRVVPTGGDWVRTEMVRELRRAAPGVRFAGLGGATEAIHNTICEPGELPREWSAVGRPLPNN
ANGR_VIBAN      FNSIAPSKLRLTMLSGDWIGLDLPQRYRNYRVDGQFIAMGGATEAIWSNVFDVEKVPMEWRSIGYPLPRQ
4CL1_TOBAC      VDSYDLSSVRTVMSGAAPLGKELEDAVRTKFPNAKLGQGYGMTEAAMCLAFAKEPFDIKSGACGTVVRNA
4CL2_SOLTU      VHNYDLSSVRTVMSGAAPLGKELEDAVRAKFPNAKLGQGYGMTEAAMCLAFAKEPFDIKSGACGTVVRNA
FADK_ECOLI      KQPADLSALRFFLCGGTTIPKVARECQQRGI---KLLSVYGSTESSPHAVVNLDDLSRFMHTDGYAAAGV
DLTA_BACHK      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACCZ      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACC3      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACC0      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACAH      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
ACVS2_PENCH     QEYDFSDSLNRIILVGENLTEARYLALRQRF-KNRILNEYGFTESAFVTALKDPESTRKDTSLGRPVRNV
ACVS1_PENCH     QEYDFSDSLNRIILVGENLTEARYLALRQRF-KNRILNEYGFTESAFVTALKDPESTRKDTSLGRPVRNV
PPSB_BACSU      MTADDAKSLRIVTFAGEAVTPDLLELNQIICPSAELANEYGPTENSVATTILRHLNKKERITIGHPIRNT
DLTA_BACAN      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACAC      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACAA      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
ACVS_CEPAC      CP-----SLKRMILVGENLTEPRYEALRQRF-KSRILNEYGFTEAFVTALNIFEPTSQRKDSLGRPVRNV
4CL1_SOLTU      VDNYDLSSVRTVMSGAAPLGKELEDAVRAKFPNAKLGQGYGMTEAAMCLAFAKEPFDIKSGACGTVVRNA
4CLL7_ARATH     IVKKDLSSLKYIGSGAAPLGKDLMEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRSGSAGMLAPGV
CAIC_SALAR      TQTPAADDVMFYLNLSVQEKEAFTERFG-----VRLFTSYGMTETIVGIIGDRPGDKRRWPSIGRPGFCY
DLTA_BACC2      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPNATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACCR      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACC4      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
ACSF2_MACFA     FSSYDISTMRGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFFPEDTVEQKAESVGRIMPHT
ACVS_EMENI      CP-----SLKRLILVGENLTESRYLALRRHF-KNCILNEYGFTESAFVTALNVFEPGRNNTSLGRPVRNV
DLTA_BACCQ      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
DLTA_BACC1      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
PKSJ_BACSU      W--ENEESVKILC--GG---EALPETLKRYFLDTEAWNMFGPTETTIWSAVQRINVECSHATIGRPIANT
PPSE_BACSU      ----RADMFRGLHTLGEALSPALMNAVRHACPDLALHNIYGPTETTFSTFFEMKRDYAGPIPIGKPISNS
4CLL9_ARATH     TKKYDLRSLRSLGCGGAPLGKDIAERFKQKFPDVDIVQGYGLTESAASTFGPEEMV--KYGSVGRISENM
BACB_BACLI      FHPQ----MKFI--SGGDVLK--FEYVENIIKGADVYNSYGPTEAVCATYYQLSSADRKKTSIGKPLSNY
DLTA_BACC7      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEAVTGIHVTEEVLNQKSLPVGYCKSDC
CAIC_PROSL      SPDEKQHKLREVMSYLNLADKEKDASIERL--NVRLLTSHGMTETIVGLIGDRPGDKRRWPSIGRPGFCY
DLTA_BACLD      XXXXXXXXXXXFMFCGETLPASVARQLKERFPKARVFNTYGPTEAVTSIEVTDDVLNKYSSPVGSEKPET
ACSF2_PONAB     QPDFSSYDISTMCGAGSPAPPELIRAIINKINMKDLVVAYGTPENSPVTFFPEDTVEQKAESVGRIMPHT
4CL2_ARATH      KSPETLSSVRMVKSGAAPLGKELEDAISAKFPNAKLGQGYGMTEAAMSLGFAKEPFPVKSGACGTVVRNA
MYCB_BACSU      MNAEDFYHVQHVVVGGEKLEPDTVERLFSLQPQIRINNEYGPTESVVSTFQPVYSADEQ-ITIGKPVANH
DLTA_BACWK      FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKAAIMNTYGPTEAVTGIHVTEEVLDQKSLPVGYCKSDC
MENE_BACSU      ETNRCPESIRCIXXXXXXXXXXXXEECRKGFP---VFQSYGMTECSQIVTLSPEFSMEKLGSAGKPLFSC
DLTA_BACA2      FTQELLPEAEVFMFCGEALPAAVAQELLNRFPKARVFNTYGPTEAVTSVEITQQIIDENESPVGFAKPDM
SRFAC_BACSU     --EDWMKGLRCILFGGERASVPHVRKALRIMGPGKLINCYGPTEG--TVFATAHVVHDLPDSIGKPISNA
LUCI_PHOPE      FFPKSALVEKYIASGGAPLSKEIGEMVKKRFKLNFVRQGYGLTETTSAVLITPD-TDVRPGSTGKIVPFH
CAIC_SALSV      APTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_PROMH      SPDEKQHKLREVMFYLNLADEEKDAFIERF--NVRLLTSYGMTETIVGLIGDRPGDKRRWPSIGRPGFCY
MENE_GEOKA      GEARYPDTFRCMXXXXXXXXXXXXEACKKGIP---VYQTYGMTEASQIATLAPEYSLTKLGSAGKPLFPA
CAIC_SALTI      TPTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_SALPB      APTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_SALDC      APTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_SALNS      APTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_SALCH      APTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_SALA4      APTDRQHHLREVMFYLNLSEQEKDDFTERF--GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
ACSF2_BOVIN     FSSYDISTMRGGVIAGSPAPPELIRAIINKLNMKELVVAYGTTENSPVTFMTEDTVEQKAESVGRVMPHT
4CL1_PETCR      VDKYDLSSVRTVMSGAAPLGKELEDAVRAKFPNAKLGQGYGMTEAAMCLAFAKEPYEIKSGACGTVVRNA
DLTA_LACPL      FNAENLPTLTHFLFCGEELTHKTAATLKKRFPDARIFNTYGPTETIEITDAALAQYDRLP--IGYAKADT
CAIC_SALPK      APTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_SALPC      APTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_SALPA      APTDRQHHLRFYLNLSAQEKDAFTERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
4CLL5_ARATH     DQIKALSSMHTVLCGGAPLSKEVTEGFAEKYPTVKILQGYGLTESTGGASTDTVEESRRYGTAGKLSASM
4CL2_PETCR      VDKYDLSSVRTVMSGAAPLGKELEDAVRAKFPNAKLGQGYGMTEAAMCLAFAKEPYEIKSGACGTVVRNA
DLTA_LACCB      FNQDNYPDLTHFLFCGEELVNKTAQELITRFPKATVYNTYGPTEAVTGMAITQDIVDQYPRPIGFAKPDT
DLTA_LACC3      FNQDNYPDLTHFLFCGEELVNKTAQELITRFPKATVYNTYGPTEAVTGMAITQDIVDQYPRPIGFAKPDT
CAIC_CITK8      -PEERQHCLREVMFYLNLSVQEKDAFIARF--GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRPGFCY
MENE_BACLD      KVDRCPGSLRCXXXXXXXXXXXXXEECKRK--RLPVVQSYGMTECSQIATLAPEYSIEKLGSAGKPLFAS
HTS1_COCCA      -DPDAVPTLKALCVAGEPLSMSVVTVWSKRL---NLINMYGPTEATVACIANQVTCTTTTVSIGRGYRAT
DLTA_LISMC      FNQENNPGLIHFLFCGEVLAKKTASELLNRFPDAVIYNTYGPTEAVTQVKVTREVIDAYPSPLGVIKPDM
CAIC_SALTY      APTDRQHHLREVMFYLNLSEQEKDDFTERF--GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
CAIC_SALHS      APTDRQHHLREVMFYLNLSEQEKDDFTERF--GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
DLTA_LISIN      FNQENNPNLTRFLFCGEVLAKKTASELLDRFPDAVIYNTYGPTEAVTQVKVTRELIDAYPSPLGVIKPDM
DLTA_LISW6      FNQENNPNLTRFLFCGEVLAKKTARELLVRFPDAVIYNTYGPTEAVTQVRITAELIDAYPSPLGVIKPDM
CAIC_SALEP      APTDRQHHLREVMFYLNLSEQEKDDFTERF--GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSY
DLTA_LISMH      FNQENNPSLTRFLFCGEVLAKKTATELLDRFPDAVIYNTYGPTEAVTQVKVTRELIEAYPSPLGVIKPDM
DLTA_LISMF      FNQENNPGLIRFLFCGEVLAKKTASELLNRFPDAVIYNTYGPTEAVTQVKVTREVIDAYPSPLGVIKPDM
DLTA_LACRH      FKQENYPNLTHFLFCGEELVNKTAQALITRFPKATVYNTYGPTEAVTGMAITQAIVDQYPRPIGYAKPDT
FAT2_YEAST      -KPNPFPHIRFIRSCSSALAPATFHKLEKEF-NAPVLEAYAMTEAMTSNNLPP---GKRKXXXXXXXXXX
DLTA_LISMO      FNQENNPRLTRFLFCGEVLAKKTASELLDRFPDAVIYNTYGPTEAVTQVKVTREIIDAYPSPLGVIKPDM
BCLA_THAAR      CPKEGELRLRACTSAGEALPEDVG---RRWQARFGVDILDGITEMLH-IFLSNRAGDVHYGTSGKPVPGY
PKSN_BACSU      KRFTEDGPLKYMMVAGEAFPKVLVKKAVSLFTNCRVENIYGPTEAIYAAYFGKGDIASHHTPIGKPVSNT
DLTA_BACSU      DPGFSQDLLPH-ADTGEVLPVSVAKALLERFPKAKIFNTYGPTEATVAVTSVENDVISRSESVGFAKPDM
CAIC_ECO27      DQQHRLREVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGQAGFCY
4CL_VANPL       VDNYDLSSVRTVMSGAAPLGKELEDAVRAKFPNAKLGQGYGMTEAAMCLAFAKEPFDIKSGACGTVVRNA
MENE_BACP2      --EECPSSLRXXXXXXXXXXXMLQESKEKGFP---VFQSYGMTECSQIVTLAPEFSVEKLGSAGKPLFGC
MENE_LISMO      GGSYHPNVRTILLGGGPASKTVLEICKQRDIPLVQSF---GMTEASQIVTLPPKDALNKIGSSGKALFPA
MENE_LISIN      YHP----NVRTVLLGGGPANKAVLEICKRDIPLVQSF---GMTEASQIVTLPPKDALNKIGSSGKALFPA
DLTA_STRPZ      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
DLTA_STRPM      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
DLTA_STRPG      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
DLTA_STRPF      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
DLTA_STRPD      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
DLTA_STRP8      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
CAIC_ECOLU      QPPSANDRVMFYLNLSEQEKDAFCERF-----SVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
4CLL3_ORYSJ     XXXSQVASLVQVSCGAAPITAALIHEFLQAFPHVDFIQGYGMTESTAGTRGFNTSKHKKYTSVGLLAPNM
DLTA_STRPC      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
DLTA_STRP6      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
DLTA_STRP3      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
DLTA_STRP1      DMAMLSDALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTEALSAIEITREMVDNYTRPIGYPKPDS
MENE_BACA2      ETEQCPESLRCIXXXXXXXXXXXXEECRRK--QFPVFQSYGLTECSQIVTLSPEFSMDKLGSAGKPLFSC
CAIC_SHISS      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECO5E      QPPSANDRLREVMFYLNLSEQEKDTFCERF--GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECO57      QPPSANDRLREVMFYLNLSEQEKDTFCERF--GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECO45      QPPSANDRVMFYLNLSEQEKDAFCERFGVSL-----LTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
ACVS_NOCLA      ---RRCASLKRLLLVGEELTASGLRQLREKFAG-RVVNEYAFTEAAFVTAVKPGVTERRDRSIGRPLRNV
MENE_GEOSW      GERRYPETFRCMXXXXXXXXXXXXEVCKKGIP---VYQTYGMTEASQIATLAPEYSLTKLGSAGKPLFPS
CAIC_ECOSM      QPPSANDQVMFYLNLSAQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECOSE      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECO55      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPSDKRRWPSIGRAGFCY
4CL2_TOBAC      MVDDDLSSVRTVMSGAAPLGKELEDTVRAKFPNAKLGQGYGMTEAAMCLAFAKEPFEIKSGACGTVVRNA
MENE_LISMF      YHP----NVRTVLLGGGPASKAVLEICKRDIPLVQSF---GMTEASQIVTLPPKDALNKIGSSGKALFPA
CAIC_ECOUT      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECOK1      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECO8A      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
MENE_BACC7      GAETYPSSLRCMLLGGGPAPKILETCVEKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
CAIC_ECOHS      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
ACSM5_RAT       LTRYKFQCLRHCL-AGGEALNSDVRDKWKNQTGLEIHEGYGQSETFRGSTI-------KSGSMGKASPPY
CAIC_ECO7I      QPPSANDEVMFYLNLSAQEKDAFCERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
4CLL6_ORYSJ     DEARRRDLSSLVAIVVGGAPLGREVSQRFAFPSVQIVQSYGLTESTGATMAGPEE-SAAYGSVGRLAPRV
ACSM1_BOVIN     YTSLRFPTLEHCCTGGEALLPEEQEQWKR---QTGVLLYYGQSETGISCGTL-RGMKIKPGSMGKAIPPF
FAT2_SCHPO      XXXXXXXXXXXXXSCSSPLAPPVLSKLEATF-RAPVLEAYAMTEAHQMTTNPLPPLVHKPHSVGKPF-GV
CAIC_ESCF3      QPPSVNDRQHHLREVMFNLSEQEKDAFCERFG-VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECO81      QPPSANDQVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECO24      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
4CL_PINTA       VSQYDVSSVRIIMSGAAPLGKELEDALRERFPKAIFGQGYGMTEAAMNLAFAKNPFPVKSGSCGTVVRNA
CAIC_SHIDS      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRLGDKRRWPSIGRAGFCY
CAIC_ECOL6      DQQHRLREVMFYLNLSEQEKDAFCERF-----SVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
CAIC_ECOL5      DQQHRLREVMFYLNLSEQEKDAFCERF-----SVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCY
4CLL1_ORYSJ     KAGKDLSSLKFIGSGAAPLGKDVMEVVAKKFPDSEIVQGYGMTEGIISLEYPEKGQAREFGSTGTLVSGV
CAIC_SHIFL      QPPSANDRVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPSDKRRWPSIGRAGFCY
4CLL2_ORYSJ     NPPLELDSLLQVSSGAAPLNHTLIHHFLHAFPHVDFIQGYGMTE---STAVGTRGFNKKYASVGLLAPNM
CAIC_ECOLC      QPPSANDQVMFYLNLSEQEKDAFCERFG-----VRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCY
4CL3_ARATH      VNSYDLSSVRFVLSGAAPLGKELQDSLRRRLPQAILGQGYGMTEASMSLGFAKEPIPTKSGSCGTVVRNA
MENE_BACC1      GAETYPSSLRCMXXXXXXXXXXXETCVEKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
ACVS_STRCL      FDXXXXXXXXXXXXVGEELTAAGLRQLRERF-SGRIVNEYAFTEAAFVTAVKPGVTERADRSIGRPVRNV
4CL4_ORYSJ      -PRVTADSIRMVMSGAAPMGKDLQDAFMAKIPNAVLGQGYGMTEAAMCLAFAKEPFEVKSGSCGTVVRNA
MENE_BACCR      GAETYPSSLRCMXXXXXXXXXXXXEAVEKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
LUCI_LUCCR      LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK-PGASGKVVPLF
ACSM3_MOUSE     MSSYKFNSLKHCVSAGEPINPEVMEQWRKKTG-LDIYEGYGQTETFKGMKI-------KPGSMGKPSPAF
4CLL2_ARATH     NEINSLSSLHTVVAGGAPLSREVTEKFVENYPKVKILQGYGLTEAIAASMFNKEET-KRYGASGLLAPNV
ACSF3_HUMAN     TQPHAQDFLRAVCEEKIRLMVSGSAALPKNITGHTLLERYGMTEIGMALSGPLTTAVRLPGSVGTPLPGV
MENE_BACWK      GEGTYPSSLRCMXXXXXXXXXXXETCVEKGIP---VYQTYGMTESSQICTLTADYMLTKVGSAGKPLFQC
DLTA_STRA5      FNSETLPQLTHFYFDGEELTVKTAQKLRQRFPKARIVNAYGPTEALSAVAITDEMLETKRLPIGYTKDDS
DLTA_STRA3      FNSETLPQLTHFYFDGEELTVKTAQKLRQRFPKARIVNAYGPTEALSAVAITDEMLETKRLPIGYTKDDS
DLTA_STRA1      FNSETLPQLTHFYFDGEELTVKTAQKLRQRFPKARIVNAYGPTEALSAVAITDEMLETKRLPIGYTKDDS
ACSF2_DANRE     QPDLAKFDLSSVRGAGSPCPPEVMRKILNVMGIKEMVIGYGTTENSPVTFFPVDSAERKIVTVGCISPHT
CAIC_ECOLI      QPPSANDEVMFYLNLSEQEKDAFCERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCY
CAIC_ECODH      QPPSANDEVMFYLNLSEQEKDAFCERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCY
CAIC_ECOBW      QPPSANDEVMFYLNLSEQEKDAFCERF-----GVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCY
MENE_BACCZ      GEETYPPSLRCMXXXXXXXXXXXXEAVEKRIP---VYQTYGMTESSQICTLSADYMLMKVGSAGKPLFQC
ENTF_ECO57      TPQTARQTLKQVFCSGEALP-ADLCREWQQLTGAPLHNLYGPTEAAVDVSWYPAFGEELAQVRGSSVPNT
MENE_BACAH      GEGTYPSSLRCMXXXXXXXXXXXETCVDKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
LUCI_PHOPY      IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDK-PGAVGKVVPFF
4CLL7_ORYSJ     CRLPA---LERITCGGAPLPAPAIERFRRRFPHVDLCMGYGSTEAGGISRMISQEECNHIGSAGRVTENV
3HBCL_THAAR     AGESAARDIRHFVSAGEKLPENIGQ-------QWLDTFGIPITEGIGASETVFLFLCARPDSCGKRVPWA
MENE_BACHK      GEGTYPSSLRCMXXXXXXXXXXXETCVDKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
MENE_BACCQ      GAETYPSSLRCMXXXXXXXXXXXETCVEKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
MENE_BACC0      GEGTYPSSLRCMXXXXXXXXXXXETCVDKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
MBTB_MYCPA      XXXXXXXXXXXXXPTGGDWVREVVRRLRAEAPGLRFAGLGGATETFEVTEPIPADWTALP--FGVPLPNN
DLTA_STRE4      FCQEKMPRLTHFYFDGEELTVSTARKLFERFPDARIINAYGPTEAISITKDMIETYTRLP--IGYPKPDS
YDAB_BACSU      WEKHQTDSSLVILMTGGT--KVPSSLISRYLDGIPLAHGYGSTEAWGSTWTPDMGMDXXXXXXXXXXXXX
DLTA_STRMU      FNAQQLPHLTHFYFDGEELTVKTAKKLRQRFPQARIVNAYGPTEALAVTDKMLETCKRLP--IGYTKPDS
ACSM1_MOUSE     TSNLRFPTLEH-CTTGGESLLPEEYEQWKQRTGLSIHEVYGQSETGISSATLREMKIKR-GSIGKAILPF
4CL3_DICDI      IVDKFLSSLRTLFCGAAPLGSEIEDLIKERFKGRLVIKQYGATELSPCCFVTPNGLVKSGSS-GTLLPNL
MENE_BACCN      GNETYPSSLRCMXXXXXXXXXXXXEAVQKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFPC
ACSM5_MOUSE     LTRYKFQCLRHCL-TGGEALNPDVRDKWKSQTGLELHEGYGQSETVVICGNSRNSTIKS-GSMGKASPPY
MENE_BACAN      GEGTYPSSFRCMXXXXXXXXXXXETCVDKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
MENE_BACAC      GEGTYPSSFRCMXXXXXXXXXXXETCVDKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
MENE_BACAA      GEGTYPSSFRCMXXXXXXXXXXXETCVDKGIP---VYQTYGMTESSQICTLSADYMLTKVGSAGKPLFQC
LUCI_LUCLA      LDKYDLSNLVEIASGGAPLSKEIGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK-PGASGKVVPLF
HMWP2_YERE8     WCEGFADNLRAVMLSGDWIGLDLPARYRAFRPQGQFIAMGGATEAIWSNACEIHDVPAHWRSIGFPLTNQ
ACS2B_HUMAN     FP--------HLQNAGGESLLPETLENWRAQTGLDIREFYGQTET-GLTCMVSKTMKIKPGYMGTAASCY
4CL1_DICDI      IVDKFLSSLRTLFSGAAPLSSEVEDLIKERFKGRLVIKQYGATELSPACFVIPSGLVKS-GSAGILLPNQ
ACSA_PSEA6      FPTESGESLRLLGSVGEPINPEAWHWYYTTVGQSRCPIVWWQTETGAAMLTPPSVTAMKPGAASH--PFF
4HBCL_RHOPA     DPRSRTETLRLCVSAGEPLPAQVGLNWRNRFG-------HDIVNGVGSTEMGHLFLTNLPHAVGVPVDGY
DLTA_STAHJ      NLNESSPSLNHFFFCGEILPHRTAKALLDRYPSAVVYNTYGPTEAVTGIKLTPEVIEANPLPVGVSRPNT
ACSM3_RAT       ITSYKFNSLKHCVSAGEPINPEVMEQWKKKTG-LDIYEGYGQTETFKGMKI-------KPGSMGKPSPAF
LUCI_LUCMI      IDKFDLSNLTEIASGGAPLAKEVGEAVARRFNLPGVRQGYGLTETTSAFIITPEGDDK-PGASGKVVPLF
ENTF_ECOLI      TPQTARQTLKQVFCSG