[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58524.1

[Show Plain Result]


## Summary of Sequence Search
    1::100
   67::109     1e-04  35%  697 aa  MED16_XENLA RecName: Full=Mediator of RNA polymerase II
   66::109     2e-04  32%  828 aa  MED16_MOUSE RecName: Full=Mediator of RNA polymerase II
   67::109     3e-04  33%  828 aa  MED16_XENTR RecName: Full=Mediator of RNA polymerase II
    1::100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAGHDLARKALGWVSPSTRITSPPTEGRSRYWQRENHS
MED16_XENLA     ---------------------------------SGHQEVITCLEWDQSGSRLLSADADGRIKCWGMTDHL
MED16_MOUSE     ---------------------------------SGHSEAITCLEWDQSGSRLLSADADGQIKCWSMADHL
MED16_XENTR     ---------------------------------SGHQEVITSLEWDQSGSRLLSADADGRIKCWGMTDHL


                         .         .         *         .         .         .         .:140
query           ANSWKNAxxxxxxxxxxxxxxxxxxxxxxx
MED16_XENLA     ANSWQN------------------------
MED16_MOUSE     ANSWESS-----------------------
MED16_XENTR     ANSWQS------------------------