[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58618.1

[Show Plain Result]


## Summary of Sequence Search
    1::690
   51::692     e-159  53%  696 aa  FLHA_PROMI RecName: Full=Flagellar biosynthesis protein flhA;
   51::690     e-159  55%  692 aa  FLHA_YEREN RecName: Full=Flagellar biosynthesis protein flhA;
   48::695     e-146  49%  696 aa  FLHA_BUCAI RecName: Full=Flagellar biosynthesis protein flhA;
   48::690     e-146  53%  692 aa  FLHA_ECOLI RecName: Full=Flagellar biosynthesis protein flhA;
   48::695     e-142  46%  695 aa  FLHA_BUCAP RecName: Full=Flagellar biosynthesis protein flhA;
   48::690     e-141  52%  692 aa  FLHA_SALTY RecName: Full=Flagellar biosynthesis protein flhA;
   50::675     e-124  46%  678 aa  FLHA_AQUAE RecName: Full=Flagellar biosynthesis protein flhA;
   68::729     e-121  42%  733 aa  FLHA_HELPY RecName: Full=Flagellar biosynthesis protein flhA;
   68::729     e-117  42%  733 aa  FLHA_HELPJ RecName: Full=Flagellar biosynthesis protein flhA;
   48::697     e-117  47%  702 aa  FLHA_BUCBP RecName: Full=Flagellar biosynthesis protein flhA;
   53::675     e-106  44%  677 aa  FLHA_BACSU RecName: Full=Flagellar biosynthesis protein flhA;
   68::700     e-103  43%  700 aa  FLHA_CAUCR RecName: Full=Flagellar biosynthesis protein flhA;
   19::578     3e-98  38%  579 aa  FHIA_ECOLI RecName: Full=Putative protein fhiA;
   63::693     1e-91  38%  697 aa  FLHA_BORBU RecName: Full=Flagellar biosynthesis protein flhA;
   58::693     2e-82  34%  707 aa  FLHA_TREPA RecName: Full=Flagellar biosynthesis protein flhA;
   75::722     2e-77  33%  723 aa  FLHA_BRUME RecName: Full=Flagellar biosynthesis protein flhA;
   50::677     2e-71  33%  695 aa  HRPI_PSESY RecName: Full=Hypersensitivity response secretion
   50::692     4e-68  30%  715 aa  HRPI_ERWAM RecName: Full=Harpin secretion protein hrpI;
   57::685     3e-67  39%  685 aa  INVA_SALTY RecName: Full=Invasion protein invA;
   57::685     3e-67  39%  685 aa  INVA_SALTI RecName: Full=Invasion protein invA;
   57::686     2e-66  31%  686 aa  MXIA_SHISO RecName: Full=Protein mxiA;AltName: Full=Protein virH;
   57::686     2e-66  31%  686 aa  MXIA_SHIFL RecName: Full=Protein mxiA;AltName: Full=Protein virH;
   46::675     9e-62  35%  697 aa  Y4YR_RHISN RecName: Full=Probable translocation protein y4yR;
   81::676     6e-61  31%  690 aa  HRCV_RALSO RecName: Full=Hypersensitivity response secretion
   59::697     3e-60  30%  704 aa  LCRD_YERPS RecName: Full=Low calcium response locus protein D;
   59::697     3e-60  30%  704 aa  LCRD_YERPE RecName: Full=Low calcium response locus protein D;
   59::702     9e-60  30%  704 aa  LCRD_YEREN RecName: Full=Low calcium response locus protein D;
   59::702     9e-60  30%  704 aa  LCRD_YERE8 RecName: Full=Low calcium response locus protein D;
   51::669     1e-54  38%  681 aa  SSAV_SALTY RecName: Full=Secretion system apparatus protein ssaV;
   85::643     3e-51  33%  645 aa  HRC2_XANEU RecName: Full=Protein hrpC2;
    1::690

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFTFNISXXXXXXXXGVYARRPLDFSSF
FLHA_PROMI      ----------------------------------------------NIALSIMVLLVAMFTRRTLDFAAF
FLHA_YEREN      ----------------------------------------------NIALSIMVLLVAMFTQRTLDFAAF
FLHA_BUCAI      -------------------------------------------FTFNIALSIIILLVSMFTRHTLEFTAF
FLHA_ECOLI      -------------------------------------------FTFNIALSIMVLLVAMFTQRTLEXXXX
FLHA_BUCAP      -------------------------------------------FTFNIALSIIILLVSMFTRHTLDFAAF
FLHA_SALTY      -------------------------------------------FTFNIALSIMVLLVAMFTQRTLDXXXX
FLHA_AQUAE      -------------------------------------------------------------KNPLEFSSF
FLHA_HELPY      -----------------------------------------------------------YIDKPTDFSAF
FLHA_HELPJ      -----------------------------------------------------------YIDKPTDFSAF
FLHA_BUCBP      -------------------------------------------FTFNIALSIVVLLMSMFTTKTLEFTSF
FLHA_BACSU      ----------------------------------------------------------------LQFSIF
FLHA_CAUCR      ----------------------------------------------------------ILIKKPLEFTSF
FHIA_ECOLI      ----------------------------------------------------------------------
FLHA_BORBU      -----------------------------------------------------------YSKRSLDFSVF
FLHA_TREPA      --------------------------------------------------------------KPTDFSVF
FLHA_BRUME      ---------------------------------------------FSIAFSVLILMVALWIQRPLDFSAF
HRPI_PSESY      ----------------------------------------------NICISCLLIMLAMHLPRPLAFSTF
HRPI_ERWAM      ----------------------------------------------NICISSLLIVLAMYLPKPLAFSTF
INVA_SALTY      -----------------------------------------------------------YIDRILSFSTF
INVA_SALTI      -----------------------------------------------------------YIDRILSFSTF
MXIA_SHISO      -----------------------------------------------------------YIERILSFSTF
MXIA_SHIFL      -----------------------------------------------------------YIERILSFSTF
Y4YR_RHISN      ---------------------------------------------FNMGXXXXXXXXXXYVSTPLDFSSL
HRCV_RALSO      ----------------------------------------------------------------------
LCRD_YERPS      ----------------------------------------------------------IYINSPLQFSAF
LCRD_YERPE      ----------------------------------------------------------IYINSPLQFSAF
LCRD_YEREN      ----------------------------------------------------------IYINSPLQFSAF
LCRD_YERE8      ----------------------------------------------------------IYINSPLQFSAF
SSAV_SALTY      --------------------------------------------TINLMFSVILLLIAIYLSDPLDLSVF
HRC2_XANEU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PTIXXXXXXXXXXXNVASTRVVLLEGHTGSDAAGKVIQAFGEFVIGGNYAXXXXXXXXXXXXXXXXXTKG
FLHA_PROMI      PXXXXXXXXXXXXXNVASTRIILMEGHTGSAAAGRVVEAFGHFLVGGNXXXXXXXXXXXXXXXXXXXTKG
FLHA_YEREN      PTIXXXXXXXXXXXNVASTRIILMDGHTGAAAAGRVVEAFGHFLVGGNXXXXXXXXXXXXXXXXXXXTKG
FLHA_BUCAI      PTILLFSTLLRLALNVASTRVIFLRGHTGTNSAGRVIESFGHFLVGGNXXXXXXXXXXXXXXXXXXXTKG
FLHA_ECOLI      XXXXXXXXXXXXXXNVASTRIILMEGHTGAAAAGKVVEAFGHFLVGGNXXXXXXXXXXXXXXXXXXXTKG
FLHA_BUCAP      PTILLFSTLLRLALNVASTRVIFLNGHNGTHSAGRVIESFGHFLVGGNXXXXXXXXXXXXXXXXXXXTKG
FLHA_SALTY      XXXXXXXXXXXXXXNVASTRIILMEGHTGAAAAGKVVEAFGHFLVGGNXXXXXXXXXXXXXXXXXXXTKG
FLHA_AQUAE      PSVXXXXXXXXXXXNIAAARRILLHGHEGTHAAGKVIEAFGKLVAGGDXXXXXXXXXXXXXXXXXXXTKG
FLHA_HELPY      PTLLLIVTLYRLALNVATTRMILTQGYKGPSAVSDIITAFGEFSVSGNYVIGAIIFSIXXXXXXXXXTNG
FLHA_HELPJ      PTLLLIVTLYRLALNVATTRMILTQGYKGPSAVSDIITAFGEFSVSGNYVIGAIIFSIXXXXXXXXXTNG
FLHA_BUCBP      PTILLFSTLLRLALNIASTRIILLNGHIGSCSAGNVIQAFGHFLXXXXXXXXXXXXXXXXXXXXXXXXKG
FLHA_BACSU      PSXXXXXXXXXXXXNVSTTRSILSHGE-----GGKVVETXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKG
FLHA_CAUCR      PTVLLVTTLFRLGLNIASTRLILSHGQEGTGGAGAVIEAFGHLMMQGNXXXXXXXXXXXXXXXXXXXTKG
FHIA_ECOLI      -------------------------------------------------------------------TKG
FLHA_BORBU      PTLLLVMTIFGLVLNISSTRLILTKG---INFDGQMIRTFGTFVVGSSXXXXXXXXXXXXXXXXXXXTKG
FLHA_TREPA      PSLLLTSTVFGLGLNVSSTRLILTLGDRFS---GYMIRAFSSFVVGGSLVIGFTVFIILIAVQAFVITKG
FLHA_BRUME      PTVLLIATMMRLSLNIATTRVILTHGNEGYLAAGHVIHGFSQFVMGGDFVIGLVVFAILIIVNFLVITKG
HRPI_PSESY      PAVLLLTTMFRLALSVSTTRLILL-----NQDAGHIVEAFGQFVVGGNLAVGLVIFLILTVVNFLVITKG
HRPI_ERWAM      PSVLLLTTMFRLALSISTTRQILLQ-----QDAGHIVEAFGNFVVGGNLAVGLVIFLILTVVNFLVITKG
INVA_SALTY      PAVLLITTLFRLALSISTSRLILIEAD-----AGEIIATFGQFVIGDSLAXXXXXXXXXXXXXXXXXTKG
INVA_SALTI      PAVLLITTLFRLALSISTSRLILIEAD-----AGEIIATFGQFVIGDSLAXXXXXXXXXXXXXXXXXTKG
MXIA_SHISO      PSVLLITTLFRLALSISTSRLILVDAD-----AGKIITTFGQFVIGDSLAVGFVIFSIVTVVQFIVITKG
MXIA_SHIFL      PSVLLITTLFRLALSISTSRLILVDAD-----AGKIITTFGQFVIGDSLAVGFVIFSIVTVVQFIVITKG
Y4YR_RHISN      PGVILLSTVFRLALTVATTRLILAEGEAGS-----IIHTFGSFVISGNIVVGFVIFLVVTMVQFMVLAKG
HRCV_RALSO      --------------NIASTKSILLHAD-----AGHIIESFXXXXXXXXXXXXXXXXXIITTVQFIVIAKG
LCRD_YERPS      PAVLLVTTLFRLALSVSTTRMILLQAD-----AGQIVYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKG
LCRD_YERPE      PAVLLVTTLFRLALSVSTTRMILLQAD-----AGQIVYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKG
LCRD_YEREN      PAVLLVTTLFRLALSVSTTRMILLQAD-----AGQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKG
LCRD_YERE8      PAVLLVTTLFRLALSVSTTRMILLQAD-----AGQIVYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKG
SSAV_SALTY      PXXXXXXXXXXXXXXXXXXXXXXXQHN-----AGNIVDAFGKXXXXXXXXXXXXXXXXXXXXXXXXXXKG
HRC2_XANEU      --------------NIASTKSILLHAE-----AGHIIESFXXXXXXXXXXXXXXXXXIITTVQFIVIAKG


                         +         .         .         .         .         *         .:210
query           ATRISEVSARFTLDAMPGKQMAIDADLNAGLIDQEEARLRREEVMQEADFYGSMDGAGKFVRXXXXXXXX
FLHA_PROMI      AGRIAEVGARFVLDGMPGKQMAIDADLNAGIINEEEAKKRRKEVSLESDFYGSMDGASKFVRGDAIAXXX
FLHA_YEREN      AGRIAEVGARFVLDGMPGKQMAIDADLNAGLIGEDEAKKRRSDVTQEADFYGSMDGASKFVRGDAVAXXX
FLHA_BUCAI      ASRIAEVGARFILDAMPGKQMAIDADLNAGLIGEEKAKKRRIKITQEADFYGSMDGASKFVRGDAIAGIL
FLHA_ECOLI      AGRIAEVGARFVLDGMPGKQMAIDADLNAGLIGEDEAKKRRSEVTQEADFYGSMDGASKFVRGDAIAXXX
FLHA_BUCAP      SGRIAEVGARFILDAMPGKQMAIDADLNAGLIGEEEAKKRRLKITKEADFYGSMDGASKFVRGDAIAGIL
FLHA_SALTY      AGRIAEVGARFVLDGMPGKQMAIDADLNAGLIGEDEAKKRRSEVTQEADFYGSMDGASKFVRGDAIAXXX
FLHA_AQUAE      AERISEVAARFTLDALPGKQMSIDADLNAGLITEEEAKRRRQELEKEANFYAAMDGASKFIRGDXXXXXX
FLHA_HELPY      STRVTEVRARFALDAMPGKQMAIDADLNSGLIDDKEAKKRRAALSQEADFYGAMDGASKFVKGDAXXXXX
FLHA_HELPJ      STRVTEVRARFALDAMPGKQMAIDADLNSGLIDDKEAKKRRAALSQEADFYGAMDGASKFVKGDAXXXXX
FLHA_BUCBP      ASRIAEVGARFTLDGMPGKQMAIDADLNAGLIGEKQAKKRRIEINQEADFYGSMDGASKFVRGDXXXXXX
FLHA_BACSU      AERVSEVAARFTLDAMPGKQMSIDADLNAGMITEQEAKHRREKVAREADFYGAMDGASKFVKGDXXXXXX
FLHA_CAUCR      SGRIAEVAARFTLDSMPGKQMAIDADLSTGLISQDEAKIRRKELEQESTFFGAMDGASKFVKGDXXXXXX
FHIA_ECOLI      AERISEVSARFTLDAMPGKQMAIDADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMM
FLHA_BORBU      ATRVAEVAARFALDALPGKQMAIDSAYSSGNLTEEEATRQKNDLQSEVNFYGAMDGASKFVSGNVKVGFX
FLHA_TREPA      ATRIAEVAARFTLDFNATKSMSIDAEYNAGVITEEEARERKRQIQREADFFGAMDGASKFVSGNVKIGIF
FLHA_BRUME      ATRIAEVGARFTLDAIPGKQMAIDADLSSGLIDXXXXXXXXXXXXXXSSFFGSMDGASKFVRGDAIAGLI
HRPI_PSESY      SERVAEVGARFTLDAMPGKQMSIDSDLRANLITVHEARKRRAELNKESQLFGAMDGAMKFVNGDAIASLI
HRPI_ERWAM      SERVAEVAARFTLDAMPGKQMSIDSDLRAGLIEAHQARQRRENLAKESQLFGAMDGAMKFVKGDAIAGLV
INVA_SALTY      SERVAEVAARFSLDGMPGKQMSIDADLKAGIIDADAARERRSVLERESQLYGSFDGAMKFXXXXXXXXXX
INVA_SALTI      SERVAEVAARFSLDGMPGKQMSIDADLKAGIIDADAARERRSVLERESQLYGSFDGAMKFXXXXXXXXXX
MXIA_SHISO      SERVAEVAARFSLDGMPGKQMSIDADLKAGIIDAAGAKERRSILERESQLYGSFDGAMKFXXXXXXXXXX
MXIA_SHIFL      SERVAEVAARFSLDGMPGKQMSIDADLKAGIIDAAGAKERRSILERESQLYGSFDGAMKFXXXXXXXXXX
Y4YR_RHISN      AERVAEVAARFTLDALPGKQMAIDAELRNGHIDADESRRRRAALEKESKLYGAMDGAMKFVKGDSIAGLV
HRCV_RALSO      SERVAEVGARFTLDAMPGKQMSIDADLRAGHLSPEEARKRRALLAMESQLHGGMDGAMKFVKGDAIAGLV
LCRD_YERPS      SERVAEVSARFSLDAMPGKQMSIDGDMRAGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLI
LCRD_YERPE      SERVAEVSARFSLDAMPGKQMSIDGDMRAGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLI
LCRD_YEREN      SERVAEVSARFSLDAMPGKQMSIDGDMRAGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLI
LCRD_YERE8      SERVAEVSARFSLDAMPGKQMSIDGDMRAGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLI
SSAV_SALTY      IERVAEVSARFSLDGMPGKQMSIDGDLRAGVIDADHARTLRQHVQQESRFLGAMDGAMKFVKGDTXXXXX
HRC2_XANEU      SERVAEVGARFTLDAMPGKQMSIDADLRGGNLTADEARRKRARLAMESQLHGGMDGAMKFVKGDAIAGLV


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXVGLLQHDLSFSEAARNYTLLTIGDGLVAQIPSLVLSTAAGILVTRVSHAQDMGSQILAQ
FLHA_PROMI      XXXXXXXXXXXXXXAQHNMALNDAASTYTLLTIGDGLVAQIPALIISTAAGVIVTRVATDEDVGQQMVTQ
FLHA_YEREN      XXXXXXXXXXXXXXXQHNMAVGHAAETYTLLTIGDGLVAQIPALVISTAAGVIVTRVSTDQDVGQQMVTQ
FLHA_BUCAI      IMVINIFXXXXXXXXQHHMFLNKAVEVYTLLTIGDGLVAQIPALVISTAAGVIVTRVSSNQNVGEQMASQ
FLHA_ECOLI      XXXXXXXXXXXXXXXQHGMSMGHAAESYTLLTIGDGLVAQIPALVISTAAGVIVTRVSTDQDVGEQMVNQ
FLHA_BUCAP      IMVLNIFGGLIIGFFQHNMLLGKAAEVYTLLTIGDGLVAQIPALVISTAAGVIVTRVSTNQNVGEQMISQ
FLHA_SALTY      XXXXXXXXXXXXXXXQHGMSIGSAAESYTLLTIGDGLVAQIPALVISTAAGVIVTRVSTDQDVGEQMVGQ
FLHA_AQUAE      XXXXXXXXXXXXXXXXXXXXXASAVKTYTILSIGEGLASQVPALLLSTAAGVLTTKMSSRENLGEAISEE
FLHA_HELPY      XXXXXXXGGFLVGVFQRDMSLSFSASTFTILTIGDGLVGQIPALIIATATGIVATRTTQEEDFASKLITQ
FLHA_HELPJ      XXXXXXXGGFLVGVFQRDMSLSFSASTFTILTIGDGLVGQIPALIIATATGIVATRTTQEEDFASKLITQ
FLHA_BUCBP      XXXXXXXXXXXXXXLQHNMTFSQAAQVYTILTIGDGLVAQIPALVVSTASGVIVTRVSTDQNVSEQIVSQ
FLHA_BACSU      XXXXXXXXXXXXXXLQQGMSIQEAASHFTMLTVGDGIVSQIPALLISTATGIVVTRAASEGNLGHDITGQ
FLHA_CAUCR      XXXXXXXXXXXXXVVQHKMPFGDAASTYTIMTIGDGLVSQIPALIISIAAGMVVSKAGVEGSADKALTTQ
FHIA_ECOLI      ILAINLIGGVCIGIFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRNQ
FLHA_BORBU      XXXXXXXXXXXXXXXXXXXNFNEALNNYVSLTVGDGLVSQLPSLLISTSTGLIVTRSISKNSFGGEIFDQ
FLHA_TREPA      ITIVNVIAGLIVGVIFRREGFQAALQTYTNLTIGDGXXXXXXXXXXSVATGFIVTRSSDQGSFGQNVQEQ
FLHA_BRUME      ITAVNIFGGIVIGATRHGMDISQAADVFTKLSVGDGLVTQIPALIVSLAAGLLVSKGGTRGSADQAIFGQ
HRPI_PSESY      IVAINMIGGISIGVLQHNMAAGDALQLYTVLTIGDGLIAQIPALLISVTSGMIITRVPNTENIGREIAEQ
HRPI_ERWAM      IVFINMIGGFAIGVLQNGMEAGAAMHIYSVLTIGDGLIAQIPALLISLTAGMIITRVSADANIGREIAEQ
INVA_SALTY      XXXXXXXXXXXXXMTRHGMDLSSALSTYTMLTIGDGLVAQIPALLIAISAGFIVTRVNGDSDMGRNIMTQ
INVA_SALTI      XXXXXXXXXXXXXMTRHGMDLSSALSTYTMLTIGDGLVAQIPALLIAISAGFIVTRVNGDSDMGRNIMTQ
MXIA_SHISO      XXXXXXXXXXSVGMSQHGMSLSGALSTYTILTIGDGLVSQIPALLISISAGFIVTRVNGDSDMGRNIMSQ
MXIA_SHIFL      XXXXXXXXXXSVGMSQHGMSLSGALSTYTILTIGDGLVSQIPALLISISAGFIVTRVNGDSDMGRNIMSQ
Y4YR_RHISN      VICINMXXXXXXXXXXKGMSFAQVLHHYTLLTIGDALISQIPALLLSITAATMVTRVTGASNLGEDIANQ
HRCV_RALSO      ITLVNILAGIVIGITYHNMTAGEAANRFAVLSIGDAMVSQIPSLLISVAAGVMITRVSHKQSLGMEIVRQ
LCRD_YERPS      IIFVNILGGVTIGVTQKGLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSDSSDLGSDIGKQ
LCRD_YERPE      IIFVNILGGVTIGVTQKGLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSDSSDLGSDIGKQ
LCRD_YEREN      IIFVNILGGVTIGVTQKGLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSDSSDLGSDIGKQ
LCRD_YERE8      IIFVNILGGVTIGVTQKGLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSDSSDLGSDIGKQ
SSAV_SALTY      XXXXXXXXXXXXXXXQYDMSMSEAVHTYSVLSIGDGLCGQIPSLLISLSAGIIVTRVEKRQNLATELSSQ
HRC2_XANEU      ITMVNILAGIVVGVTYHGMTAGDAANRFAILSVGDAMVSQIASLLISVAAGVMITRVANENELGLDIGRQ


                         .         *         .         .         .         .         +:350
query           LFKNPKSLAVVAVVLGSMGLIPGMPNXXXXXXXXXXXXXVWWLGKRQKAEVAPTPPMAAPSETPELSWED
FLHA_PROMI      LFDNPRXXXXXXXXXXXXXXXPGMPNFVFLFFTAALAGLGWYILKRHSSPXXXXXXXXXXNRVVEASWED
FLHA_YEREN      LFNNPRVMVLSAAVLGLLGMVPGMPNFVXXXXXXXXXXXXWRLGKQQQPTAAEAPVIQDQQQATEATWSD
FLHA_BUCAI      LFYNPQVILLSAIVLGVLGLVPGMPNXXXXXXXXXXXXXSWWLEKKYDLEKSNKKYKFIHDAISEASWND
FLHA_ECOLI      LFSNPXXXXXXXXXXXXXXXXXXXXNXXXXXXXXXXXXXXWWIGREQKAPAEPKPVKMAENNTVEATWND
FLHA_BUCAP      LFCNSQVILLSAIVLGILGLVPGMPNIIFLVFTVXXXXXXXXXXRKKNVLISDSKYKSRENSISEASWND
FLHA_SALTY      LFSNPRXXXXXXXXXXXXXXXXXXXNXXXXXXXXXXXXXXXXXXXEEKAPEEPQPKMPENNSVVEATWND
FLHA_AQUAE      LTKQPRALLFSAGVLGFIGLIPGLPTLPFLAMSAILAGAYYLVQQSXXXXXXXXXXXXXXXXXXXXXXXX
FLHA_HELPY      LTNKSKTLVIVGAILLLFATIPGLPTFSLAFVGTLFLFIAWLISREGKSKIKPHTPTTRAKTQEELKREE
FLHA_HELPJ      LTNKSKTLVIVGANLLLFATIPGLPTFSLAFVGTLFLFIAWLISREGKDGLLTKLENYLSSEKPHSSXDE
FLHA_BUCBP      LFCNPQXXXXXXXXXXXXXXXXXMPNXXXXXXXXXXXXXSWLIYRNPVIFTNFESTMKKIDNTSDASWND
FLHA_BACSU      LFAYPKLLYVAAATIMLLGIFTPIGILLTGPLAGLLAFGAYTLSKSGKXXXXXXXXXXXXXXSPE-SVVQ
FLHA_CAUCR      LAMNPVGLGMVSASSGIIALIPGMPIFPFXXXXXXXXXXXYKRAKKPKXXXXXXXXXXXXXXXXXXXXXX
FHIA_ECOLI      LLASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKQPLAAEAEEKSLETLTRTQQVSWET
FLHA_BORBU      FTNHLGIYWIVSXXXXXXXXXXXXXTLILMFLSLSIAFLAYSLGIRQKEEI--DKKMKLEEEQASISDKD
FLHA_TREPA      FSKSALVYFIGSGALIVMAVLPGFPHSILFFMAVCFAFVGLQLRKRERVHVQEHEMQKSSDKKGMQQTQD
FLHA_BRUME      LGAYPKXXXXXXXXXXXXGVMPGLPAAVPXXXXXXXXXXXXXXGKKQRAEEQERNSVKASLETNQIEL--
HRPI_PSESY      ITSQPKAWIIASVAMLGFAALPGMPT--GVFITIAIICGAGGLLQLQRAKPKADEQRTA-AVAPEMNGED
HRPI_ERWAM      LTSQPKAWIMSAAGMLGFALLPGMPTVIISAIALGSGLFQLWRIKQQDSQQQADELHAQQLAPEDNGYQD
INVA_SALTY      LLNNPFVLVVTAILTISMGTLPGXXXXXXXXXXXXXXXXXXXXXREAKRSAA--KPKTSKGEQP-LSIEE
INVA_SALTI      LLNNPFVLVVTAILTISMGTLPGXXXXXXXXXXXXXXXXXXXXXREAKRSAA--KPKTSKGEQP-LSIEE
MXIA_SHISO      IFGNPFVLIVTSALALAIGMLPGFPFFVFFLIAVTLTALFYYXXXXXXXXXXXXXXXXGYTGTFDISLAM
MXIA_SHIFL      IFGNPFVLIVTSALALAIGMLPGFPFFVFFLIAVTLTALFYYXXXXXXXXXXXXXXXXGYTGTFDISLAM
Y4YR_RHISN      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGDVLDADVDATTVTPAESQTPNVAAQP
HRCV_RALSO      LSTSARAMFTASALLMGFALVPGFPSFLFVALATLIFVFGYTLRNRAKEEGDALPALGSKGKAPTIAEQA
LCRD_YERPS      VVAQPKAMXXXXXXXXXXXXXXXXXTVTFLILALLVGCGGYMLSRKQSLQSILTSGSGAPAARTKAKTSG
LCRD_YERPE      VVAQPKAMXXXXXXXXXXXXXXXXXTVTFLILALLVGCGGYMLSRKQSLQSILTSGSGAPAARTKAKTSG
LCRD_YEREN      VVAQPKAMXXXXXXXXXXXXXXXXXTVTFLILALLVGCGGYMLSRKQSLQSLLTSGSGAPAARTKAKTSG
LCRD_YERE8      VVAQPKAMXXXXXXXXXXXXXXXXXTVTFLILALLVGCGGYMLSRKQSLQSLLTSGSGAPAARTKAKTSG
SSAV_SALTY      IARQPQSLILTAVVLMLLALIPGFP--XXXXXXXXXXXXXXXXXXRRKKSVVSANGVEAPEKD-----SM
HRC2_XANEU      LTSNARALMAASVLLACFAXXXXXXXXXXXXXXXXXXXXXYTIWRKQR-DISGTDQRKLPSEAPHIRKNA


                         .         .         .         .         *         .         .:420
query           IPPVDPIGLEVGYRLIPLVDKTQGGQLMGRIKGVRKKLSQDWGFLIPPVHIRDNLNLAPIAYRITLFGVT
FLHA_PROMI      VQLEDPLSMEVGYRLIPMVDNRQNGELLGRISGIRKKFAQEMGYLPPVVHIRDNMEVKPSSYRILMKGVE
FLHA_YEREN      VQLEDPLGMEVGYRLIPMVDFQQNGELLGRIRSIRKKFAQEMGYLPPVVHIRDNLELPPASYRILMKGVE
FLHA_BUCAI      VELEDPIRIEIGYKLTPMTDINKKGDLLDRIRIVRKKVAQEIGFLPPLVRIKNNMHLSGNSYRIFIKGVE
FLHA_ECOLI      VQLEDSLGMEVGYRLIPMVDFQQDGELLGRIRSIRKKFAQEMGFLPPVVHIRDNMDLQPARYRILMKGVE
FLHA_BUCAP      VELEDPIRIEIGYNLIPMVDIQKKGDLLDKIRIIRKKFAQEIGFLPPLVHIKNNINLKRTSYQIFIKGVE
FLHA_SALTY      VQLEDSLGMEVGYRLIPMVDFQQDGELLGRIRSIRKKFAQDMGFLPPVVHIRDNMDLQPARYRILMKGVE
FLHA_AQUAE      IPQPEPITLEIGYALIPLVDESQGGQIPKKIKNLRKQIAKEYGVIVPLIHIRDNLRLKPNEYRILIKGIE
FLHA_HELPY      EQAIDEVELALGYQLISLADMKQGGDLLERIRGIRKKIASDYGFLMPQIRIRDNLQLPPTHYEIKLKGIV
FLHA_HELPJ      VLKIEFLELALGYQLISLADMKQGGDLLERIRGIRKKIASDYGFLMPQIRIRDNLQLPPTHYEIKLKGIV
FLHA_BUCBP      VQLEGSISIELGNLLIPMIKNSKKSNLLDKIRNVRKKCAKNIGFLPPLVHIRDNNNLPGNCYCILIKGIE
FLHA_BACSU      LLHIDPIEFEFGYGLIPLADANQGGDLLDRIVMIRRQLALELGLVIPVVRIRDNIALQPNEYRLKIKGNE
FLHA_CAUCR      XXXIDDVKIELGYGLLTLINDLDGRKLTDQIRALRKTLASEYGFVMPPVRILDNMRLANQGYAIRIKEME
FHIA_ECOLI      IPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGVLLPEIRIRENFRLKPSQYAIFINGIK
FLHA_BORBU      VSPVDPLALEIGYNLVPIVDDTKTSELLDRIVKIRREIAFEFGIVVPKIRIVDNMRLEPNAYSFKLRGVE
FLHA_TREPA      IVPLDPLSLELGYGLIPLVDKEKGAELLSRITVIRKDAALDLGLVAPKIRIIDNMRLDPSSYCFKIQGLE
FLHA_BRUME      -----CLGKQLSARLIASQE-----ELAHRVNKMRRKFAQEYGFVIPEIKVTDDIALPPKSYRIKIHGTA
HRPI_PSESY      LRTFSP-SRQFVLQFHPGQDSAQIEALVSEIRKRRNRLVVQYGLTLPSFIIEHVDDIAPDEFRFTVYDVP
HRPI_ERWAM      LRRFNPTRAYLLQFSQEHLNSEAAESLIQHIRRLRNRLVYHFGFTLPSFDIEFSPALAADEFRFCVYEIP
INVA_SALTY      IGDLDKVSTET-VPLILLVPKSEKAQLAERL---RSQFFIDYGVRLPEVLLRDGEGLDDNSIVLLINEIR
INVA_SALTI      IGDLDKVSTET-VPLILLVPKSEKAQLAERL---RSQFFIDYGVRLPEVLLRDGEGLDDNSIVLLINEIR
MXIA_SHISO      IENLDAISSET----VPLINKINANDMEGLIERIRSQFFIDYGVRLPTILYRTSNELKVDDIVLLINEVR
MXIA_SHIFL      IENLDAISSET----VPLINKINANDMEGLIERIRSQFFIDYGVRLPTILYRTSNELKVDDIVLLINEVR
Y4YR_RHISN      ----NPIGVFLAPSLTNAIDQVELRQHIARIS---QLVSADLGIIVPPIPVDVDQQLPESQFRIDVEGV-
HRCV_RALSO      PSFTVPVGVRLGAELAKGLDVP---ALDTAFQQGRHALAEALGLPFPGIAIWKADALQPDSYEVRVHDIP
LCRD_YERPS      ANKGRLGEQEAFAMTVPLLIDVDSSQLNDELVRVRRALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVP
LCRD_YERPE      ANKGRLGEQEAFAMTVPLLIDVDSSQLNDELVRVRRALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVP
LCRD_YEREN      ANKGRLGEQEAFAMTVPLLIDVDSSQLNDELVRVRRALYLDLGVPFPGIHLRFNEGMGEGEYLISLQEVP
LCRD_YERE8      ANKGRLGEQEAFAMTVPLLIDVDSSQLNDELVRVRRALYLDLGVPFPGIHLRFNEGMGEGEYLISLQEVP
SSAV_SALTY      VPGACPLIL----RLSPTL---HSADLIRDIDAMRWFLFEDTGVPLPEVNIEPTEKLTVLLYQEPVFSLS
HRC2_XANEU      PDFASPLSMRLSPQLAALLDPARLDQ---AIESERRQLVELLGLPFPGIAIWQTESLQGMQYEVLIHDVP


                         .         .         +         .         .         .         .:490
query           VGEAEVFPEREMAINPGQVFGKVEGTPAQDPAFGLEALWIEPAQREQAQMHGYTVVDAGTVIATHLSQIL
FLHA_PROMI      IGHGEAHPGRWLAINPGNAVGTLEGDNTQEPAFGLPAVWIDDSLREQAQVQGYTVVAASTVIATHFNHVL
FLHA_YEREN      IGSGEAHPGRWLAINPGNAVGTLPGEATQDPAFGLAAVWIESALREQAQIQGFTVVEASTVVATHLNHLI
FLHA_BUCAI      VGQGKCFYGRFMAIHSGRETESLPFEKVYEPTFGLSGYWIDEEFKNKAQKKGYSVIESSVVLSTHLNFLI
FLHA_ECOLI      IGSGDAYPGRWLAINPGTAAGTLPGEATVDPAFGLNAIWIESALKEQAQIQGYTVVEASTVVATHLNHLI
FLHA_BUCAP      VGQGTCFYGKYMAIRSGRETEPLPFKEVYEPTFGLSGYWIDLNFKNKAEKKGYSVVEASAIIATHLNFLI
FLHA_SALTY      IGSGDAYPGRWLAINPGTAAGTLPGEKTVDPAFGLDAIWIESALKEQAQIQGFTVVEASTVVATHLNHLI
FLHA_AQUAE      IDRYELMPGHYLAVNLGNAKGPIEGIETYDPAFKIKAYWITEDKKEEAQKLGYMVVDAETVLITHLSEVI
FLHA_HELPY      IGEGMVMPDKFLAMNTGFVNKEIEGIPTKEPAFGMDALWIETKNKEEAIIQGYTIIDPSTVIATHTSELV
FLHA_HELPJ      IGEGMVMPDKFLAMNTGFVNREIEGIPTKEPAFGMDALWIDAKNKEEAIIQGYTIIDPSTVIATHTSELV
FLHA_BUCBP      ISKGTVQCGKFLAINSGNASGPLP-LPAEDPIFKFKSFWITSELINQAKQKGYNIAEDSTVISTHLNHII
FLHA_BACSU      VAKGELLLDHYLAMSPTPEDDLIEGIETVEPSFGLPAKWISEAVKDEADMLGYTVVDPASVVSTHITEKI
FLHA_CAUCR      AGAGEVRLGCLMCMDPGQV--ELPGEHVREPAFGLPATWIADDLREEATFRGYTVVDPATVLTTHLTEIL
FHIA_ECOLI      ADEADIPADKLMALPSSETYGEIDGVQGNDPAYGMPVTWIQAAQKAKALNMGYQVIDSASVIATHVNKIV
FLHA_BORBU      VGRGEIKLGKFLVINVG-IDSGIDGDLVKDPSFGLPSLWVNDDGRETAEKLGYTVVDPPSIIATHMTELI
FLHA_TREPA      VARGKLRLGWFLAIKSGQVTEEVPGERTIDPTFGLPAVWISEENRDRAERVGYTVVAPSAIIATHLTQVI
FLHA_BRUME      VASHELRVGEILVVLGERPVPSVPGEEVREPAFGMRAYSVPETFTADLRREGYMTVDNLSVLLTHLSEIV
HRPI_PSESY      MLKA-TFTQSHVAVEARQLEG--ENLPAAIPTDRQEDQWVWLPAEQSGELN---PVSSTTLIIERMERAL
HRPI_ERWAM      LVTATFAVEQEIHLADGESDGQIQ--PGQAERDEHHWCWL-PPQHPLLQQEDRRCWNAQQLIMLRMEQAI
INVA_SALTY      VEQFTVYFDLMRVVNYSDEVVSFGINPTIHQQGSSQYFWVTHEEGEKLRELGYVLRNALDELYHCLAVTL
INVA_SALTI      VEQFTVYFDLMRVVNYSDEVVSFGINPTIHQQGSSQYFWVTHEEGEKLRELGYVLRNALDELYHCLAVTL
MXIA_SHISO      ADSFNIYFDKVCITDEN---GDIDGIPVVSTSYNERVIWVDVSYTENLTNIDAKIKSAQDEFYHQLSQAL
MXIA_SHIFL      ADSFNIYFDKVCITDEN---GDIDGIPVVSTSYNERVIWVDVSYTENLTNIDAKIKSAQDEFYHQLSQAL
Y4YR_RHISN      -------PVEQDLINPAQLLKKIEGIPRHDPE--THRIWVEQSHEPALKAAGIRHHSPSELLAMRVHATL
HRCV_RALSO      -GEPVAVPDGHLLIPDLPEALRAQAVEAAGLPNHPAPHWIAPAHVAQDAALSATGQRVERVIADHVVHVL
LCRD_YERPS      VARGEL-KAGYLLVRESVSQLELLGIPYEKGEHLLEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVL
LCRD_YERPE      VARGEL-KAGYLLVRESVSQLELLGIPYEKGEHLLEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVL
LCRD_YEREN      VARGEL-KAGYLLVRESVSQLELLGIPYEKGEHLLETFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVL
LCRD_YERE8      VARGEL-KAGYLLVRESVSQLELLGIPYEKGEHLLETFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVL
SSAV_SALTY      I------PAQADYLLIGADASVVGDSQTLPNGMG-QICWLTKDMAHKAQGFGLDVFAGSQRISALLKCVL
HRC2_XANEU      ETRAE-----------------LENTDDMQAALARQA--ISP---------------------------L


                         *         .         .         .         .         +         .:560
query           QNHAHGLLGREEVQKLLENLAKTAPKLVEGLVPEILPLSIVQKVLQQLLEEGVPIRDMRTIVESLTEHGL
FLHA_PROMI      NQYAAELFGRQEAQMLFDRVSKELPKMTENMIPDMLSLTVLHKVLQNLLAEQVPIRDMRTILEALAEHAP
FLHA_YEREN      SQYASDLFGRQETQQLLDRVSQEMPKLTEDFIPGVVTLTTLHKVLQNLLMERVSIRDMRTIIETLAEHAP
FLHA_BUCAI      TNHIDDLFGRQEAQQLLERVTIDHPKLTEDLIPNTINLTIFHKILRNLLLEHVPIRDMRTILETLSEHAD
FLHA_ECOLI      SQHAAELFGRQEAQQLLDRVAQEMPKLTEDLVPGVVTLTTLHKVLQNLLDEKVPIRDMRTILETLAEHAP
FLHA_BUCAP      SKHIDELFGRQEAQQLLDHVNLEMPKLTEDLIPNIINLTILHKILKNLLLEEVPIRDMRTILETLSEFSI
FLHA_SALTY      GQFSAELFGRQEAQQLLDRVSQEMPKLTEDLVPGVVTLTTLHKVLQNLLAEKVPIRDMRTILETLAEHAP
FLHA_AQUAE      KRNLHELLTRNEVMELIEMLSKKYPKVVKEIVPEQVPISIIHRVLQNLLREGIPVNDLLTILETLADYIE
FLHA_HELPY      KKYAEDFITKDEVKSLLERLAKDYPTIVE--ESKKIPTGAIRSVLQALLHEKIPIKDMLTILETITDIAL
FLHA_HELPJ      KKYAEDFITKDEVKSLLERLAKDYPTIVE--ESKKIPTGAIRSVLQALLHEKIPIKDMLTILETITDIAL
FLHA_BUCBP      LTHISLLFGRQEAQQLLDYVSKFCPKLIEDLIPNSINLTIFHQVLQNLLIENVPIRDMQTILETLITHAP
FLHA_BACSU      KQHAHELIGRQETKQLIDHLKESYPVLVEEVTPNPLSVGDIQKVLAKLLKEKVSIRNLVTIFETLADYGK
FLHA_CAUCR      KENMADLLSYAEVQKLLKELPETQKKLVDDLIPGTVTATTVQRVLQSLLRERVSIRDLPQILEGVGEAAP
FHIA_ECOLI      RSYIPDLFNYDDITQLHNRLSSTAPRLAEDL-SAALNYSQLLKVYRALLTEGVSLRDIVTIATVLVASST
FLHA_BORBU      KRHSYEILTRQDVQNTLDVFKKDYGAIVEEVLKN-FSVGEIQRVLQGLLKEQVSIRNLVTIFETIADFTS
FLHA_TREPA      RTNAADILGRQNVQMIIDALRKEYPAVVDD-VTQKCPLGKIQKVLQGLLREQVSIRNTVAIFETLADFAS
FLHA_BRUME      RNNLAQLLSYKDMRILLDRLGPEYRKLLEDICPAHISYSGLQAVLKLLLAERISIRNLHLILEAIAEIAP
HRPI_PSESY      QSCAPQFIGLQETKAILSWLESEQPELAQEM-QRVLTLTRFSAVLQRLASECVPLRAIRVIAETLIEHCQ
HRPI_ERWAM      HQSGAQFIGLQESKSILNWLESEQPELAQEL-QRIMPLSRFAAVLQRLASERIPLRSVRTIAETLIEHGQ
INVA_SALTY      ARNVNEYFGIQETKHMLDQLEAKFPDLLK----EVLRHATVQRVLQRLLSERVSVRNMKLIMEALALWAP
INVA_SALTI      ARNVNEYFGIQETKHMLDQLEAKFPDLLK----EVLRHATVQRVLQRLLSERVSVRNMKLIMEALALWAP
MXIA_SHISO      LNNINEIFGIQETKNMLDQFENRYPDLLKEVFRHV-TIQRISEVLQRLLGENISVRNLKLIMESLALWAP
MXIA_SHIFL      LNNINEIFGIQETKNMLDQFENRYPDLLKEVFRHV-TIQRISEVLQRLLGENISVRNLKLIMESLALWAP
Y4YR_RHISN      TCHAPRLVGIQETRQLLGRMEQEYSDLVKEVL-RTTPIPRIADVLRRLLGEGIPIRNTRLVLEALAEWSE
HRCV_RALSO      RRSAHLFVGLQETQWMLERVTTDYPGLV-AEAQKAVPAQRIADVLRRLLEEQVPIRNMRAILESLVVWGP
LCRD_YERPS      REYAEDFIGIQETRYLLEQMEGGYGELIKE-VQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQ
LCRD_YERPE      REYAEDFIGIQETRYLLEQMEGGYGELIKE-VQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQ
LCRD_YEREN      REYAEDFIGIQETRYLLEQMEGGYGELIKE-VQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQ
LCRD_YERE8      REYAEDFIGIQETRYLLEQMEGGYGELIKE-VQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQ
SSAV_SALTY      LRHMGEFIGVQETRYLMNAMEKNYSELVKELQRQ-LPINKIAETLQRLVSERVSIRDLRLIFGTLIDWAP
HRC2_XANEU      HARAHLFVGIQETQWMLEQVAVDYPGLV-AEVNKAMPAQRIADVLRRLLEERIPVRNIKSILESLVVWGP


                         .         .         .         *         .         .         .:630
query           RSQDPAILTAIIRIALGRFIIQCFNGLEKELQVISIAPALEQLLLASLQTASEGGGLNMEPGLAEKLHLT
FLHA_PROMI      EQKDPAELTAVVRVALRRAITQHWFGDKEEIQVIGLDAGLERLLLQAMQS---GGGL--EPGLAENIEQQ
FLHA_YEREN      NQTDPYELTAVVRVALGRSIAQQWFPGTGEIQVI-----XXXXXXXXXXXXXXXXXXXXEPGLADRLLEQ
FLHA_BUCAI      TQKDPNELTSIVRIALRKIIIQKLFNQNNIIEIIGLEPNLERLLLNSLKSGTD----TIEPNLSENLLIQ
FLHA_ECOLI      IQSDPHELTAVVRVALGRAITQQWFPGKDEVHVIGLDTXXXXXXXXXXXXXXXXXXXXXDRLLAQ-----
FLHA_BUCAP      DQKDPNELTSLVRIALSKIITQKLFYKKDIIEIIGLEKNLEQLLLDNL----KGQNNTIEPSLFELLMIK
FLHA_SALTY      LQSDPHELTAVVRVALGRAITQQWFPGNEEVQVIGLDTAXXXXXXXXXXXXXXXXXXXXDRLLAQ-----
FLHA_AQUAE      QTKDPDLLTEYVRQALSKRITRMYNG---TLYAIALSPKVEAKLVKFLKENREDEFIDY---VLNTLLPK
FLHA_HELPY      VQNDVNILTEQVRARLSRVITNAFKSEDGRLKFLTFSTDSEQFLLNKLRENGTSKSLLLNVGELQKLIEV
FLHA_HELPJ      VQNDVNILTEQVRARLSRVITNAFKSEDGRLKFLTFSTDSEQFLLNKLRENGTSKSLLLNVGELQKLIEG
FLHA_BUCBP      NYQDSQILTSLVRISLGKLIIQNIFQNNK-IEVIKFDSKLEQILLKTIANKDS----VLEPGLYNYIVVK
FLHA_BACSU      LTTDSDLLTEYTRQALAKQITAQFAKENEVLKVVTCSGRVEKAIADGVQQTEHGNYLSLEPDISESIVRS
FLHA_CAUCR      HTASVTQLVEQVRARLARQLCWANRGDDGALPIITLSADWEQAFAEALIGPGDDKQLALPPSRLQDFIRG
FHIA_ECOLI      VTKDHIXXXXXXXXXXXXSITHPFVRKQXXXXXXXXXXXXXXXXXXXXQ-AQQGGSVPVDPNMLNQFQST
FLHA_BORBU      ITKDIFFLIEKCRQSVGRQITSGYLDLNSELNVITLNPSFEQMIIDSRVESNHDLISSIDPNLKTKFIYE
FLHA_TREPA      TSDPVPILIEKVRQRLGRQICLQYADEQNVLHVMRLDSSLETFLSEKIATVDSLSILTLSLDEQRQVLQA
FLHA_BRUME      LVRRPEMIVEHVRMRMAQQICGDLNGV---LNVLRLGNRWDLVFHQSLKRDAKGEEFDIDPRLLEQFGTE
HRPI_PSESY      HERDTNVLTDYVRIALKSQIYHQYCGAE-GLQVWLVTPESEGLLRDGLQTQTETFALSNETSLVQQLHIA
HRPI_ERWAM      HERDSAALTDFVRIALKEHICHQYQ-QPNGLNVWLLTPETEELLRDSLRQAQSETFFSLAQEYGINLLNQ
INVA_SALTY      REKDVINLVEHIRGAMARYICHKFNG--GELRAVMVSAEVEDVIRKGIRQTSGSTFLSLDPEASANXXXX
INVA_SALTI      REKDVINLVEHIRGAMARYICHKFNG--GELRAVMVSAEVEDVIRKGIRQTSGSTFLSLDPEASANXXXX
MXIA_SHISO      REKDVITLVEHVRASLSRYICSKI-AVSGEIKVVMLSGYIEDAIRKGIRQTSGGSFLNMDIEVSDEVMET
MXIA_SHIFL      REKDVITLVEHVRASLSRYICSKI-AVSGEIKVVMLSGYIEDAIRKGIRQTSGGSFLNMDIEVSDEVMET
Y4YR_RHISN      REQNVALLTEHVRSGMKRQICHRY-GRHGVLPAFVMERETEDVVRCAVRETAAGPYLALEDRQSEALLSQ
HRCV_RALSO      KEKDTLMLVEYVRGDLGRQIAHQATGGTRQMPAILLDLSVEQTVRQAIKPTPAGNFLTLDPQQVEAIIMR
LCRD_YERPS      KEKDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALEPAVTESLLEQ
LCRD_YERPE      KEKDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALEPAVTESLLEQ
LCRD_YEREN      KEKDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALDPAVTESLLEQ
LCRD_YERE8      KEKDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSAVRQTSAGSYLALDPAVTESLLEQ
SSAV_SALTY      REKDVLMLTEYVXXXXXXXXXXXXNPEGKPLPILRIGEGIENLVRESIRQTAMGTYTALSSRHKTQI-LQ
HRC2_XANEU      KEKDLLMLTEYVRCDLGRYLAHTATAGTGQLPAVMLDHAVEQLIRQSIRATAAGNFLALPPEQANQ----


                         .         +         .         .         .         .         *:700
query           LRDSVQRQEAAGKPAILLVQGVLRPWLARFVRHAIPELKVLSYNEIPEDKQVRIVASVGS
FLHA_PROMI      ALDAVRRQEMSGGVPVLLVNHAXXXXXXXXXXXXXPQLAVLSNMEISEGRHIRMTSMIG-
FLHA_YEREN      SRQALQRQEMLGAPPVLLVNHXXXXXXXXXXXXSLPQMVVLSNLEIGDNRQIRMTSTIG-
FLHA_BUCAI      TKEAIKKQLLIGSPLVLLVRHSLRYFLSKFLRQNFPELTVLSQFEIIDVKEIKMTNIIGT
FLHA_ECOLI      TQEALSRQEMLGAPPVLLVNHAXXXXXXXXXXXXXXXXVVLSNLELSDNRHIRMTATIG-
FLHA_BUCAP      TQEAIEKQKLINAPIVLLVTHPLRFFLSKILRKKFPELTVLSQFEVTDIKKVKMTSIIGS
FLHA_SALTY      TQEALSRQEMLGAPPVLLVNHAXXXXXXXXXXXXXXXXVVLSNLELSDNRHIRMTATIG-
FLHA_AQUAE      IKNEIVKFAQYGAVPVLLTSGEVRRFVRKTIEPYLSELAVLSYNELEKQVNIKIIGIV--
FLHA_HELPY      VSEEAMKVLQKGAPVILIVEPNLRKALSNQMEQARIDVIVLSHAELDPNSNFEALGTI--
FLHA_HELPJ      VSEEAMKVLQKGAPVILIVEPNLRKALSNQMEQARIDVVVLSHAELDPNSNFEALGTI--
FLHA_BUCBP      LQQEYNNCKLKNIPCVLLVHHNLRVFIAKMLLKNIPKIFVLSNLELEDVTKIYTTNIIG-
FLHA_BACSU      VAKEAEQLSLRQETAILLCSPPVRMYVKQLLERYFPDLPVLSYNELEANVEVQSIGVV--
FLHA_CAUCR      VRDSFERAALAGEAPVLLTSPGVRPYVRSIIERFRGQTVVMSQNEIHPRARLKTVGMV--
FHIA_ECOLI      MPQVKEQMKAAGKDXXXXXXXXXXXXXARYARLFAPGLHVLSYNEVPDELELKIMGAL--
FLHA_BORBU      LFKIVNEVQAEGFYPVVLSSESSRPIIKVITSREIPDLVVMSVLEVPQNIKVNVLKTV--
FLHA_TREPA      VRTVFVPTRQEGYIPVLLTTDTIRSAMWNLFFSDRIEIAVMSYKEVSTDMRIETVGVV--
FLHA_BRUME      ASAAIRKHFDNGERFVLVSSPEARPYIRMIIERLFATLPVLSHVEIARGVEVKSLGAI--
HRPI_PSESY      F------PVRAPEQAVLLVAQDLRSPLRTLLREEFYHVPVLSFAEISNAAKVKVM-----
HRPI_ERWAM      MRSAFPPYD--NHHALILVAQDLRSPLRALLKDEFHAVPVLSFAELTSNVAINVL-----
INVA_SALTY      XXXXXXXXXIAHKDLVLLTSVDVRRFIKKMIEGRFPDLEVLSFGEIADSKSVNVIKTI--
INVA_SALTI      XXXXXXXXXIAHKDLVLLTSVDVRRFIKKMIEGRFPDLEVLSFGEIADSKSVNVIKTI--
MXIA_SHISO      LAHALRELRNAKKNFVLLVSVDIRRFVKRLIDNRFKSILVISYAEIDEAYTINVLKTI--
MXIA_SHIFL      LAHALRELRNAKKNFVLLVSVDIRRFVKRLIDNRFKSILVISYAEIDEAYTINVLKTI--
Y4YR_RHISN      MRQVFSSTAPGQTRPIVLTSMDVRRFVRGFLTRNGIELAVLSYQDLASDFKIQPVGSI--
HRCV_RALSO      LRGIMQGNPVETPSALAIVTSMIRRYVRRMIEPHLQALNVYSFQEL--------------
LCRD_YERPS      VRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQINIQ-------
LCRD_YERPE      VRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQINIQ-------
LCRD_YEREN      VRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQINIQPLGRV--
LCRD_YERE8      VRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQINIQPLGRV--
SSAV_SALTY      LIEQALKQSA----KLFIVTSVTRRFLRKITEATLFDVPILSWQELGEESLIQVVESI--
HRC2_XANEU      LVEQVERGDHAQHPLAVVASMDVRRYVRRMIEARLTWLQVYSFQELGSEVQLQPIGRV--