[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58626.1

[Show Plain Result]


## Summary of Sequence Search
    1::171
   61::159     8e-10  33%  161 aa  FLIL_AQUAE RecName: Full=Flagellar fliL protein;
   55::154     1e-06  29%  154 aa  FLIL_SHIFL RecName: Full=Flagellar fliL protein;
   55::154     1e-06  29%  154 aa  FLIL_ECOLI RecName: Full=Flagellar fliL protein;
   55::154     1e-06  29%  154 aa  FLIL_ECOL6 RecName: Full=Flagellar fliL protein;
   55::154     1e-06  29%  154 aa  FLIL_ECO57 RecName: Full=Flagellar fliL protein;
   72::155     9e-06  29%  155 aa  FLIL_SALTY RecName: Full=Flagellar fliL protein;
   60::166     1e-04  22%  166 aa  LAFL_VIBPA RecName: Full=Flagellar protein lafL;
  115::159     4e-04  47%  264 aa  KKA2_KLEPN RecName: Full=Aminoglycoside 3'-phosphotransferase;     
    1::171

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSADAARTNQPAIYHS
FLIL_AQUAE      ------------------------------------------------------------------IMYK
FLIL_SHIFL      ------------------------------------------------------------------VFYA
FLIL_ECOLI      ------------------------------------------------------------------VFYA
FLIL_ECOL6      ------------------------------------------------------------------VFYA
FLIL_ECO57      ------------------------------------------------------------------VFYA
FLIL_SALTY      ----------------------------------------------------------------------
LAFL_VIBPA      -------------------------------------------------------------TSKGPSFHP
KKA2_KLEPN      ------------------------------------------------------IMADAMRR-----LHT


                         .         .         *         .         .         .         .:140
query           LDPAFVVNFQHQSQHRIRFLQTKMEAMARDQEVIEALQTHMPAIRNTLLLLLSQQDYETMRTVEGKERLR
FLIL_AQUAE      LDPPFIVNLADPEATVYARISITLEVA--NQQVLQEVQKKEPVIRDAIIEIISSKTSNEIRTPEGREQLK
FLIL_SHIFL      LD-TFTVNLGDAD----RVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLI
FLIL_ECOLI      LD-TFTVNLGDAD----RVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLI
FLIL_ECOL6      LD-TFTVNLGDAD----RVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLI
FLIL_ECO57      LD-TFTVNLGDAD----RVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLI
FLIL_SALTY      -----------------RVLYIGVTLRLKDEATRARLNEYLPEVRSRLLLLFSRQNAAELSTEAGKQKLI
LAFL_VIBPA      LDKV-VLSIKGKKQTHFVMLELAIET--RRPERIKDIDNYMPMVQNSLLKLFSDKTFDELQQTGAIDILQ
KKA2_KLEPN      LDPA-TCPFDHQAKHRIERARTRMEAGLVDQDDLD-----------------------------------


                         +         .         .         .         .         *         .:210
query           EAAREEINLILEAQAAVSGVEAVFFTGFVMQ
FLIL_AQUAE      LEVLKRINTIL----SEGGVRNVYFTEFVIQ
FLIL_SHIFL      AEIKTTLSTPLVAGQPKQDVTDVLYTAFILR
FLIL_ECOLI      AEIKTTLSTPLVAGQPKQDVTDVLYTAFILR
FLIL_ECOL6      AEIKTTLSTPLVAGQPKQDVTDVLYTAFILR
FLIL_ECO57      AEIKTTLSTPLVAGQPKQDVTDVLYTAFILR
FLIL_SALTY      AAIKETLAAPLVAGQPKQVVTDVLYTAFILR
LAFL_VIBPA      NEVKQTLLVAFAKTDIVRDIDDVLLTKYVVQ
KKA2_KLEPN      -------------------------------