[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58831.1

[Show Plain Result]


## Summary of Sequence Search
    1::261
    1::259     3e-93  64%  260 aa  FLGG_ECOLI RecName: Full=Flagellar basal-body rod protein
    1::259     3e-93  64%  260 aa  FLGG_ECOL6 RecName: Full=Flagellar basal-body rod protein
    1::259     3e-93  64%  260 aa  FLGG_ECO57 RecName: Full=Flagellar basal-body rod protein
    1::259     1e-92  63%  260 aa  FLGG_SALTY RecName: Full=Flagellar basal-body rod protein
    1::259     1e-92  63%  260 aa  FLGG_SALTI RecName: Full=Flagellar basal-body rod protein
    1::259     3e-82  58%  260 aa  FLGG_BUCAP RecName: Full=Flagellar basal-body rod protein
    1::259     2e-80  56%  260 aa  FLGG_BUCAI RecName: Full=Flagellar basal-body rod protein
    1::255     1e-79  55%  260 aa  FLGG_BUCBP RecName: Full=Flagellar basal-body rod protein
    1::259     3e-74  53%  265 aa  FLGG_BORBU RecName: Full=Flagellar basal-body rod protein
    2::259     1e-61  46%  262 aa  FLGG_CAUCR RecName: Full=Flagellar basal-body rod protein
    2::261     3e-59  45%  262 aa  FLGG_RHIME RecName: Full=Flagellar basal-body rod protein
    2::261     4e-58  45%  262 aa  FLGG_AGRT5 RecName: Full=Flagellar basal-body rod protein
    1::257     6e-40  38%  264 aa  FLGG_BACSU RecName: Full=Flagellar basal-body rod protein
    1::241     3e-25  38%  245 aa  FLGF_CAUCR RecName: Full=Flagellar basal-body rod protein flgF;
    1::217     1e-24  37%  454 aa  FLGE_HELMU RecName: Full=Flagellar hook protein flgE;Flags:
    1::248     4e-24  36%  251 aa  FLGF_ECOLI RecName: Full=Flagellar basal-body rod protein
    1::248     5e-24  36%  251 aa  FLGF_SALTY RecName: Full=Flagellar basal-body rod protein
    1::262     6e-24  30%  269 aa  FLHP_BACSU RecName: Full=Flagellar hook-basal body complex protein
    1::710     3e-23  40%  718 aa  FLGE_HELPY RecName: Full=Flagellar hook protein flgE;
    1::710     3e-23  40%  718 aa  FLGE_HELPJ RecName: Full=Flagellar hook protein flgE;
    1::235     9e-21  36%  241 aa  FLGF_RHILO RecName: Full=Flagellar basal-body rod protein flgF;
    1::455     7e-20  38%  463 aa  FLGE_TREPH RecName: Full=Flagellar hook protein flgE;
    1::237     2e-19  33%  241 aa  FLGF_RHIME RecName: Full=Flagellar basal-body rod protein flgF;
    1::260     3e-19  32%  270 aa  FLHO_BACSU RecName: Full=Flagellar hook-basal body complex protein
    1::455     4e-19  37%  463 aa  FLGE_TREPA RecName: Full=Flagellar hook protein flgE;
    1::435     2e-18  37%  442 aa  FLGE_BORBU RecName: Full=Flagellar hook protein flgE;
  285::395     9e-18  41%  402 aa  FLGE_ECOLI RecName: Full=Flagellar hook protein flgE;
   12::177     2e-17  37%  406 aa  FLGE_RHIME RecName: Full=Flagellar hook protein flgE;
  286::396     5e-16  38%  403 aa  FLGE_SALTY RecName: Full=Flagellar hook protein flgE;
  286::396     5e-16  38%  403 aa  FLGE_SALTI RecName: Full=Flagellar hook protein flgE;
   12::388     5e-15  38%  396 aa  FLGE_BRUSU RecName: Full=Flagellar hook protein FlgE;
   12::388     5e-15  38%  396 aa  FLGE_BRUME RecName: Full=Flagellar hook protein flgE;
   12::388     5e-15  38%  396 aa  FLGE_BRUAB RecName: Full=Flagellar hook protein flgE;
    1::478     8e-14  32%  482 aa  FLGE_AQUAE RecName: Full=Flagellar hook protein flgE;
    1::243     4e-13  26%  249 aa  FLGF_BUCAP RecName: Full=Flagellar basal-body rod protein flgF;
    2::115     9e-13  35%  405 aa  FLGE_BUCAI RecName: Full=Flagellar hook protein flgE;
  478::583     1e-12  32%  591 aa  FLGE_CAUCR RecName: Full=Flagellar hook protein flgE;
    9::118     6e-12  36%  409 aa  FLGE_BUCAP RecName: Full=Flagellar hook protein flgE;
   20::244     7e-12  29%  248 aa  FLGF_BUCBP RecName: Full=Flagellar basal-body rod protein flgF;
   10::240     7e-10  26%  244 aa  FLGF_BUCAI RecName: Full=Flagellar basal-body rod protein flgF;
    9::49      9e-07  51%  152 aa  FLGC_BORBU RecName: Full=Flagellar basal-body rod protein flgC;
  227::339     1e-04  29% 1371 aa  PLS_STAAW RecName: Full=Putative surface protein MW2416;Flags:
 1459::1576    3e-04  33% 9439 aa  EBH_STAES RecName: Full=Extracellular matrix-binding protein
 1459::1576    3e-04  33% 9439 aa  EBH_STAEQ RecName: Full=Extracellular matrix-binding protein
   10::49      3e-04  53%   59 aa  FLGC_BORHE RecName: Full=Flagellar basal-body rod protein
  744::836     6e-04  36% 2470 aa  TOR1_YEAST RecName: Full=Serine/threonine-protein kinase TOR1;     
   35::142     7e-04  31%  464 aa  VATB_METPE RecName: Full=V-type ATP synthase beta chain;AltName:
    1::261

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNQALWIAKTGLDAQQTRMATISNNLANVNTTGFKRDRAVFEDLLYQTVRQPGAQSSQNTLLPSGLMLGT
FLGG_ECOLI      MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGT
FLGG_ECOL6      MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGT
FLGG_ECO57      MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGT
FLGG_SALTY      MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGT
FLGG_SALTI      MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGT
FLGG_BUCAP      MIPSLWISKTGLDAQQINMNVISNNLANVSTNGFKRSRAVFEDLMYQTMRQAGTNSSIDTTLPSGLQLGT
FLGG_BUCAI      MIPSLWISKTGLDAQQINMNIISNNLANVSTNGFKRSRAVFEDLMYQTIREAGTNSSLETTLPSGLQLGT
FLGG_BUCBP      MIPALWIAKTGLDAQQINMNVIANNLANVNTNGFKRSKAIFEDLIYHTVQQPGSKSSEETISPSGFQLGT
FLGG_BORBU      MMRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTHNRAGTPATENTLRPLGNQVGH
FLGG_CAUCR      --QALRTAASGMAAQQLNVEVISNNIANMNTVGFKRQRAEFQDLLYQTIERAGSQSSSDNIVPTGVQVGG
FLGG_RHIME      --KALSIAATGMNAQQLNLEVXXXXXXXXXTTGYKRARAEFSDLLYQTERAQGVPNRSNAIVPEGAIIGL
FLGG_AGRT5      --RALAIAATGMDAQQTNLEVXXXXXXXXXTTGYKRARAEFTDLLYQTERMQGVPNRANAIVPEGANIGL
FLGG_BACSU      MLRSLYSGISGMKNFQTKLDVIGNNIANVNTVGFKKSRVTFKDMVSQXXXXXXXXXXXXXXXNSK-QIGL
FLGF_CAUCR      MDNALYV---GLSRQMTELDIVXXXXXXXXTTGFK-----VEDLMVRTEQAKPAKTLDGSS-PVKFVMDT
FLGE_HELMU      MLRSLWSGVSGMQAHQVALDVESNNIANVNTTGFKYSRASFVDMISQTKLIATSPHKGGLGGQNDVSVGL
FLGF_ECOLI      MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFR------------------AQLNALRAVPEGLSLPT
FLGF_SALTY      MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFR------------------AQLNALRAVPDGLSLAT
FLHP_BACSU      MLRSMLTASTTLNQLQQQIDXXXXXXXXXXXXGYKAKDTNFSELVRQQVDEKNEEVAKARKTPPGLRLGV
FLGE_HELPY      MLRSLWSGVNGMQAHQIALDIESNNIANVNTTGFKYSRASFVDMLSQVKLIATAPYKNGLAGQNDFSVGL
FLGE_HELPJ      MLRSLWSGVNGMQAHQIALDIESNNIANVNTTGFKYSRASFVDMLSQVKLIATAPYKNGLAGQNDFSVGL
FLGF_RHILO      MQDSLYVALSAQMALERRLDTIADNVANANTVGFRATGVKFEDMVSGTGQKSVSFASSGKTYLSG-----
FLGE_TREPH      MMRSLFSGVSGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQL-SGASRPNEEVGGVNPKEVGL
FLGF_RHIME      MQTGLYVALSSQMALEKRLNTLADNIANSNTVGFRATEVKFNQVLGDT--KPTKVS----------YVSE
FLHO_BACSU      MLKGLYTATSAMIAQQRRTEMLSNNIANANTSGYKADQGAFPEMLLSRIESKSPAGTSRTEIGS---VNT
FLGE_TREPA      MMRSLFSGVSGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQL-SAAARPNEEVGGVNPKEVGL
FLGE_BORBU      MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMISQSIRPTDARGGTNP-----KQVGL
FLGE_ECOLI      ----------------------------------------------------------------------
FLGE_RHIME      ---------SGMNAQSNRLSTVAENIANANTTGYKRASTEFSSMIL-----PSGNGSYNS---------G
FLGE_SALTY      ----------------------------------------------------------------------
FLGE_SALTI      ----------------------------------------------------------------------
FLGE_BRUSU      ---------SGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVL-----PSTAGQYN----SGSVL-T
FLGE_BRUME      ---------SGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVL-----PSTAGQYN----SGSVL-T
FLGE_BRUAB      ---------SGMNAQANRLSTVADNIANASTVGYKRAETQFSSLVL-----PSTAGQYN----SGSVL-T
FLGE_AQUAE      MLRSFYNAITGMDVSRFALDVTSDNLANANTVGFKKSRPIFQDM----VSQXXXXXXXXXXXXXXXXXXX
FLGF_BUCAP      MNKAIYESMNAAIKLLDKQAVIANNLANISTVGFKESFNLF-------IKDRNLQNLKKTYN--------
FLGE_BUCAI      ------IAISGLLANNDYMEXXXXXXXXXXTIGYKSRKPLFFDMFSHSFY-------------SNTTNGY
FLGE_CAUCR      ----------------------------------------------------------------------
FLGE_BUCAP      ----------GLMINNDYIDIVSNNIANASTIGFKSSTPSFFDIVSHSFYS-------NQIIKSGVGISN
FLGF_BUCBP      -------------------ARIANNITNISTPGFKSEL----ELKILLPSQKDQNSQEDNFL--------
FLGF_BUCAI      -----------------KQSIISNNLANISTTGFK-EKFIFA---IQNHNVKNLYNSDKKITKEYYNLSP
FLGC_BORBU      ------VASTGLTAQRLRIDVISNNIANVSTSPYRRQRIIF-----------------------------
PLS_STAAW       ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
FLGC_BORHE      -------ASTGLTAQRLRLDVIANNIANVETTSYRRQRVIF-----------------------------
TOR1_YEAST      ------------------------------------------------VAKPYIEPLLNVLLPKFQDTSS
VATB_METPE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GVRTVATEKLFTQGGLTQTGNSLDMAIQGRGFFQILMPDGSLAYTRDGTFQIDANGQLVTSSGYPVQPGI
FLGG_ECOLI      GVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGSFQVDQNGQLVTAGGFQVQPAI
FLGG_ECOL6      GVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGSFQVDQNGQLVTAGGFQVQPAI
FLGG_ECO57      GVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGSFQVDQNGQLVTAGGFQVQPAI
FLGG_SALTY      GVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAI
FLGG_SALTI      GVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAI
FLGG_BUCAP      GVRPVSTEKIYSQGNLSKTDSSKDVAINGPGFFQVQLPDGNIAYTRDGSFQLDQNGQLVTNSGYXXXXXX
FLGG_BUCAI      GVRPVSTERIHTQGNLSKTDASKDVAINGSGFFQVQLPDGNIAYTRDGSFQLDQNGQLVTNSGFXXXXXX
FLGG_BUCBP      GVRPITTEREHSQGNLSKTNSLKDVAINGNGFFQVQLPDGNAAYTRDGSFQINPNGQLVTNNGFLIQPVI
FLGG_BORBU      GTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGTYAYTRDGSFKIDSNRELVTSQGYKVLPNI
FLGG_CAUCR      GVKAGSVYRITEQGTPTLTDSPLDLAIQGKGYMPILLPSGETAYTRAGNFSTNDQGQIVTEDGYLVQPGI
FLGG_RHIME      GVQTSAVRNLHIQGSLVNTGNDYDLALVGRGWFQIETPDGETVYTRSGAFNTNATGQLVTIDGYTVVPGV
FLGG_AGRT5      GVQTSAVRNIHTQGNLIETGNKLDVAIIGQGWFQIEAADGSTLYSRAGAFNKNADGNLVTVDGYNVIPNI
FLGG_BACSU      GSSSGTIDTIHSTSATQSTGRTLDLAIDGDGYFRIDTGDGT-AYTRAGNFYLDNTGTLVTGDGYHVLNTI
FLGF_CAUCR      GVA-----RNFTQGPMTKTGGDYDLAINGMGFFKV-QANGGERYTRDGRFTTNPEGILVTQAGAPVLDDI
FLGE_HELMU      GVNVNSTTKVFSQGSTQNTDVKTDLAIEGDGFF-IISPDRGKTFTRDGEFLFDANGNLVTNGGYVVQ-GW
FLGF_ECOLI      --RTLVTASTMTPGKMDYTSRPLDVALQQDGWLAVQTADGSEGYTRNGSIQVDPTGQL-TIQGHPVEAGI
FLGF_SALTY      --RTLVTASTMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQL-TIQGHPVEGGI
FLHP_BACSU      GAM-MSSRLVSDQGSIQKTDRDLDIAFTSPYQYLQVNVNGNRQYTRDGALYVTPSAQLVTGNGYPVLDEV
FLGE_HELPY      GVGVDATTKIFSQGNIQNTDVKTDLAIQGDGFF-IISPDRGITFTRDGEFLFDSQGSLVTTGGLVVQ---
FLGE_HELPJ      GVGVDATTKIFSQGNIQNTDVKTDLAIQGDGFF-IISPDRGITFTRDGEFLFDSQGSLVTTGGLVVQ---
FLGF_RHILO      -----------AHGSLSETGNPFDFAIQGDAWFAIDTPAGTV-MTRDGRFSMNENGELMSIEGHPVL---
FLGE_TREPH      GVMVASIDTVHTQGALQTTGINTDIAIQGNGFF--ILKDGEKSYTTAGAFGVDRDGTLVNANGMRVQ---
FLGF_RHIME      GEEFLSTK----TGALARTGSALDFAIKGDAWFSIDTPGGP-ALTRDGRFTLTETGELVTIKGYPVLDAI
FLHO_BACSU      GVYMQELKPLFTQGSLKSTDQPTDIALKAALFYPVQTADG-IRYSKSSTFSLNENNQL-TINGRPIQP-I
FLGE_TREPA      GVLIASIDTVHTQGALQTTGINTDVSIQGSGFF-VLKSGEKTFFTRAGAFGVDNAGTLVNANGMRVQ---
FLGE_BORBU      GMNVASIDTIHTQGAFQSTQKASDLGVSGNGFF-ILKEGKNLFYTRAGAFDVDSDRHLVNANGMRIQ---
FLGE_ECOLI      ----------------------------------------------------------------------
FLGE_RHIME      GVQTEVRYSISQQGATTFTTSASDLAIDGGGFFIVEGANGQEYLTRAGSFVPDSEGNLVNASGFTLM-GY
FLGE_SALTY      ----------------------------------------------------------------------
FLGE_SALTI      ----------------------------------------------------------------------
FLGE_BRUSU      DVRYGISD----QGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNS---------
FLGE_BRUME      DVRYGISD----QGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNS---------
FLGE_BRUAB      DVRYGISD----QGGIRSTSSTTDLAIDGNGYFVVQGPGGSTYLTRAGSFVPDKNGDLVNS---------
FLGE_AQUAE      XXXXDSTQKVWTIGSFKQTEITTDLAIEGKALFILRVLTNQTYYTRDGRFRINREGYLINPNGLYVQ---
FLGF_BUCAP      --QNVKEYYNFYPGTLIHTQRNLDLVIKNNGWLAIKDINGQEAYTKNGHIKINKEGKMVQNYELXXXXXX
FLGE_BUCAI      GVGISSIIQNFNNGMLVETGRDLDLGIIKDGFFRLVDSQGHVYYTRDGQFFLDKDQNIINIQG-------
FLGE_CAUCR      ----------------------------------------------------------------------
FLGE_BUCAP      LVQN------FSDGVLVQTNRDLDLGIVQDGFFRVLDSKGYVYYTRNGHFLLDKNKNIVNGQG-------
FLGF_BUCBP      ----YKQYKNKNQGTLRRTNQPLDCAIIDKNWFVIKIDPKTIAYTKNGHFKINSNRQL-TVQNHPVDGEI
FLGF_BUCAI      GI-------------LRYTGRNLDLFIKDDGWLTVKDTNGQEAYTKNGHLKINSKRKLIQDNEVXXXXXX
FLGC_BORBU      ----------------------------------------------------------------------
PLS_STAAW       ---------------------------------------------------------------------I
EBH_STAES       ----------------------------------------SLAYTRTGVWQTSQSAKFIVTNAKPNQPTI
EBH_STAEQ       ----------------------------------------SLAYTRTGVWQTSQSAKFIVTNAKPNQPTI
FLGC_BORHE      ----------------------------------------------------------------------
TOR1_YEAST      ---TVASTALRTIGELSVVGGE-DMKIYLKDLFPLIIKDQSNSFKREAALK--ALGQLAASSGYVIDPLL
VATB_METPE      ----------------------------------------------DGTIKLDTSDDLVTTTGIGKDSGV


                         +         .         .         .         .         *         .:210
query           TIPESALSVTVGSDGIVSVLMAGDGTPIQAGNLQLADFINPAGLQPTGNNLFKETASSGVAQTGIPGLNG
FLGG_ECOLI      TIPANALSITIGRDGVVSVTXXXXXXXXXXXXLNLTTFMNDTGLESIGENLYTETQSSGAPNESTPGLNG
FLGG_ECOL6      TIPANALSITIGRDGVVSVTXXXXXXXXXXXXLNLTTFMNDTGLESIGENLYTETQSSGAPNESTPGLNG
FLGG_ECO57      TIPANALSITIGRDGVVSVTXXXXXXXXXXXXLNLTTFMNDTGLESIGENLYTETQSSGAPNESTPGLNG
FLGG_SALTY      TIPANALSITIGRDGVVSVTXXXXXXXXXXXXLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNG
FLGG_SALTI      TIPANALSITIGRDGVVSVTXXXXXXXXXXXXLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNG
FLGG_BUCAP      XXXXXXXXXXXGRDGIVSVTIQGQTQPISIGQLNLINFVNHSGLESLGENLYQETQASGNPIDTTPGLNG
FLGG_BUCAI      XXXXXXXXXXXARDGVISVVVQGQTQPVLLGQLNLINFVNNSGLESLGENLYQETQASGSPIETTPGLNG
FLGG_BUCBP      NFPANGNNMSVSRDGIITVRIPEQTQPIRVGKLYLANFVNDSGLSNIGENLYQETEASGNPSISSPGSHG
FLGG_BORBU      LFPEEYISITISEEGIVSVKIDTSNEPIELGQIEISRFINPAGLSAIGSNLFKETAGSGQEIAGIPGSEG
FLGG_CAUCR      TIPQNATDITISKSGLVQVKLDGQPQPQTVGQIQLANFLNEGGLEAIGDNLFXXXXXXXXXXXXXXXXPG
FLGG_RHIME      TVPQDATEIVFTSSGQVMVRIGNDTELQEIGQLTIANFVNEAGLEPMGENLFRQTPASGDPIVGTPADPG
FLGG_AGRT5      NIPTDAQDITITRTGQVTARIGNAADFTQLGQLTIANFANEAGLKPLGDNLFSQTPASGAPVVGVPDDPS
FLGG_BACSU      KIPTDAQSFSIGSDGKVSIVDA-EGKTQDGGQIGIVTFANSDGLDKIGSNLYRESLNSGTASAANPGDGG
FLGF_CAUCR      TIDPRLGPVTVGKDGIVSQ------GAIRVGRIGLVRPDDLSTFAKDGDNLYRNTTNTA------PQPVT
FLGE_HELMU      MKDDLRNAEKISEDDFFRV----DTTPIQ--NIQ----IDPAMMMPSSNISLRANLNAGRHVDQVANVFG
FLGF_ECOLI      AVPEGA-EITIAADGTISALNPGDNTVAPVGRLKLVK-ATGSEVQRGDDGIFRLSAETQATRGPVLQADP
FLGF_SALTY      TVPEGS-EITIAADGTISALNPGDNTVAPVGRLKLVK-AEGNEVQRSDDGLFRLTAEAQAERGAVLAADP
FLHP_BACSU      NIDSSMKNITINKNG---TLTASDGNAVQRFNLGVVQVNNPQELKSEGNNLFSIDNAAAFEELNGANRQN
FLGE_HELPY      ------MDVRFDSDGVLLGAFS-NGRTLALAQVALANFANDAGLQALGGNVFSQTGNSGQALIGAANTGR
FLGE_HELPJ      ------MDVRFDSDGVLLGAFS-NGRTLALAQVALANFANDAGLQALGGNVFSQTGNSGQALIGAANTGR
FLGF_RHILO      ----DAGGAPIQLDPRNGPPKAGDGSLRQ--NDQLVGSIGLYNFDPGEN--FVRYGNSGIVPARTPDRSD
FLGE_TREPH      ----------IDQSGIITGVYS-NGASREIGQLALAGFANQGGLEKAGENTYIQSNNSGIANITVSGVMG
FLGF_RHIME      QLNGGAGEIAVGADGAIH----QNGVQIALLGLYEADF-SKGFMRYDNSSVMPAAQPEPVVDRFDVG---
FLHO_BACSU      TVDNE--NFTVSENGTVTT----NGRTAGQIDVRMAEDVR--NLKRDGNDLY--STADGNDLPSAAGNNQ
FLGE_TREPA      ----------IDQSGVITGVYS-NGVSQDIGQLALAGFANQGGLEKAGENTYVQSNNSGIANISTSGVMG
FLGE_BORBU      ----------IDQNGVI-VGIYSNGIRRDLGKIALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAG
FLGE_ECOLI      --PGDLVSYQINDDGTVVGNYSNEQTQL-LGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTAGTGN
FLGE_RHIME      EY-EAGVDPTVGFDGLTRVNLASDGL-IAAGSTKGSMGANLPSGAPVGD---------------------
FLGE_SALTY      --PGDLVSYQINNDGTVVGNYSNEQEQV-LGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGN
FLGE_SALTI      --PGDLVSYQINNDGTVVGNYSNEQEQV-LGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGN
FLGE_BRUSU      -----------------------NGTQKVLYRIPLANVASPNRMTVVSGNIFLPSAESGDVRLGFPQGDG
FLGE_BRUME      -----------------------NGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDVRLGFPQGDG
FLGE_BRUAB      -----------------------NGTQKVLYRIPLANVASPDRMTVVSGNIFLPSAESGDVRLGFPQGDG
FLGE_AQUAE      ----------LSEDGVV-VGVYSNGETLPTYRLALAQFTDPEELVKKGSNLYASVKTPTILLPG--GSNK
FLGF_BUCAP      XXXXXXXXLKISSNGIIKEIKKNKDSIIESGSLKLVRLQNDNLIQK--ENGXXXXXXXXXXXXXXXXHDS
FLGE_BUCAI      ------------------------------GQILLSKFINPEKLQPESGNLWSATAESGEAKTAMKGIQE
FLGE_CAUCR      -------NIEIDEGGYVSAIF-DNGVTRRIAQVAIATFSNPNGLKGVNGNAYRVTNESGTYSLKAPSQGG
FLGE_BUCAP      ------------------------------GQIFLAKFINPEKLKPESGSIWSATHESGQEKIGAAGDQG
FLGF_BUCBP      FIPKNE-NIVISSDGYINIILQHKVAQFKLKNFDINDLTXXXXXXXXXXXXXXXXXXXXXXVSNI-----
FLGF_BUCAI      XXXXXXXXXXXXXXGVITSVKNKHKHIVETGSLKLVQLPSQDLIQ-NENGLFKKNNEINKKHTNTIKHSK
FLGC_BORBU      ----------------------------------------------------------------------
PLS_STAAW       RVANNHQSVTTGADGWGFLFSKGDGNEY----LQKGGILGPKGMEDTGYN-FKDPMDKEEKQAG-QGFKG
EBH_STAES       TQSKTG-DVTVTPGAVRNILISGTNDYIQASADKIV--INKNGNKLT--TFVKNNDGRWTVETGSPDING
EBH_STAEQ       TQSKTG-DVTVTPGAVRNILISGTNDYIQASADKIV--INKNGNKLT--TFVKNNDGRWTVETGSPDING
FLGC_BORHE      ----------------------------------------------------------------------
TOR1_YEAST      DYPE------------------------------------------------------------------
VATB_METPE      RFTGETIKMPVGRD-MLGRILSGSGKPIDGG----PEIVPEKRLDITGANPYARASPSDFIETGISTIDG


                         .         .         .         +         .         .         .:280
query           IGTLVQGALEGANVNVVEELVNMIETQRAYEMNSKAISSTDEMLRFATQTL
FLGG_ECOLI      AGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQ--
FLGG_ECOL6      AGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQ--
FLGG_ECO57      AGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQ--
FLGG_SALTY      AGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQ--
FLGG_SALTI      AGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQ--
FLGG_BUCAP      TGLLYQGYVETSNVNVAEELVNMIQTQRAYEINSKSINTSDQMLQKLSQ--
FLGG_BUCAI      TGVLYQGYVETSNVNVAEELVNMIQTQRAYEINSKSISTSDQMLQKLSQ--
FLGG_BUCBP      TGLLYQSYVETSNVNIAEELVNMIQAQRAYEINSKVITTADQMLQ------
FLGG_BORBU      MGRLRQGILEMSNVSIAEEMVTMIVAQRAYEINSKAIQTSDNMLGIA----
FLGG_CAUCR      FGMLLQHYTEASNVDAVSEITALITAQRAYEMNSKVISTADQMLQATSQ--
FLGG_RHIME      FAQVKQNYLESSNVDPVKEITDLISAQRAYEMNSKIIQAADEMAATVSKNL
FLGG_AGRT5      YGYVKQSYLEGSNVDAVKEITDLITAQRAYEMNSKVITTADEMASIVSKNL
FLGG_BACSU      TGALKSGFLEMSNVDLTDEFTEMIVAQRGFQSNSKIITTSDEILQ------
FLGF_CAUCR      DAQIHQGMLEASNVQPVIEITKLIEIQRAYESVAKMMDNTAELSRSAVERL
FLGE_HELMU      LGSTTKTPVDGIN--------------------------------------
FLGF_ECOLI      TLRVMSGVLEGSNVNAVAAMSDMIASARRFEMQMKVISSVDDNAGRANQLL
FLGF_SALTY      SIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLL
FLHP_BACSU      IG-MQQGSLEMSNVDISEQMTDLITSQRSYQLNSRTITMGDQML-------
FLGE_HELPY      RGSISGSKLESSNVDLSRSLTNLIVVQRGFQANSKAVTTSDQIL-------
FLGE_HELPJ      RGSISGSKLESSNVDLSRSLTNLIVVQRGFQANSKAVTTSDQIL-------
FLGF_RHILO      VG-IAQGFVEESNVNPVLEMTRLIMVQRAFELMRQTASSSDEAIK------
FLGE_TREPH      KGKLIAGTLEMSNVDLTDQFTDMIITQRGFQAGAKTIQTSDTML-------
FLGF_RHIME      ---VMQGFLEESNVNAIQEMSQLIMITRAFDNVTALMRDSEGSLDKAIETL
FLHO_BACSU      VASLKQGVSELSNVDVTSAYTEMTEAYRSFEANQKVIQAYDKSM-------
FLGE_TREPA      KGKLIAGTLEMSNVDLTDQFTDMIITQKGFQAGAKTIQTSDTML-------
FLGE_BORBU      LGDIRSGVLEMANVDLAEQFTDMIVTQRGFQANAKTITTSDQLLQ------
FLGE_ECOLI      FGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQIL-------
FLGE_RHIME      ---------------------------------------------------
FLGE_SALTY      FGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQIL-------
FLGE_SALTI      FGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQIL-------
FLGE_BRUSU      MGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGSELM-------
FLGE_BRUME      MGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELM-------
FLGE_BRUAB      MGKIMSGTLEESNADIAQELTDMIEAQRSYTANSKVFQTGFELM-------
FLGE_AQUAE      IRSAV---VEMSNVDIAKEFINLITAQRTYQV-------------------
FLGF_BUCAP      SVRIQSEMLEASNVNPTKNMIDMISNARQFEMNMKIISMCDQNTEYANQ--
FLGE_BUCAI      SGVLSNKTLEVSNVDLNKELINMIIAQRNYQSNAQSFKTEDKII-------
FLGE_CAUCR      AGALAPSTLEASTVDLSQEFTGLITTQRAYSASSKIITTADQML-------
FLGE_BUCAP      FGSLYTKFLESSNVDLNKELINMIIAQRNYQSSAQAFKTEDRII-------
FLGF_BUCBP      --KLVSGILEDSNVNLEENMVEMISNARKFDMQIKILSMYNENTQAASRFL
FLGF_BUCAI      KIRVQSGMLEESNVNASKNMIEMISNARQFEMQMKMISMCDQNAEYANQLI
FLGC_BORBU      -----KGYVELPNVNLVEEMVDMISASRAYEANSTVINSSKSMFRSALAIL
PLS_STAAW       YGTFVKTGADGTTAKVGTNIPTRGKADNSFQYADNSIDTTD----------
EBH_STAES       IGPTNNG--------------------------------------------
EBH_STAEQ       IGPTNNG--------------------------------------------
FLGC_BORHE      ---------------------------------------------------
TOR1_YEAST      ---------------------------------------------------
VATB_METPE      TNTLVRG--------------------------------------------