[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58871.1

[Show Plain Result]


## Summary of Sequence Search
    1::200
    1::200     e-114 100%  200 aa  WRBA_NITOC RecName: Full=Flavoprotein wrbA;
    1::197     3e-86  77%  201 aa  WRBA_THICR RecName: Full=Flavoprotein wrbA;
    1::198     3e-84  74%  200 aa  WRBA_BURCM RecName: Full=Flavoprotein wrbA;
    1::198     3e-84  74%  200 aa  WRBA_BURA4 RecName: Full=Flavoprotein wrbA;
    1::198     6e-84  75%  200 aa  WRBA_BURPP RecName: Full=Flavoprotein wrbA;
    1::198     2e-83  73%  200 aa  WRBA_BURCJ RecName: Full=Flavoprotein wrbA;
    1::198     2e-83  73%  200 aa  WRBA_BURCC RecName: Full=Flavoprotein wrbA;
    1::198     4e-83  73%  200 aa  WRBA_BURM1 RecName: Full=Flavoprotein wrbA;
    1::198     5e-83  73%  200 aa  WRBA_BURS3 RecName: Full=Flavoprotein wrbA;
    1::198     6e-83  73%  200 aa  WRBA_BURCH RecName: Full=Flavoprotein wrbA;
    1::198     8e-83  72%  200 aa  WRBA_BURCA RecName: Full=Flavoprotein wrbA;
    1::198     4e-82  73%  200 aa  WRBA_BURVG RecName: Full=Flavoprotein wrbA;
    1::197     5e-80  73%  199 aa  WRBA_ALHEH RecName: Full=Flavoprotein wrbA;
    1::197     2e-76  70%  199 aa  WRBA_AZOSB RecName: Full=Flavoprotein wrbA;
    1::197     9e-74  68%  200 aa  WRBA_METRJ RecName: Full=Flavoprotein wrbA;
    1::198     2e-73  67%  200 aa  WRBA_RHOCS RecName: Full=Flavoprotein wrbA;
    2::202     3e-73  65%  207 aa  WRBA_AZOSE RecName: Full=Flavoprotein wrbA;
    1::197     1e-72  66%  199 aa  WRBA_METEP RecName: Full=Flavoprotein wrbA;
    1::197     1e-72  66%  199 aa  WRBA_METC4 RecName: Full=Flavoprotein wrbA;
    1::197     2e-72  68%  199 aa  WRBA_ACICJ RecName: Full=Flavoprotein wrbA;
    1::198     3e-70  65%  199 aa  WRBA_AGRRK RecName: Full=Flavoprotein wrbA;
    1::197     8e-70  63%  199 aa  WRBA_AGRT5 RecName: Full=Flavoprotein wrbA;
    1::194     8e-70  67%  212 aa  WRBA3_RHIME RecName: Full=Flavoprotein wrbA 3;
    1::197     4e-69  63%  198 aa  WRBA_RHIL3 RecName: Full=Flavoprotein wrbA;
    1::198     5e-69  62%  200 aa  WRBA_ACIF5 RecName: Full=Flavoprotein wrbA;
    1::198     5e-69  62%  200 aa  WRBA_ACIF2 RecName: Full=Flavoprotein wrbA;
    1::199     9e-69  60%  199 aa  WRBA1_RHIME RecName: Full=Flavoprotein wrbA 1;
    2::201     1e-68  63%  204 aa  WRBA_SYNFM RecName: Full=Flavoprotein wrbA;
    1::197     2e-68  63%  199 aa  WRBA_PHOLL RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERPY RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERPS RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERPP RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERPN RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERPG RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERPE RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERPB RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERPA RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     4e-68  63%  199 aa  WRBA_YERP3 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    3::201     3e-67  60%  203 aa  WRBA_DESMR RecName: Full=Flavoprotein wrbA;
    1::197     5e-67  62%  199 aa  WRBA_YERE8 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     1e-65  63%  198 aa  WRBA_AZOVD RecName: Full=Flavoprotein wrbA;
    3::201     4e-65  60%  203 aa  WRBA_GEOSL RecName: Full=Flavoprotein wrbA;
    1::196     6e-65  58%  198 aa  WRBA_MARMS RecName: Full=Flavoprotein wrbA;
    1::202     6e-65  62%  204 aa  WRBA_GEOLS RecName: Full=Flavoprotein wrbA;
    1::197     8e-65  60%  199 aa  WRBA_METPB RecName: Full=Flavoprotein wrbA;
    1::197     1e-64  62%  199 aa  WRBA_TOLAT RecName: Full=Flavoprotein wrbA;
    1::197     1e-64  62%  200 aa  WRBA_DIAST RecName: Full=Flavoprotein wrbA;
    1::199     1e-64  60%  201 aa  WRBA_CHRSD RecName: Full=Flavoprotein wrbA;
    1::198     2e-64  61%  199 aa  WRBA_SPHWW RecName: Full=Flavoprotein wrbA;
    2::203     3e-64  59%  203 aa  WRBA_SYNAS RecName: Full=Flavoprotein wrbA;
    1::197     4e-64  60%  199 aa  WRBA_BRASO RecName: Full=Flavoprotein wrbA;
    1::197     8e-64  60%  199 aa  WRBA_RHOP2 RecName: Full=Flavoprotein wrbA;
    1::197     1e-63  60%  199 aa  WRBA_OLICO RecName: Full=Flavoprotein wrbA;
    1::200     4e-63  62%  208 aa  WRBA_PARDP RecName: Full=Flavoprotein wrbA;
    1::197     5e-63  59%  199 aa  WRBA_BRASB RecName: Full=Flavoprotein wrbA;
    2::202     9e-63  58%  205 aa  WRBA_GEOSF RecName: Full=Flavoprotein wrbA;
    1::197     2e-62  58%  199 aa  WRBA_BRAJA RecName: Full=Flavoprotein wrbA;
    1::196     5e-62  60%  198 aa  WRBA_SALSV RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     5e-62  60%  198 aa  WRBA_SALNS RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     5e-62  60%  198 aa  WRBA_SALHS RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     5e-62  60%  198 aa  WRBA_SALG2 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     5e-62  60%  198 aa  WRBA_SALEP RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     5e-62  60%  198 aa  WRBA_SALDC RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     5e-62  60%  198 aa  WRBA_SALAR RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     5e-62  60%  198 aa  WRBA_SALA4 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     5e-62  57%  199 aa  WRBA_RHOPS RecName: Full=Flavoprotein wrbA;
    1::196     8e-62  60%  198 aa  WRBA_SALPK RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     8e-62  60%  198 aa  WRBA_SALPB RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     8e-62  60%  198 aa  WRBA_SALPA RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     8e-62  57%  199 aa  WRBA_RHOPT RecName: Full=Flavoprotein wrbA;
    1::196     1e-61  59%  198 aa  WRBA_SALTY RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     1e-61  59%  198 aa  WRBA_SALPC RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     1e-61  58%  199 aa  WRBA_METS4 RecName: Full=Flavoprotein wrbA;
    1::197     2e-61  57%  199 aa  WRBA_RHOPA RecName: Full=Flavoprotein wrbA;
    1::199     2e-61  56%  199 aa  WRBA_RHISN RecName: Full=Flavoprotein wrbA;
    2::201     2e-61  56%  203 aa  WRBA_GEOUR RecName: Full=Flavoprotein wrbA;
    1::196     3e-61  59%  198 aa  WRBA_CITK8 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::188     3e-61  63%  202 aa  WRBA2_RHIME RecName: Full=Flavoprotein wrbA 2;
    1::197     4e-61  59%  199 aa  WRBA_SERP5 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     9e-61  57%  199 aa  WRBA_NITWN RecName: Full=Flavoprotein wrbA;
    1::196     1e-60  57%  198 aa  WRBA_HALHL RecName: Full=Flavoprotein wrbA;
    1::197     1e-60  58%  199 aa  WRBA_CAUCR RecName: Full=Flavoprotein wrbA;
    1::197     1e-60  58%  199 aa  WRBA_CAUCN RecName: Full=Flavoprotein wrbA;
    1::197     3e-60  58%  199 aa  WRBA_GLUDA RecName: Full=Flavoprotein wrbA;
    1::196     6e-60  58%  198 aa  WRBA_SHIDS RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     6e-60  59%  198 aa  WRBA_ENT38 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     1e-59  58%  198 aa  WRBA_SALTI RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     2e-59  57%  199 aa  WRBA_BURP8 RecName: Full=Flavoprotein wrbA;
    1::197     2e-59  57%  200 aa  WRBA_ZYMMO RecName: Full=Flavoprotein wrbA;
    1::196     2e-59  58%  198 aa  WRBA_SHIFL RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_SHIF8 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOUT RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOSM RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOSE RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOLU RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOLI RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOLC RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOL6 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOL5 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOK1 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOHS RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECODH RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECOBW RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECO8A RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECO7I RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECO55 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECO45 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECO27 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     2e-59  58%  198 aa  WRBA_ECO24 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     3e-59  58%  198 aa  WRBA_ESCF3 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     8e-59  58%  199 aa  WRBA_AZOC5 RecName: Full=Flavoprotein wrbA;
    6::199     1e-58  57%  201 aa  WRBA_SHISS RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::197     1e-58  57%  199 aa  WRBA_BEII9 RecName: Full=Flavoprotein wrbA;
    2::201     2e-58  55%  203 aa  WRBA_GEOMG RecName: Full=Flavoprotein wrbA;
    1::196     3e-58  57%  198 aa  WRBA_ECO5E RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    1::196     3e-58  57%  198 aa  WRBA_ECO57 RecName: Full=Putative flavoprotein wrbA;AltName:
    1::197     4e-58  55%  199 aa  WRBA_RHOP5 RecName: Full=Flavoprotein wrbA;
    1::197     3e-57  56%  199 aa  WRBA_XANP2 RecName: Full=Flavoprotein wrbA;
    1::196     4e-57  57%  198 aa  WRBA_KLEP3 RecName: Full=Flavoprotein wrbA;AltName: Full=Trp
    5::201     8e-57  57%  203 aa  WRBA_PARL1 RecName: Full=Flavoprotein wrbA;
    1::197     8e-57  57%  199 aa  WRBA_CAUSK RecName: Full=Flavoprotein wrbA;
    1::197     2e-56  56%  199 aa  WRBA_METSB RecName: Full=Flavoprotein wrbA;
    1::197     2e-55  54%  199 aa  WRBA_BRUMB RecName: Full=Flavoprotein wrbA;
    1::197     7e-55  54%  199 aa  WRBA_BRUO2 RecName: Full=Flavoprotein wrbA;
    1::206     2e-54  54%  209 aa  WRBA_METAC RecName: Full=Flavoprotein wrbA;
    1::197     5e-54  54%  199 aa  WRBA_BRUSU RecName: Full=Flavoprotein wrbA;
    1::197     5e-54  54%  199 aa  WRBA_BRUME RecName: Full=Flavoprotein wrbA;
    1::197     5e-54  54%  199 aa  WRBA_BRUC2 RecName: Full=Flavoprotein wrbA;
    1::197     6e-54  53%  199 aa  WRBA_BRUSI RecName: Full=Flavoprotein wrbA;
    1::206     1e-53  53%  209 aa  WRBA_METMA RecName: Full=Flavoprotein wrbA;
    1::197     1e-53  53%  199 aa  WRBA_BRUAB RecName: Full=Flavoprotein wrbA;
    1::197     1e-53  53%  199 aa  WRBA_BRUA2 RecName: Full=Flavoprotein wrbA;
    1::197     1e-53  53%  199 aa  WRBA_BRUA1 RecName: Full=Flavoprotein wrbA;
    1::197     1e-51  52%  199 aa  WRBA_OCHA4 RecName: Full=Flavoprotein wrbA;
    1::197     1e-50  53%  199 aa  WRBA_RHOPB RecName: Full=Flavoprotein wrbA;
    1::198     4e-49  49%  199 aa  WRBA_MESSB RecName: Full=Flavoprotein wrbA;
    1::197     5e-48  50%  199 aa  WRBA_RALME RecName: Full=Flavoprotein wrbA;
    1::197     9e-47  49%  199 aa  WRBA_MARAV RecName: Full=Flavoprotein wrbA;
    1::207     9e-45  47%  208 aa  WRBA_METBF RecName: Full=Flavoprotein wrbA;
    5::200     6e-44  46%  202 aa  WRBA_RHORT RecName: Full=Flavoprotein wrbA;
    1::200     3e-39  42%  247 aa  YCP4_YEAST RecName: Full=Flavoprotein-like protein YCP4;Flags:
    4::193     3e-38  44%  204 aa  ALTA7_ALTAL RecName: Full=Minor allergen Alt a 7;AltName:
    1::198     4e-35  43%  198 aa  PST2_YEAST RecName: Full=Protoplast secreted protein 2;Flags:
    4::201     1e-28  37%  204 aa  CLAH7_CLAHE RecName: Full=Minor allergen Cla h 7;AltName:
    2::169     8e-25  37%  176 aa  YHCB_BACSU RecName: Full=Uncharacterized protein yhcB;
    9::193     6e-24  34%  202 aa  P25_SCHPO RecName: Full=P25 protein;AltName: Full=Brefeldin A
    1::201     5e-22  35%  210 aa  RFS1_YEAST RecName: Full=Protein RFS1;AltName: Full=RAD55
    1::122     4e-14  39%  185 aa  FLAV_AQUAE RecName: Full=Flavodoxin;
   20::191     3e-12  28%  193 aa  ISF2_METJA RecName: Full=Iron-sulfur flavoprotein MJ1083;AltName:
    2::159     3e-10  33%  160 aa  FLAV_CLOSA RecName: Full=Flavodoxin;
   76::148     2e-07  38%  191 aa  ISF_METTE RecName: Full=Iron-sulfur flavoprotein;       
   67::147     1e-05  30%  201 aa  ISF3_ARCFU RecName: Full=Iron-sulfur flavoprotein AF_1896;AltName:
   76::149     3e-05  29%  198 aa  ISF1_METJA RecName: Full=Iron-sulfur flavoprotein MJ0731;       
  258::332     0.001  37%  404 aa  FPRA_METTM RecName: Full=Type A flavoprotein fprA;       
    1::200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKLLVLYYSMYGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAPIATVDELPEY
WRBA_NITOC      MTKLLVLYYSMYGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAPIATVDELPEY
WRBA_THICR      MTKVLVLYYSMYGHVETMAKAIAEGAGSVEGVEVTIKRVPELMTDEQAKKAGVKLDQSAPIATPSELADY
WRBA_BURCM      MAKVLVLYYSSYGHVETMAQHIAEGAKSVPGVEVTLKRVPETIPADQAKAIGVKVDQAAPVATVDELPNY
WRBA_BURA4      MAKVLVLYYSSYGHVETMAQHVAEGAKSVPGVEVTLKRVPETIPADQAKAIGVKVDQAAPVATVDELPNY
WRBA_BURPP      MAKVLVLYYSMYGHIETMADAVAEGARSVPGTEVTIKRVAETIPADQAAAHGVKLDQKAPVATPDELANY
WRBA_BURCJ      MAKVLVLYYSSYGHVETMAQHIVEGAKSVPGVEVTLKRVPETIPVDQARAIGVKVDQAAPVATVDELADY
WRBA_BURCC      MAKVLVLYYSSYGHVETMAQHIVEGAKSVPGVEVTLKRVPETIPVDQARAIGVKVDQAAPVATVDELADY
WRBA_BURM1      MAKVLVLYYSSYGHVETMAQQVAEGAKSVPGVEVTLKRVPETIPADQAKAIGIKTDQAAPVATVDELADY
WRBA_BURS3      MAKVLVLYYSSYGHVETMAQHIAEGAKSVAGVEVTLKRVPETIPVDQARAIGVKVDQAAPVATVDELADY
WRBA_BURCH      MAKVLVLYYSSYGHVETMAQHIVEGAKSVPGVEVTLKRVPETIPVDQARAIGVKVDQAAPVATVDELADY
WRBA_BURCA      MAKVLVLYYSSYGHIETMAQHIVEGAKSVPGVEVTLKRVPETIPVDQARAIGVKVDQAAPVATVDELADY
WRBA_BURVG      MAKVLVLYYSSYGHVETMAQHVAEGAKSVPGVEVTLKRVPETIPVDQAKAIGVKVDQAAPVATVDELANY
WRBA_ALHEH      MAKILVLYYSMYGHIRTMADAVAEGSREVSGTTVDIKRVPELMSEEALRKAGAP-ADDTPVARPEELADY
WRBA_AZOSB      MAKVLVLYYSSYGHIEKMXXXXXXXXXXXXXXX-TIKRVPELVPEEVARKSGMKLDQPAPVATVGELPDY
WRBA_METRJ      MAKVLVLYYSTYGHVEQMAYAVAEGARETG-AEVVVKRVPELVPEEVARQNHFKLDQAAPVATVAELADY
WRBA_RHOCS      MTKVLVLYYSSYGHIETMAQAVAEGARSVPGTEVAVKRVPELVPEEVARNAGMKLDQPAPVATVAELAEY
WRBA_AZOSE      --KVQIIFYSMYGHIFRMAEAVAEGARSVAGAEVGLFRVPELVPDEVLEKSGAKTAQQAPVAKTEQLPEA
WRBA_METEP      MAKVLVLYYSSWGHVEQMAKAVAEGARETG-AEVALKRVPELVPDEVAKQFHYKLDQEAPIATVEELADY
WRBA_METC4      MAKVLVLYYSSWGHVEQMAKAVAEGARETG-AEVALKRVPELVPDEVAKQFHYKLDQEAPIATVEELADY
WRBA_ACICJ      MAKVLVLYYSTWGHVETMXXXXXXXXXXXXXXX-TLKRVPETMPEDTAKAIHAKTDQDAPVATPAELADY
WRBA_AGRRK      MAKVLVLYYSAYGHIEKMAYAVAEGAKSAG-AEVTVKRVPELVPEEVAKASYFKLDQEAPIATPDELAEY
WRBA_AGRT5      MTKVLVLYYSSYGHIETMAYAVAEGVESTG-AEAVVKRVPELVPEEVAKSSHFKMDQPAPVATVDELAEY
WRBA3_RHIME     MTKMLVLYYSSYGHIEAMAKAVANGAKQAGAT-VALKRVPELVPEAVARSSGYRLGQEAPIATVAELADY
WRBA_RHIL3      MAKVLVLYYSAYGHIETMAYAVAEGAKSAG-AEVTVKRVPELVPEDVAKASYYKVDQAAPIATVDELADY
WRBA_ACIF5      MSRILVLYHSLWGHVEQMAEAEAEGARSVSGIQVDVRRVPETMPAETLAAVHAKTHQAAPEAHPDDLANY
WRBA_ACIF2      MSRILVLYHSLWGHVEQMAEAEAEGARSVSGIQVDVRRVPETMPAETLAAVHAKTHQAAPEAHPDDLANY
WRBA1_RHIME     MARVLVLYYSAYGHIETMAHAVAEGARSAG-AEVAVKRVPELVPEDVAKASHFKLDQPAPVATVEELADY
WRBA_SYNFM      --KVLIVFYSMYGHIYRMAEAVAEGVRSVDGAEAVLRRVPETLSAEILASMGATEAQKQPVCTVDELGAA
WRBA_PHOLL      MTKILVLYYSMYGHIEALASAVAEGAKKVADVEVTIKRVPETIPPEAFTKAGGKVDQSAPVASVQELVDY
WRBA_YERPY      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_YERPS      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_YERPP      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_YERPN      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_YERPG      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_YERPE      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_YERPB      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_YERPA      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_YERP3      MAKILVLYYSMYGHIETLAGAIAEGARKVSGVDVTIKRVPETMPAEAFAKAGGKTNQQAPVATPHELADY
WRBA_DESMR      ---VLIVYYSLYGHVAAMAQAVAEGVHQVPGMTATLRRVPETLSEEVIGKMGATEAQKAPACTLEELEDA
WRBA_YERE8      MAKILVLYYSMYGHIETLASAIAEGAQKVDGVEVTIKRVPETMPADAFAKAGGKTDQKAPVATPQELADY
WRBA_AZOVD      MKKILVLYYSMYGHIERMAEAVAEGARSVPGVEVTLKRVPETMPEEVARKAGAKLDQAAPPAEPKELADY
WRBA_GEOSL      ---VLIVYYSMYGHIHRMAEAVAEGVREVPGAEAVLRRVPETLSPDVLEKMGAVEPQKAPVATVDELASA
WRBA_MARMS      MTKVLVLYYSSYGHIEAMANEIAQGARSTG-AQVDIKRVPELMPEDVAKNSGVKLDQDAPVAKPDDLVNY
WRBA_GEOLS      MSKIQIVFYSMYGHIHTMAEAVADGVRSVGGCSAELLQVPELISEEVLEKYGXXXXXHIPTATVERLAEA
WRBA_METPB      MAKVLVLYYSSWGHVEQMXXXXXXXXXXXXXXXXX-KRVPELVPEEVARQFHYKLDQAAPIATVEELADY
WRBA_TOLAT      MTKVLVLYHSMYGHIETMANSIAEGAREVSGVEVTIKRVPETMDPARFAAAGGKTEQSAPVATPAELVDY
WRBA_DIAST      MSKVLVLYYSTYGHLETMAQAVAEGARSAGAT-VDVKRVPETVPQEIARSAHFKLDQSAPVATVTELENY
WRBA_CHRSD      MSKVLVLYYSSYGHVETLANAVAEGVRGVAGTQVDLYRVAELVPDEVAAKSGYK--EDTTAAVLDDLAEY
WRBA_SPHWW      MPKILVLYYSTYGHIETMAEAIAEGARSAG-AEVDVKRVPETVPLDIAEKNHFKLDQKAPVATVAELEDY
WRBA_SYNAS      --KIMVVYYSAYGHVHRLAEAVAEGASEIVDVEVVMRRVPETLPEALLKKIGVFEAQQAPVCEVAELETA
WRBA_BRASO      MTKVLVLYYSAYGHIEAMANAVAEGAREAGAT-VDIKRVPELVPDDVAKASYYKLDQAAPIAKIEELADY
WRBA_RHOP2      MAKVLVLYYSAYGHIETMANAVAEGAREAGAT-VDIKRVPELVPPDVAKASYYKLDQAAPVATIDDLANY
WRBA_OLICO      MTKVLVLYYSAYGHIEAMANAVAEGAREAG-ASVDIKRVPELVPAEVAKAAHFKLDQAAPVAKVEDLANY
WRBA_PARDP      MTDVLVLYYSSYGHVETMXXXXXXXXXXXXXXXXXXXX-PELVPEAVAERAGYKQDQRAPVATVGELADY
WRBA_BRASB      MTKVLVLYYSAYGHIEAMANAVAEGAREAGAT-VDVKRVPELVPDDVAKASHYKLDQAAPIAKIEELANY
WRBA_GEOSF      --KVLVVYYSMYGHIHRMXXXXXXXXXXXXXXXXXLRRVPETLSHDVLEKMGAVEAQRSPICTVDELAEA
WRBA_BRAJA      MTKVLVLYYSAYGHIEAMANAVAEGAREAG-VTVDIKRVPELVPAEVAKASYYKVDQAAPIAKIEDLTNY
WRBA_SALSV      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALNS      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALHS      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALG2      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALEP      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALDC      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALAR      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALA4      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_RHOPS      MAKVLVLYYSAYGHIEAMANAVAEGAREAGAT-VDIKRVPELVPPDVAKASHYKLDQAAPVATIGDLADY
WRBA_SALPK      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALPB      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALPA      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_RHOPT      MAKVLVLYYSAYGHIEAMANAVAEGAREAG-AQVDIKRVPELVPPDVAKASHYKLDQAAPVATIEDLANY
WRBA_SALTY      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_SALPC      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_METS4      MAKVLVLYYSTYGHIEQMXXXXXXXXXXXXXXX-DVKRVPELVPEDVARKSHFKLDQSAPLARVDELPNY
WRBA_RHOPA      MAKVLVLYYSAYGHIEAMANAVAEGAREAGAT-VDIKRVPELVPPDVAKASHYKLDQAAPVATIEDLANY
WRBA_RHISN      MAKVLVLYYSAYGHIEKMAYXXXXXXXXXXXXXXX-KRVPELVSEEVAKASHYKIDQPAPVATVEELGDY
WRBA_GEOUR      --KVLIAYYSMYGHIHRMXXXXXXXXXXXXXXXXLIRRVPETLPADVLEKMGAKMAQ-IPVCTIGELADA
WRBA_CITK8      MAKILVLYYSMYGHIETMAHAVAEGANKVDGAEVVIKRVPETMQPEIFAKAGGK-TQNAPVATPQELPDY
WRBA2_RHIME     MTRVLVLYYSSYGHIETMAGAVAEGARSTG-AEVTIKRVPETVPIEVADKAHFKLNQAAPVATVAELADY
WRBA_SERP5      MAKILVLYYSMYGHIETLAEAVAEGARRVSGVEVTLKRVPETIPAEAFAKAGGKQDQKAPVASPQELADY
WRBA_NITWN      MAKVLVLYYSAYGHIEAMANAVADGARQAGAT-VDVKRVPELVPEAVAKAKYFKLDQAAPLAKVDDLADY
WRBA_HALHL      MSKVLVLYYSMYGHVETLAQAVAEGARGAGS-EVVIKRVPETMPEDVARQAGAKLDQEAPVASLEELADY
WRBA_CAUCR      MAKVLVLYYSSYGHLEVMAKAIAEGAREAG-ASVDIKRVPETVPLEIAKGAHFKLDQDAPVAKVEDLADY
WRBA_CAUCN      MAKVLVLYYSSYGHLEVMAKAIAEGAREAG-ASVDIKRVPETVPLEIAKGAHFKLDQDAPVAKVEDLADY
WRBA_GLUDA      MTKVLVLYYSTYGHIETMXXXXXXXXXXXXXXX-DIKRVPETVPEDVARTHHFKLDQAAPIATPADLEAY
WRBA_SHIDS      MTKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ENT38      MAKVLVLYYSMYGHIETMAHAIAEGANKVDGVEVVIKRVPETMNAEAFLKAGGK-TQNAPQATPQELADY
WRBA_SALTI      MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGK-TQNAPVATPQELADY
WRBA_BURP8      MARVLVLYYSSYGHIEKMXXXXXXXXXXXXX-QVDIKRVPETVPEEIAKKANFKLDQQAPIATVADLEQY
WRBA_ZYMMO      MPKILVLYYSTYGHVESMXXXXXXXXXXXXXXX-DVKRVPELVPEEAAKKNHFKIDQKAPIAEPKDLLEY
WRBA_SHIFL      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_SHIF8      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOUT      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOSM      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOSE      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOLU      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOLI      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOLC      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOL6      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOL5      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOK1      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOHS      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECODH      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECOBW      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECO8A      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECO7I      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECO55      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECO45      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECO27      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ECO24      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_ESCF3      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVIVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_AZOC5      MAKVLVLYYSTYGHLETMXXXXXXXXXXXXXT-VDVKRVPETAPDEVAKAAHFKLDQAAPVATIADLEHY
WRBA_SHISS      --RILVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
WRBA_BEII9      MPKVLVLYYSSYGHIETMXXXXXXXXXXXXXXX-DVKRVPELVPEPVAKAHFFKLDQGAPIATPEDLVNY
WRBA_GEOMG      --KVLIPFYSMYGHIYRMAEAVAEGVREVSGAEAVLRRVPETLPTDVLQKMGAVEPQKAPVCTVDELAAA
WRBA_ECO5E      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMSPQLFEKAGGK-TQTAPVATPQELANY
WRBA_ECO57      MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMSPQLFEKAGGK-TQTAPVATPQELANY
WRBA_RHOP5      MAKVLVLYYSAYGHIETMXXXXXXXXXXXXXT-VDIKRVPELVPAEVAKASHYKLDQAAPVASIDDLANY
WRBA_XANP2      MAKVLVLYYSAYGHIEQMXXXXXXXXXXXXXT-VDIKRVPDLVPEEVAKSAHFKLDQKAPIATVAELAEY
WRBA_KLEP3      MAKILVLYYSMYGHIETMAHAVADGANRXXXXXXXXXXXPETMQAEAFAKAGGK-TQNAPVATPQELAEY
WRBA_PARL1      -TKVLVLYHSSYGHIETLAKAVAEGAASQAGTEVLLKRVPETMPADAMANAGMKVEQEAPVATPQELGDY
WRBA_CAUSK      MPKVLVLYYSAYGHIETMXXXXXXXXXXXXXT-VDIKRVPELVSEEIAKKSHYKLDQAAPIAKIDDLADY
WRBA_METSB      MAKVLVLYYSAYGHIEKMXXXXXXXXXXXXXXX-DIKRVPELVPLEIAQKSHFKLDQAAPVATIADLEHY
WRBA_BRUMB      MVKMLVLYYSAYGYMEQMXXXXXXXXXXXXXX-VTLKRVPELVPEEVAKASHYKIDQEAPIATPGELADY
WRBA_BRUO2      MVKMLVLYYSAYGHMEQMXXXXXXXXXXXXXX-VTLKRVPELVPEEVAKASHYKIDQEAPIATPGELADY
WRBA_METAC      MVKVNIIFYSMYGHVYRMXXXXXXXXXXXXXXXXXIYQVPETLPEEVLEKMGAKLFAHIPVLTREMNEEV
WRBA_BRUSU      MVKMLVLYYSAYGHMEQMXXXXXXXXXXXXXX-VTLKRVPELVPEEVAKASHYKIDQEAPIATPGELADY
WRBA_BRUME      MVKMLVLYYSAYGYMEQMXXXXXXXXXXXXXX-VTLKRVPELVPEEVAKASHYKIDQEAPIATPGELADY
WRBA_BRUC2      MVKMLVLYYSAYGHMEQMXXXXXXXXXXXXXX-VTLKRVPELVPEEVAKASHYKIDQEAPIATPGELADY
WRBA_BRUSI      MVKMLVLYYSAYGHMEQMXXXXXXXXXXXXXX-ITLKRVPELVPEEVAKASHYKIDQEAPIATPGELADY
WRBA_METMA      MVKVNIIFHSVHAHIYRMXXXXXXXXXXXXXXXXXIYQVPETLPEDVLEKMGAKLFAHIPVVTEDVLAGA
WRBA_BRUAB      MVKMLVLYYSAYGYMEQMXXXXXXXXXXXXXX-VTLKRVPELVPEEVAKASHYKIDQEVPIATPGELADY
WRBA_BRUA2      MVKMLVLYYSAYGYMEQMXXXXXXXXXXXXXX-VTLKRVPELVPEEVAKASHYKIDQEVPIATPGELADY
WRBA_BRUA1      MVKMLVLYYSAYGYMEQMXXXXXXXXXXXXXX-VTLKRVPELVPEEVAKASHYKIDQEVPIATPGELADY
WRBA_OCHA4      MVKVLVLYYSAYXXXXXXXXXXXXXXXXXXXX-VTIKRVPELVPPDVAKASHYKIDQDAPIATPAELADY
WRBA_RHOPB      MAKVLVLYYSAYGHIETMANAVAEGAREAGAT-VDIKRVPELVPPEIAKASHYKLDQAAPIATVDDLANY
WRBA_MESSB      MAKILVLYYSSWGHXXXXXXXXXXXXXXXXX-NVTIKRVPELVPEEVARKAHYKLEQEAQIATPLELADY
WRBA_RALME      MSKVLVLYYSTYGHXXXXXXXXXXXXXXXXXXX-DVKRXXXXXXXXXXXXSHFKVDQKAPVATVEDLANY
WRBA_MARAV      MAKVLVLYYSMYGHIETMANTXXXXXXXXXXXXXXXXXXPETMADEAFLNAGGKADQGAPVADPKELADY
WRBA_METBF      MVKVNVIFHSIHGHTYKMXXXXXXXXXXXXXXXXXXYQVPETLPYEVLEKMGANLFAHIPVVTEDVFAGA
WRBA_RHORT      -TKVLVLYYSMYGHIDTLAKEIXXXXXXXXXXXXXLKRVPEHMSAELLSTIHARTDFDTPIASVDELADY
YCP4_YEAST      MVKIAIITYSTYGHIDVLAQAVKKGVEAAGG-KADIYRVEETLPDEVLTKMNAQKPEDIPVATEKTLLEY
ALTA7_ALTAL     --KIAIVYYSMYGHIKKMADAELKGIQEAGG-DAKLFQVAETLPQEVLDKMYAP-PKDSSVPVLEDLEEF
PST2_YEAST      MPRVAIIIYTLYGHVXXXXXXXXXXXXXXXXXX-DIYQVEETLSPEVVKALGGAPKPDYPIATQDTLTEY
CLAH7_CLAHE     --KIAIIFYSTWGHVQTLAEAEAKGIREAGG-SVDLYRVPETLTQEVLTKMHAPPKDDSIPEITDPLEQY
YHCB_BACSU      --KIYVVYDSEGEHTKVLAEAIAEGARENDAAEVFIDHVDQ--------------------ADIRKLKDM
P25_SCHPO       -----IVIYSTYGHVVKLXXXXXXXXXXXXXXXV-IYQFPETLSPEILEKMHAAPKPNYPVVTLDVLTQY
RFS1_YEAST      MPKVAILIYSVDDIIATLAENEKKGIE-IAGGEAEIFQVPDVSYKEYATEEGKEAAKVAKILTRETLVEY
FLAV_AQUAE      MGKVLVIYDTRTGNTKKMAELVAEGARSLEGTEVRLKHVDE--------------------ATKEDVLWA
ISF2_METJA      --------------VREALNAIAEEGIETEFISLADKELNPCIGCNMCKEEGKCPIIDDVDEILKKMKEA
FLAV_CLOSA      --KISILYSSKTGKTERVAKLIEEGVKRSGNIEV----------------------KTMNLDAVDKLQES
ISF_METTE       ----------------------------------------------------------------------
ISF3_ARCFU      ---------------------------------------------------------------LEKMQEA
ISF1_METJA      ----------------------------------------------------------------------
FPRA_METTM      --RVTVIYDTMHGSTRKMAHAIAEGAMS-EGVDVRVYCLHEDDRSEIVKDLGAPTIYDEPYPSVGDLLMY


                         .         .         *         .         .         .         .:140
query           DAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHGGQETTITSFHSTLLHQGMVI
WRBA_NITOC      DAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHGGQETTITSFHSTLLHQGMVI
WRBA_THICR      DAIIFGTPTRFGNMCAQMRNFLDQTGGLWAGGKLINKVGSVFTSTGTQHGGQETTITSFHTNLFHYGMIV
WRBA_BURCM      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHQGMVI
WRBA_BURA4      DAIIFGTPTRFGNMAGQMRTFLDQTGCLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHQGMVI
WRBA_BURPP      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHSTLLHQGMVI
WRBA_BURCJ      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVI
WRBA_BURCC      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVI
WRBA_BURM1      DAILFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVI
WRBA_BURS3      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVI
WRBA_BURCH      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVI
WRBA_BURCA      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVI
WRBA_BURVG      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGALVGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVI
WRBA_ALHEH      DGIIFGSPTRFGNMAGQMRNFLDQTGGLWAQGKLIGKVGSVFTSTGSQHGGQETTLTSMQTTLMHHGMVI
WRBA_AZOSB      DAIIFGTPTRFGNMASQMRNFLDQTGGLWMSGKLVGKVGSVFASTATQHGGQETTITSFHTTLLHHGMVI
WRBA_METRJ      DAIIFGTPTRYGNMASQMKQFIDQTGGLWMKGALVGKVGSVFTSTASQHGGQETTLTSFHTVLFHHGMVV
WRBA_RHOCS      DAIIVGSPTRFGRMTSQMANFLDQTGGLWAKGALNGKVGAAFTSTASQHGGQETTLFSILTNLLHHGMVV
WRBA_AZOSE      DAIIFGTPTRFGNMCAQMRNFLDQTGGLWMKGSLVGKVGSVFTSTATQHGGQESTILSTHITLLHQGMVL
WRBA_METEP      DAIIFGTPTRYGNMASQMKQFIDQTGGLWAKGALVGKVGSAFTSTASQHGGQETTLTSFHTVLFHHGMVV
WRBA_METC4      DAIIFGTPTRYGNMASQMKQFIDQTGGLWAKGALVGKVGSAFTSTASQHGGQETTLTSFHTVLFHHGMVV
WRBA_ACICJ      DAIIFGTPTRFGNMCGQMRNFLDQTGGLWAKGALIGKVGSVFASTGTQHGGQETTITSFHTTLFHHGMIV
WRBA_AGRRK      DAIIVGAGTRFGTVASQMRNFWDQTGGLWFSGKLVGKVGSVFTSSATQHGGQESTILGFIPTLLHHGMAV
WRBA_AGRT5      DAIIVGAGTRFGTVASQMRNFWDQTGGLWFSGKLVGKVGSAFTSSATQHGGQESTILGFIPTFLHHGMAV
WRBA3_RHIME     DAIVIGTPTRFGNMASQMKNFLDQTGGLWAENKLVGKVGSVFTSTGSQHGGQESTILSTHVVMLHLGMVI
WRBA_RHIL3      DAIIVGAGTRFGTVASQMRNFWDQTGGLWFAGKLVGKLGSVFTSSATQHGGQESTILGFIPTFLHQGMVV
WRBA_ACIF5      DGIIFGTPTRFGNMTGQMRNFLDRTGNLWQEGRLVGKVGSVFVSTATQHGGQEXXXXXXXXXXXXQGMLV
WRBA_ACIF2      DGIIFGTPTRFGNMTGQMRNFLDRTGNLWQEGRLVGKVGSVFVSTATQHGGQEXXXXXXXXXXXXQGMLV
WRBA1_RHIME     DAIIFGAGTRYGTVASQLRNFIDQTGGLWAKGKLVGKVGSAFTSSATQHGGQESTILGLIPTMMHHGMVV
WRBA_SYNFM      DAVIFGTPTRFGNMAGQMRQFLDATGRLWVSGALVGKAGSVFTSSNTQHGGQESTILSFHINLLHQGMVI
WRBA_PHOLL      DAIIIGTPTRFGNMAGQMRNFLDQTGGLWAEGKLYGKVASVFTST-GVGGGQEMTITSTWTTLAHHGFII
WRBA_YERPY      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_YERPS      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_YERPP      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_YERPN      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_YERPG      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_YERPE      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_YERPB      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_YERPA      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_YERP3      DGIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_DESMR      DAIVFGTPTRFGNMCGQMRQFLDATGQIWMRGGLVGKPGGVFCSTATQHGGQETTLMSFIQTLLHHGMIV
WRBA_YERE8      HGIIFGTPTRFGNMAGQMRTFLDQTGGLWASGALYGKVASVFASTGT-GGGQEHTITSTWTTLAHHGFII
WRBA_AZOVD      DAILFGTPTRFGNMAGQMRNFLDQTGGLWVSGALVGKFASVFXXXXXXXXXXXXXXXFWH-TLAHHGMVI
WRBA_GEOSL      DAIIFGTPTRFGNMCGQMRQFLDATGGLWVKGSLVGKAAGVFTSSATQHGGQESTILTFHTFLLHQGMVI
WRBA_MARMS      DAVIFGSPTRFGNMASQMRNFLDMTGGLWAQGKLVGKIGSVF-XXXXXXXXXXXXIQSFHTTLFHHGFVV
WRBA_GEOLS      DAIIFGTPTRFGNMAAQMRNFLDQTXXXXXXXXXXXXXXXXFASTATQHGGQETTITSFHSTLLHHGMII
WRBA_METPB      DAIIFGTPTRYGNMASQMKQFIDQTGGLWAKGALVGKVGSAFTSTASQHGGQETTLTSFHTVMFHHGMVV
WRBA_TOLAT      DAIIFGVPTRFGNMTAQMRNFLDQTGGLWAKGALFGKIASVFAST-GVGGGQEMTITSTWTTLAHHGMVI
WRBA_DIAST      DAIIVGAPTRFGRMPSQMGSFLDQAGGLWARGALNGKVGAAFTSTATQHGGQETTLFSIITNLLHFGMVI
WRBA_CHRSD      DAIVVGTPTRFGNMASQMRNFWDKTGGLWAQGKLIGKLGGAFTSTASQHGGQEXXXXXXXXXXXXXGMAV
WRBA_SPHWW      DAIIVGTGTRFGRMSSQMAAFLDGAGGLWARGALNGKVGAAFASTATQHGGQETTLFSIITNLLHFGMTI
WRBA_SYNAS      DAILFGTPARFGNMCGQMRSFLDATGGLWAKGALVGKVGSVFTSTGTQHGGQESTILSFHTTLLHHGMII
WRBA_BRASO      DAIIVGTGTRFGRMASQMANFLDQAGGLWAKGALNGKVGGAFTSTATQHGGQETTLFTIITNLLHFGMTI
WRBA_RHOP2      DAIIVGTGTRFGRMASQMANFLDQAGGLWAKGALNGKVGGAFTSTATQHGGQETTLFSIITNLLHFGMVV
WRBA_OLICO      DAIIVGTGTRFGRMSSQMANFLDQAGGLWAKGALHGKVGGAFTSTATQHGGQEMTLFSIITNLLHFGMVV
WRBA_PARDP      DAIIIGTPTRFGNMASQMKNFLDQTGGLWAEDRLVGKVGSVFTSTGSQHGGQETTIQSTHTVLLHLGMIV
WRBA_BRASB      DAIIVGTGTRFGRMASQMANFLDQAGGLWARGALNGKVGGAFTSTATQHGGQETTLFTIITNLLHFGMTI
WRBA_GEOSF      DAVIFGSPTRFGNMCGQMRQFLDATGGLWVKGSLIGKVGSVFASSNTQHGGQESTILSFHTTLLHHGMVI
WRBA_BRAJA      DAIIVGTGTRFGRMGSQMANFLDQAGGLWAKGALHGKVGGAFTSSATQHGGQETTLFSIITNLLHFGMVV
WRBA_SALSV      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALNS      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALHS      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALG2      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALEP      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALDC      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALAR      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALA4      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_RHOPS      DAIVVGTGTRFGRMASQMANFLDQAGGLWAKGALHGKVGGAFTSTATQHGGQETTLFSIITNLLHFGMVV
WRBA_SALPK      DAIIFGTPTRFGNMPGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALPB      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALPA      DAIIFGTPTRFGNMPGQMRTFLDQTGGLWASGALYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_RHOPT      DAIVIGTGTRFGRMASQMSNFLDQAGGLWARGALNGKVGGAFTSTATQHGGQETTLFSIITNLLHFGMVV
WRBA_SALTY      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGSLYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALPC      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGSLYGKLGSVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_METS4      DAIIFGTPTRYGNMASQMKNFLDQTGGLWMKGALVGKVGSVFTSSASQHGGQESTILSFHTXXXXXXXXX
WRBA_RHOPA      DAIVIGTGTRFGRMASQMSNFLDQAGGLWARGALNGKVGGAFTSTATQHGGQETTLFSIITNLLHFGMVV
WRBA_RHISN      DAIIFGAGTRYGTVASQLRNFIDQTGSLWAKGKLVGKVGSAFTSSATQHGGQESTILGLIPTMLHHGMVV
WRBA_GEOUR      DAIIFGTPTRFGNMCGQMRQFLDATGGLWMKGSLVGKLGSVFTSSATQHGGQESTILSFHITLLHQGMVV
WRBA_CITK8      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA2_RHIME     DAIIVGTGTRFGRMSSQMAVFLDQAGGLWARGALNGKVGGAFVSTGTQHGGQETTLFSIITNLMHFGMVI
WRBA_SERP5      DGIIFGTPTRFGNMAGQMRTFLDQTGGLWASGALY-XXXXXXXXXXXXXXXQEHTITSTWTTLAHHGFII
WRBA_NITWN      DAIVVGTGTRFGRMSSQMASFLDQAGGLWARGALHGKVGGAFSSSATQHGGQETTLFSIITNLLHFGMTI
WRBA_HALHL      DAILFGTPTRFGNMAGQMRNFLDQTGSLWFNGQLIXXXXXXXXXXXXXXXXXXXXXSFWH-TLAHHGMVI
WRBA_CAUCR      DAIIVGAPTRFGRMASQMAAFFDAAGGLWARGALHGKVAGAFTSTATQHGGQETTLFSIITNMLHFGTTI
WRBA_CAUCN      DAIIVGAPTRFGRMASQMAAFFDAAGGLWARGALHGKVAGAFTSTATQHGGQETTLFSIITNMLHFGTTI
WRBA_GLUDA      DAIIVGTPTRFGRMASQMASFWDQTGGLWMKGALIGKVGAAFTSTATQHGGQETTLFSVITNLLHQGMVI
WRBA_SHIDS      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ENT38      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWATGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SALTI      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLXXXXXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_BURP8      DAIVVGTGTRYGRISSQMAAFLDQTGGLWMRGALNGKVGAAFASTATQHGGQETTLFSIITNLMHLGMII
WRBA_ZYMMO      DGIIVGAPTRFGRLPSQMANFWDRTGGIWAQGALIGKVGAVFTSTATQHGGQETTLYSLMSSLLHHGLVI
WRBA_SHIFL      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_SHIF8      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOUT      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOSM      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOSE      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOLU      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOLI      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOLC      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOL6      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOL5      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOK1      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOHS      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECODH      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECOBW      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECO8A      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECO7I      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECO55      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECO45      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECO27      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECO24      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ESCF3      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_AZOC5      DAIIVGAPTRFGRIASQMAAFLDQAGGLWFRGALNGKVGAAFTSTATQHGGQETTLFSIITNLLHFGMVI
WRBA_SHISS      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_BEII9      DAIIIGAPTRFGRLPAQMANFWDMTGGLWLKGALIGKVGAAFTSTAVQHGGQETTLYSLLTNLIHHGMVV
WRBA_GEOMG      DAIIFGTPTRFGNMCGQMRQFLDATXXXXXXXXXXXXXXXXFTSSATQHGGQESTILTFHTFLLHQGMVL
WRBA_ECO5E      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_ECO57      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFXXXXXXXXXXXXXXXXW-TTLAHHGMVI
WRBA_RHOP5      DAIIVGTGTRFGRMASQMANFLDQAGGLWAKGALHGKVGGAFTSTATQHGGQETTLFSIITNLLHFGMVV
WRBA_XANP2      DAIIVGVGTRFGRMASQMANFLDQAGGLWARGALNGKVGGAFTSTATQHGGQEVTLFSIITNLMHFGMVI
WRBA_KLEP3      DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKIASVFXXXXXXXXXXXXXXXXW-TTLAHHGMII
WRBA_PARL1      DAVIFGTPTRFGNMTGQMRTFLDQTGGLWAKGAL-XXXXXXXXXXXXXXXXXXXXXXSFHTNLFHHGMVV
WRBA_CAUSK      DAIIVGTGTRFGRMSSQMAAFLDQAGGLWARGALNGKVGAAFTSSATQHGGNETTLFSIITNLLHFGLTI
WRBA_METSB      DAIIVGTGTRFGRMSSQMANFLDQAGGLWMRGALNGKVGAAFTSTATQHGGQEVTLFSIITNLLHFGLVI
WRBA_BRUMB      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMII
WRBA_BRUO2      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMII
WRBA_METAC      DALIFGTPTRYGNMTAQMRAVLDGLGGLWNRDAFVGKVGSVFTSSGTQHGGQESTILTFHVTLLHLGMIL
WRBA_BRUSU      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQYGGAELALISTQWQMQHHGMII
WRBA_BRUME      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMII
WRBA_BRUC2      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQYGGAELALISTQWQMQHHGMII
WRBA_BRUSI      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQYGGAELALISTQWQMQHHGMII
WRBA_METMA      DALIFGTPTRYGMMTAQMRAVLDGLGKLWSEDAFVGKVGSVFTSSGTQHGGQESTILSFHVTLLHLGMVI
WRBA_BRUAB      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMII
WRBA_BRUA2      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMII
WRBA_BRUA1      DAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMII
WRBA_OCHA4      DAIIIGTATRYGMMAAQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHQGMII
WRBA_RHOPB      DAXXXXXXXXXXXXXSQMANFLDQAGGLWAKGVLHGKVGGAFTSTASQHGGQETTLFSIITNLLHFXXXX
WRBA_MESSB      DGFIFGVSTRYGMMSSQLKNFLDQTGPLWAAGKLVNKPATVMVSTATQHGGAEIALASTQLALQHHGMII
WRBA_RALME      DAIVVGTPTRFGRISSQMAAFLDQAGGLWMRGVLNGKVGGAFTSTATQHGGQEATLFSIIANLLHFGMTI
WRBA_MARAV      DAIIFGTPTRFGNMAGQMRTFLDQTGGLWAEGKL-HXXXXXXXXXXXXXXXXXXXXXXFWTTLAHHGMVL
WRBA_METBF      DALIFGTPTRYGNMTAQMRTVFDGLGGLWSRDALVGKVGSVFTSSGTQHGGQESXXXXXXXXXXXXGMII
WRBA_RHORT      DGILIGTPTRFGNMAGQMRNFLDQT-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLSVYTNFLHHGMVV
YCP4_YEAST      DAFLFGVPTRFGNLPAQWSAFWDKTGGLWAKGSLNGKAAGIFVSTSSYGGGQESTVKACLSYLAHHGIIF
ALTA7_ALTAL     DGILFGIPTRYGNFPAQFKTFWDKTGKQWQQGAFWGKYAGVFVSTGTLGGGQETTAITSMSTLVDHGFIY
PST2_YEAST      DAFLFGIPTRFGNFPAQWKAFWDRTGGLWAKGALHGKVAGCFVSTGT-GGGNEATIMNSLSTLAHHGIIF
CLAH7_CLAHE     DRFPHGHPTRYGNFPAQWRTFWDRTGGQWQTGAFWGKYAGLFISXXXXXXXXESTALAAMSTLSHHGIIY
YHCB_BACSU      DAIIWGCPGHFGTISSGLKTWIDRLGYLWAEGELINKVGAVFCTTATTHGGLEMTMHNLITPMFHQGMIV
P25_SCHPO       DAFLFGYPTRYGTPPAQFRTFWDSTGGLWVQGALHGKYFGQFFSTGTLGGGQESTALTAMTSFVHHGMIF
RFS1_YEAST      DYYLFGIPTKFGNFPAEWKSFWDNTGGLWAKGSLHGKIAGLFVSGASGKGDTEMCIMNAMSTLVHHGVIY
FLAV_AQUAE      DGLAVGSPTNMGLVSWKMKRFFDDVGDLW--GEIDGKIACAFSSSGGWGGGNEVACMSILTMLMNFGFLV
ISF2_METJA      DGIILGSPVYFGGVSAQLKMLMDRSRPLRIGFQLRNKVGGAVAVGASRNGGQETTIQQIHNFFLIHSMIV
FLAV_CLOSA      EGIIFGTPTYYANISWEMKKWIDESSEF----NLEGKLGAAFSTANSIAGGSDIALLTILNHLMVKGMLV
ISF_METTE       DGIIVAAPVYMGNYPAQLKALFDRSVLRRKNFALKNKVGAALSVGGSRNGGQEKTIQSIHDWMHIHGMIV
ISF3_ARCFU      DAIVIGTPTYFGNVTGIVKNLIDRSRMARMGNRLRNRVFAPVVTSGLRNGGAEYAAMSLIVYALGQAMLP
ISF1_METJA      DGVIIGTPVYQGNVTGQLKTLMDRCRAILAKNVLRGRVGMAIAVGGDRNGGQEIALRTIHDFFIINEMIP
FPRA_METTM      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VGVPYSCQALLNMNEITGGSPYGASTLADADGSRQPSENELTIARFQGEHVAKFTKKVVE
WRBA_NITOC      VGVPYSCQALLNMNEITGGSPYGASTLADADGSRQPSENELTIARFQGEHVAKFTKKVVE
WRBA_THICR      VGVPYSCQEMTNMNEITGGTPYGASTLAGGDGSRQPSENEIKIAKCQGVHVAKVAKK---
WRBA_BURCM      VGVPYACSGLVNMSEITGGTPYGATTLAGADGSRQPSANELDIARYQGKHVAELAVKL--
WRBA_BURA4      VGVPYACSGLVNMSEITGGTPYGATTLAGADGSRQPSANELDIARYQGKHVAELAVKL--
WRBA_BURPP      VGVPYSCAGLVNMTEITGGTPYGATTLAGADGSRQPSQNELDIARFQGKHVASLALKI--
WRBA_BURCJ      VGVPYACSGLVNMNEITGGTPYGATTLAGADGSRQPSANELDIARYQGKHVAELANKL--
WRBA_BURCC      VGVPYACSGLVNMNEITGGTPYGATTLAGADGSRQPSANELDIARYQGKHVAELASKL--
WRBA_BURM1      VGVPYACSGLVNMNEITGGTPYGATTLAGADGSRQPSANELDIARYQGKHVAELAVKL--
WRBA_BURS3      VGVPYACSGLVNMNEITGGTPYGATTLAGADGSRQPSANELDIARYQGKRVAELASKL--
WRBA_BURCH      VGVPYACSGLVNMSEITGGTPYGATTLAGADGSRQPSANELDIARYQGKHVAELASKL--
WRBA_BURCA      VGVPYACSGLVNMSEITGGTPYGATTLAGADGSRQPSANELDIARYQGKHVAELASKL--
WRBA_BURVG      VGVPYACSGLVDMKEITGGTPYGATTLAGADGSRQPSANELDIARYQGKHVAQLAAKL--
WRBA_ALHEH      VGVPYSCAALTNMDEITGGTPYGASTLAGPDGSRQPSENELTIARFQGRHVAEITQKL--
WRBA_AZOSB      VGLPYTEARQMNMDEITGGSPYGATTLAKGDGTRQPSENELAMARFQGGHVAKIAAKL--
WRBA_METRJ      VGLPYSFQGQAGVEAVKGNTPYGASTIADGDGSRQPSAVELEGARFQGRHVAGIAAKL--
WRBA_RHOCS      VGLPYSYEGLSGVEQVKGGTPYGASTIADGDGSRRPTEVELGGARYQGALVARTAAKL--
WRBA_AZOSE      VGLPYTEKRQMGMDEILGGSPYGAATIAGGDGSRMPSQTEIEMAKFQGRHVAEIASALV-
WRBA_METEP      VGLPYSFAGQNGVEQVKGNSPYGATTIADGDGSRQPSEVELDGARFQGRHVAGIAAKL--
WRBA_METC4      VGLPYSFAGQNGVEQVKGNSPYGATTIADGDGSRQPSEVELDGARFQGRHVAGIAAKL--
WRBA_ACICJ      VGVPYSNPELTNMNEITGGTPYGATTLAGADGSRQPSANELAIARAQGKHVAGIAAKL--
WRBA_AGRRK      VGLPYAFAGQMGTEEVKGGSPYGASTITNGDGSRQPSEIELEAAKYQGAHVAKIAAKLV-
WRBA_AGRT5      VGLPYAFQGQMGVDEIKGGSPYGASTITDGDGSRQPSAIELDAARYQGAHVAKLAAKL--
WRBA3_RHIME     VGLPYSFKGQMRMDEITGGSPYGASTLAEDENDRSPSANELDGARFQGRHVAE-------
WRBA_RHIL3      AGLPYAFQGQMGTEEVKGGSPYGASTITNGDGSRQPSEIELEGAKYQGAHVAKLAAKL--
WRBA_ACIF5      VGVPYSCTELMNMDEISGGTPYGASTMSKGDGSRQPSANELTIARFQGRHVAEITRKL--
WRBA_ACIF2      VGVPYSCTELMNMDEISGGTPYGASTMSKGDGSRQPSANELTIARFQGRHVAEITRKL--
WRBA1_RHIME     VGLPYAFQGQMGVEEVKGGSPYGASTITGGDGSRQPSAVELEAARFQGAHVARIAAKLAD
WRBA_SYNFM      VGLPYSFQGQSTMDEITGGSPYGASTIAGPTGARTPSDNELAGARYQGRHVAEIARKL--
WRBA_PHOLL      VPIGYGIPEIGDISQMQGGTPYGASTIADGDGSRIPNENELKIARYQGEHVAKIAKKL--
WRBA_YERPY      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_YERPS      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_YERPP      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_YERPN      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_YERPG      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_YERPE      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_YERPB      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_YERPA      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_YERP3      VPIGYGAKELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_DESMR      VGLPYSFAGQMRLDEVTGGSPYGATTIAGGDGSRMPSENELDAARFQGRHIADVTRRL--
WRBA_YERE8      VPIGYGATELFDVSQTRGGTPYGATTIAGGDGSRQPSAEELAIARFQGEHVAKITAKL--
WRBA_AZOVD      VGLPYVLPELSDVSEPRGGSPYGAATIAGADGSRRPSEKELILASFQGAHVARLVVRM--
WRBA_GEOSL      VGLPYAFAGQTRIDEITGGSPYGASTIAGGQGERLPSENDLAGARFQGRYVAQIAAKL--
WRBA_MARMS      VGLPYSCPELADISEVKGGSPLGAGTIAGADGSRMPSDKEIAMARFQGKHVAEIAAKL--
WRBA_GEOLS      VGVPYTEQRLLTMDEISGGSPYGATTLAGGDGSRRPSENELAIARFQGAHVAKITARL--
WRBA_METPB      VGLPYSFAGQNGVEQVKGNSPYGATTIADGDGSRQPSQVELDGARFQGRHVAGIAAKL--
WRBA_TOLAT      VPIGYGTAEMFDISHVGGGTPYGATTLAGGDGSRQPDARELAIARFQGKHVATVAAKM--
WRBA_DIAST      VGLPYSFQGQMTLDEVVGGAPYGATTIAGGQGQRQPSATELDGARFQGRLVAETANKL--
WRBA_CHRSD      VGVPYSCPALTELDEVSGGTPYGATTIAGGDGSRQPSENELTIARFQGQHIAEMAAKL--
WRBA_SPHWW      VGLPYAYQGQMGVDEVKGGAPYGATTIADGDGSRQPSATDLDGARFQGRHVAEITAKLV-
WRBA_SYNAS      VGLPYTFQGQSRNDEITGCSPYGASTIAGSANDRWPTENELAGANFQGRHVACIAGKLFQ
WRBA_BRASO      VGLNYGFAGQMKLDEVTGGSPYGATTITGGDGSRQPSENELAGARYQGRVIAETAKKL--
WRBA_RHOP2      VGLNYGFQGQMTLGEITGGAPYGATTLTGGDGARQPSANELAGARYQGKTIAETAIKL--
WRBA_OLICO      VGLNYGFAGQMGVKEVTGGAPYGATTITDGDGSRLPSENELNGARYQGRTIAETAKKL--
WRBA_PARDP      VGLPYSFKGQMRMDEITGGSPYGASTLADDGGDRQPSANELDGARFQGRHVAEIAAALV-
WRBA_BRASB      VGLNYGFAGQMKLDEVTGGSPYGATTITGGDGSRLPSENELAGARYQGRVIAETAKKL--
WRBA_GEOSF      VGLPYAFQGQMRNDEITGGSPYGASTVAGTQGERQPTENELAAARYQGKHVASIAYKLV-
WRBA_BRAJA      VGMNYGFAGQMKLDEVTGGAPYGATTITGGDGSRQPSANELAGARYQGRQIAETARKL--
WRBA_SALSV      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALNS      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALHS      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALG2      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALEP      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALDC      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALAR      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALA4      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_RHOPS      VGLNYGFAGQMKLDEVTGGAPYGATTITGGDGSRQPSANELAGARYQGKTIAETAIKL--
WRBA_SALPK      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALPB      VPIGYAAQELFDVSHVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALPA      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_RHOPT      VGLNYGFGDQMRLDQVTGGAPYGATTITGGDGSRQPSETELAGARYQGKTIAETAIKL--
WRBA_SALTY      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SALPC      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_METS4      XXXPYAFQGQLGVSQVMGNSPYGASTIADGDGSRQPSPIELDGARYQGRHVAGIAAKL--
WRBA_RHOPA      VGLNYGFGDQMRLDQVTGGAPYGATTITGGDGSRQPSETELAGARYQGKTIAETAIKL--
WRBA_RHISN      VGLPYAFQGQMGIDEIKGGSPYGASTITGGDGSRQPSEIELDAARFQGAHVARIAAKLAD
WRBA_GEOUR      VGLPYAFQGQMRNDEIIGGSPYGASTIAGTQGERSPSENDLAAARYQGKHVASIAARL--
WRBA_CITK8      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA2_RHIME     VGLPYSHQGQMSVDEIVGGAPYGATTVAGGDGSRQPSQIDLAGAFHQGE-----------
WRBA_SERP5      VPIGYATPELFDVSHVRGGTPYGATTIAGGDGSRQPSQEELTIARYQGEHVAKITAKL--
WRBA_NITWN      VGLNYGFAGQMGVKEVTGGAPYGATTIADGDGSRPPSENELAGARYQGRMIAETAAKL--
WRBA_HALHL      VGLSYAAPELADLSVVKGGSPYGAGTIAGGDGSRQPNEQELALARYQGRHVAEIAQRL--
WRBA_CAUCR      VGLDYGHAGQMTLDEITGGSPYGATTIAGGDGSRQPSENELTGARYQGRKIAETAIKL--
WRBA_CAUCN      VGLDYGHAGQMTLDEITGGSPYGATTIAGGDGSRQPSENELTGARYQGRKIAETAIKL--
WRBA_GLUDA      SGLPYNFQGQMRLDEITGGAPYGATTIAAGDGSRAVSDNERDGARFLGQHVAQIAAKL--
WRBA_SHIDS      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ENT38      VPIGYGAQELFDVSAVRGGTPYGATTIAGGDGSRQPSQEELAIARFQGEHVAGLAKKL--
WRBA_SALTI      VPIGYSAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_BURP8      VGLPYSHQGMMNMTEIVGGAPYGATTIAAGDGSRQPSAIDLEGARHQGELVAKTAAKL--
WRBA_ZYMMO      SGLPYSFQGQGRLDEVTGGAPYGATTIAASDGSRQPSKNELDGAKFLGKHVAELAKKL--
WRBA_SHIFL      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_SHIF8      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOUT      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOSM      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOSE      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOLU      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOLI      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOLC      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOL6      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOL5      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOK1      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOHS      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECODH      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECOBW      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECO8A      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECO7I      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECO55      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECO45      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECO27      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECO24      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ESCF3      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_AZOC5      VGLPYSHQGQMSMSEIVGGAPYGATTLAAGDGSRQPSEIDLAGARHQGELVAKTAAKL--
WRBA_SHISS      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_BEII9      AGLPYSFAGQMNMNEITGGSPYGATTIANGDGSRAVSANEQEGAKFLGRHVAEIAQKL--
WRBA_GEOMG      VGLPYAFAGQMRIDEITGGSPYGASTIAGGQGERLPSENELAGARYQGKYIAEIAAKL--
WRBA_ECO5E      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_ECO57      VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
WRBA_RHOP5      VGLNYGFAGQMTLDEVTGGSPYGATTITGGDGSRQPSANELAGARYQGQVIAETAIKL--
WRBA_XANP2      VGLDYGYGAQMTLDEVTGGSPYGATTITGGDGSRQPSAIELDGARYQGRKIAETAIKL--
WRBA_KLEP3      VPIGYGAQELFDISQVRGGTPYGATTIAGGDGSRQPSEEELAIARYQGEHVAKLAVKV--
WRBA_PARL1      VGLPYSVTELFDISEVRGGSPYGASTLAGGDGKRQPTEKELSLARKQGAHVASIAAKL--
WRBA_CAUSK      VGLPYSHAGQMTLEEITGGAPYGATTIAGGDGSRQPSQIELDGARHQGELVAKTAAKL--
WRBA_METSB      VGLDYGFAGQGRLDEITGGSPYGATTIAASDGSRQPSETELAGARYQGRRVAEVAGKL--
WRBA_BRUMB      VPLSYACREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL--
WRBA_BRUO2      VPLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDDARFQGRRVAEITAKL--
WRBA_METAC      VGLPYSEKRQTRMDEITGGSPYGVSTIAGGDGSRQPSENELAMARYQGRHVTLIAKKI--
WRBA_BRUSU      VPLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL--
WRBA_BRUME      VPLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL--
WRBA_BRUC2      VPLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL--
WRBA_BRUSI      VPLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL--
WRBA_METMA      VGLPYAEKRQTIMNEITGGSPYGASTIAGGDGSRQPSENELEMARYQGRHVTQIAKKI--
WRBA_BRUAB      VPLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL--
WRBA_BRUA2      VPLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL--
WRBA_BRUA1      VPLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL--
WRBA_OCHA4      VPLSYAYQGQMGNDVVRGGAPYGMTTTADGDGSRQPSEQELDGARFQGKRVAEITAKL--
WRBA_RHOPB      XXXXXXXXXXXXXDEVAGGSPYGATTITGGDGARQPSANELGGARYQGKVIAETAIKL--
WRBA_MESSB      VPLSYAYQGQSGNDTVRGGAPYGMTTTSDTDGSRMPSAQELEGARFQGKRLAEITAKLV-
WRBA_RALME      VGLPYSHQGQMTLDEIVGGSPYGATTIAGGQGQRQPSAIELEGARHQGELIAKTANKL--
WRBA_MARAV      VPLGYGIPEFFDISEVNGGTPYGASTIAGGDGSRQPSEKELAIARFQGKHVAELAIKL--
WRBA_METBF      VGLPYSETRQRRMDEITGGSPYGASTIAGAEENRQPSENELAMARYQGRHVTQIAKKLI-
WRBA_RHORT      VGVPYGTPEMFDTSEARAGGPYGAATLAGGDGSRQPSDKERTIARFQGRHFAGVAKKL--
YCP4_YEAST      LPLGYSFAELASIEEVHGGSPWGAGTLAGPDGSRTASPLELRIAEIQGKTFYETAKKL--
ALTA7_ALTAL     VPLGYAFSMLANLDEVHGGSPWGAGTFSAGDGSRQPSELELNIAQAQGK-----------
PST2_YEAST      VPLGYKFAELTNMDEVHGGSPWGAGTIAGSDGSRSPSALELQVHEIQGETVAKF------
CLAH7_CLAHE     VPLGYTFHLLGDNSEVRGAAVWGAGTFSGGDGSRQPSQKELELTA-QGKAFYEAVAKV--
YHCB_BACSU      VGLPGNVP-----ENALYGSYYGAGVTCPVDSDELMSEEGIQLGRALGRRVSQVT-----
P25_SCHPO       VPLGYTFSLMANVESIHXXXXXXXXXXXXXXXXRNVSDDELEIARIQGE-----------
RFS1_YEAST      VPLGYAYKELTDVEDVNGSCAWGAGCVSGIDGGRPPSLSELRVHQLQGK-----------
FLAV_AQUAE      FGV---------------------------------------------------------
ISF2_METJA      VG----------DNDPT--AHYGGTGVGKAPGDCKNDDIGLETARNLGKKVAEVVKLI--
FLAV_CLOSA      FGKPKTHLGYVHINEI--------------------QENEDENARIFGERIANKVKQI--
ISF_METTE       VG----------------------------------------------------------
ISF3_ARCFU      VSI---------------------------------------------------------
ISF1_METJA      VG----------------------------------------------------------
FPRA_METTM      ------------------------------------------------------------