[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58880.1

[Show Plain Result]


## Summary of Sequence Search
    1::163
   10::146     3e-26  44%  171 aa  ZUR_SHIFL RecName: Full=Zinc uptake regulation protein;       
   10::146     3e-26  44%  171 aa  ZUR_ECOLI RecName: Full=Zinc uptake regulation protein;       
   14::138     6e-09  31%  144 aa  FUR_NEIGO RecName: Full=Ferric uptake regulation protein;       
   14::138     1e-08  31%  144 aa  FUR_NEIMC RecName: Full=Ferric uptake regulation protein;       
   14::138     1e-08  31%  144 aa  FUR_NEIMB RecName: Full=Ferric uptake regulation protein;       
   14::138     1e-08  31%  144 aa  FUR_NEIMA RecName: Full=Ferric uptake regulation protein;       
   17::140     5e-08  26%  145 aa  PERR_BACSU RecName: Full=Peroxide operon regulator;
   16::141     7e-08  28%  146 aa  FUR2_MYCFO RecName: Full=Ferric uptake regulation protein 2;       
   11::135     2e-07  32%  139 aa  FUR_BORPE RecName: Full=Ferric uptake regulation protein;       
   11::135     2e-07  32%  139 aa  FUR_BORPA RecName: Full=Ferric uptake regulation protein;       
   11::135     2e-07  32%  139 aa  FUR_BORBR RecName: Full=Ferric uptake regulation protein;       
    9::135     3e-07  26%  142 aa  FUR_RHILV RecName: Full=Ferric uptake regulation protein;       
   16::138     3e-07  30%  147 aa  FUR_MYCTU RecName: Full=Ferric uptake regulation protein;       
   16::138     3e-07  30%  147 aa  FUR_MYCBO RecName: Full=Ferric uptake regulation protein;       
   23::145     1e-06  24%  148 aa  PERR_STAAN RecName: Full=Peroxide-responsive repressor perR;
   23::145     1e-06  24%  148 aa  PERR_STAAM RecName: Full=Peroxide-responsive repressor perR;
   23::145     2e-06  24%  148 aa  PERR_STAAW RecName: Full=Peroxide-responsive repressor perR;
   23::145     2e-06  24%  148 aa  PERR_STAAU RecName: Full=Peroxide-responsive repressor perR;
   23::145     2e-06  24%  148 aa  PERR_STAAS RecName: Full=Peroxide-responsive repressor perR;
   23::145     2e-06  24%  148 aa  PERR_STAAR RecName: Full=Peroxide-responsive repressor perR;
   23::145     2e-06  24%  148 aa  PERR_STAAC RecName: Full=Peroxide-responsive repressor perR;
   23::145     2e-06  24%  148 aa  PERR_STAAB RecName: Full=Peroxide-responsive repressor perR;
   23::145     2e-06  24%  148 aa  PERR_STAA8 RecName: Full=Peroxide-responsive repressor perR;
   23::145     2e-06  24%  148 aa  PERR_STAA3 RecName: Full=Peroxide-responsive repressor perR;
   11::134     2e-06  26%  141 aa  FUR_BRUSU RecName: Full=Ferric uptake regulation protein;       
   11::134     2e-06  26%  141 aa  FUR_BRUAB RecName: Full=Ferric uptake regulation protein;       
   11::134     2e-06  26%  141 aa  FUR_BRUA2 RecName: Full=Ferric uptake regulation protein;       
   21::145     2e-06  23%  148 aa  PERR_STAS1 RecName: Full=Peroxide-responsive repressor perR;
   16::149     2e-06  27%  157 aa  FUR_CAMJE RecName: Full=Ferric uptake regulation protein;       
   16::149     2e-06  27%  157 aa  FUR_CAMJ8 RecName: Full=Ferric uptake regulation protein;       
   14::138     3e-06  22%  145 aa  ZUR_BACSU RecName: Full=Zinc-specific metallo-regulatory protein;
   15::142     3e-06  23%  147 aa  FUR_SYNE7 RecName: Full=Ferric uptake regulation protein;       
   23::145     5e-06  22%  150 aa  PERR_STAES RecName: Full=Peroxide-responsive repressor perR;
   23::145     5e-06  22%  150 aa  PERR_STAEQ RecName: Full=Peroxide-responsive repressor perR;
   13::128     5e-06  28%  161 aa  FUR1_MYCFO RecName: Full=Ferric uptake regulation protein 1;       
   23::145     6e-06  20%  150 aa  PERR_STAHJ RecName: Full=Peroxide-responsive repressor perR;
    6::134     6e-06  24%  139 aa  FUR_STAES RecName: Full=Ferric uptake regulation protein;       
    6::134     6e-06  24%  139 aa  FUR_STAEQ RecName: Full=Ferric uptake regulation protein;       
   11::134     6e-06  25%  141 aa  FUR_BRUME RecName: Full=Ferric uptake regulation protein;       
   15::137     1e-05  22%  141 aa  ZURR_LISMO RecName: Full=Transcriptional regulator ZurR;AltName:
   15::137     1e-05  22%  141 aa  ZURR_LISIN RecName: Full=Transcriptional regulator ZurR;AltName:
   11::135     1e-05  31%  136 aa  FUR_LEGPN RecName: Full=Ferric uptake regulation protein;       
    6::134     1e-05  23%  136 aa  FUR_STAAW RecName: Full=Ferric uptake regulation protein;       
    6::134     1e-05  23%  136 aa  FUR_STAAU RecName: Full=Ferric uptake regulation protein;       
    6::134     1e-05  23%  136 aa  FUR_STAAS RecName: Full=Ferric uptake regulation protein;       
    6::134     1e-05  23%  136 aa  FUR_STAAR RecName: Full=Ferric uptake regulation protein;       
    6::134     1e-05  23%  136 aa  FUR_STAAN RecName: Full=Ferric uptake regulation protein;       
    6::134     1e-05  23%  136 aa  FUR_STAAM RecName: Full=Ferric uptake regulation protein;       
    6::134     1e-05  23%  136 aa  FUR_STAAC RecName: Full=Ferric uptake regulation protein;       
    6::134     1e-05  23%  136 aa  FUR_STAA8 RecName: Full=Ferric uptake regulation protein;       
    6::134     4e-05  25%  138 aa  FUR_STAEP RecName: Full=Ferric uptake regulation protein;       
   16::149     7e-05  26%  156 aa  FUR_CAMUP RecName: Full=Ferric uptake regulation protein;       
   22::145     9e-05  25%  150 aa  FUR_HELPY RecName: Full=Ferric uptake regulation protein;       
    6::133     1e-04  27%  148 aa  FUR_YERPE RecName: Full=Ferric uptake regulation protein;       
   22::116     1e-04  29%  150 aa  FUR_HELPJ RecName: Full=Ferric uptake regulation protein;       
   11::132     2e-04  30%  143 aa  FUR_RALME RecName: Full=Ferric uptake regulation protein;       
   12::135     2e-04  26%  148 aa  FUR_SHIFL RecName: Full=Ferric uptake regulation protein;       
   12::135     4e-04  25%  148 aa  FUR_ECOLI RecName: Full=Ferric uptake regulation protein;       
   12::135     4e-04  25%  148 aa  FUR_ECOL6 RecName: Full=Ferric uptake regulation protein;       
   12::135     4e-04  25%  148 aa  FUR_ECO57 RecName: Full=Ferric uptake regulation protein;       
    7::110     6e-04  28%  149 aa  FUR_HAEDU RecName: Full=Ferric uptake regulation protein;       
    1::163

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxLAVAEKTCASRGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEH
ZUR_SHIFL       ------------------------LAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAE
ZUR_ECOLI       ------------------------LAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAE
FUR_NEIGO       -----------------------------------GLKVTGPRLKILDL-FEKHEHLSAEDVYRILLEEG
FUR_NEIMC       -----------------------------------GLKVTGPRLKILDL-FETHEHLSAEDVYRILLEEG
FUR_NEIMB       -----------------------------------GLKVTGPRLKILDL-FETHEHLSAEDVYRILLEEG
FUR_NEIMA       -----------------------------------GLKVTGPRLKILDL-FETHEHLSAEDVYRILLEEG
PERR_BACSU      -----------------------------------GVRITPQRHAILEYLVNSMAHPTADDIYKALEGKF
FUR2_MYCFO      ------------------------------------LRVTRPRVAVLHAVHXXTRDADTETIIRSVREDL
FUR_BORPE       -----------------------------------GLKATFPRLKILDIFRKRHLSAE--DVYRALIAEN
FUR_BORPA       -----------------------------------GLKATFPRLKILDIFRKRHLSAE--DVYRALIAEN
FUR_BORBR       -----------------------------------GLKATFPRLKILDIFRKRHLSAE--DVYRALIAEN
FUR_RHILV       ----------------------------EELCTERGMRMTEQRRVIARILEDSEDHPDVEELYRRSVKVD
FUR_MYCTU       ------------------------------------LRVTRPRVAVLEAV-NAHPHADTETIFGAVRFAL
FUR_MYCBO       ------------------------------------LRVTRPRVAVLEAV-NAHPHADTETIFGAVRFAL
PERR_STAAN      -----------------------------------GIRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAAM      -----------------------------------GIRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAAW      -----------------------------------GVRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAAU      -----------------------------------GVRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAAS      -----------------------------------GVRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAAR      -----------------------------------GVRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAAC      -----------------------------------GVRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAAB      -----------------------------------GVRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAA8      -----------------------------------GVRITPQRQAILRYLISSHTHPTADEIYQALSPDF
PERR_STAA3      -----------------------------------GVRITPQRQAILRYLISSHTHPTADEIYQALSPDF
FUR_BRUSU       ----------------------------EQELRRAGVRITRPRRIILNILNETEDHPDALEIFRRAVEED
FUR_BRUAB       ----------------------------EQELRRAGVRITRPRRIILNILNETEDHPDALEIFRRAVEED
FUR_BRUA2       ----------------------------EQELRRAGVRITRPRRIILNILNETEDHPDALEIFRRAVEED
PERR_STAS1      ---------------------------------NNGVRITPQRQAILKFLIASHTHPTADEIYQALSPDF
FUR_CAMJE       ----------------------------KKILRQGGLKYTKQREVLLKTLYDTHTPESLYMEIKQAEPDL
FUR_CAMJ8       ----------------------------KKILRQGGLKYTKQREVLLKTLYDTHTPESLYMEIKQAEPDL
ZUR_BACSU       -----------------------------------GYKYTNKREDMLQLFADSDRYLTAKNVLSALNDDY
FUR_SYNE7       ----------------------------------RGWRLTPQREEILRVFQNAGEHLSAEDLYNHLLSRN
PERR_STAES      -----------------------------------GVRITPQRQAIMRYLISSHSHPTADEIYQALSPKF
PERR_STAEQ      -----------------------------------GVRITPQRQAIMRYLISSHSHPTADEIYQALSPKF
FUR1_MYCFO      ---------------------------------SAGLRITRPRLAVLNAVKE-HPHAETDHVIRAVRVQL
PERR_STAHJ      -----------------------------------GVRITPQRQAIIRYLIASHSHPTADEIYQALSPDF
FUR_STAES       ---------------------------AIKVLKENGLKYTDKRKDMLDIFVKEDKYLNAKHIQQQMDKDY
FUR_STAEQ       ---------------------------AIKVLKENGLKYTDKRKDMLDIFVKEDKYLNAKHIQQQMDKDY
FUR_BRUME       ----------------------------EQELRRAGVRITRPRRIILNILNETEDHPDALEIFRRAVEED
ZURR_LISMO      ----------------------------------KGYKHTDKREFLINLLARKNKYLTAKDVLENMKDDF
ZURR_LISIN      ----------------------------------KGYKHTDKREFLINLLARKNKYLTAKDVLENMKDDF
FUR_LEGPN       -----------------------------------GLKITLPRIKVLQILQSRNHHLSAEAVYKALLESG
FUR_STAAW       ---------------------------AIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENY
FUR_STAAU       ---------------------------AIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENY
FUR_STAAS       ---------------------------AIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENY
FUR_STAAR       ---------------------------AIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENY
FUR_STAAN       ---------------------------AIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENY
FUR_STAAM       ---------------------------AIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENY
FUR_STAAC       ---------------------------AIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENY
FUR_STAA8       ---------------------------AIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENY
FUR_STAEP       ---------------------------AIKILKDNGLKYTDKRKDMLDIFVEEDKYLNAKHIQQKMDKDY
FUR_CAMUP       ----------------------------KKILREGGLKYTKQREVLLKTLYDTHTPESLYMEIKQAEPDS
FUR_HELPY       -----------------------------------GLKNSKQREEVVSVLYRSGTHLSPEEITHSIRQKD
FUR_YERPE       -----------------------------KALKNAGLKVTLPRLKILEVLQNHHVSAELYKILIDIGEEI
FUR_HELPJ       -----------------------------------GLKNSKQREEVVSVLYRSGTHLSPEEITHSIRQKD
FUR_RALME       -----------------------------------GLKATVPRLKILEIFQTSEQRLSAEDVYRILLNEH
FUR_SHIFL       -----------------------------------GLRVTLPRLKILEVLQDNHH-VSAEDLYKRLIDMG
FUR_ECOLI       -----------------------------------GLKVTLPRLKILEVLQDNHH-VSAEDLYKRLIDMG
FUR_ECOL6       -----------------------------------GLKVTLPRLKILEVLQDNHH-VSAEDLYKRLIDMG
FUR_ECO57       -----------------------------------GLKVTLPRLKILEVLQDNHH-VSAEDLYKRLIDMG
FUR_HAEDU       -----------------------------KLLKSVGLKVTEPRLTILALMQQYREEMQAEDIYKLLLEQS


                         .         .         *         .         .         .         .:140
query           QAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRCGTVAELDAPEITGIITREAK
ZUR_SHIFL       PQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQTHTSAMFICDRCGAVKEECAEGVEDIMHTLAA
ZUR_ECOLI       PQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQTHTSAMFICDRCGAVKEECAEGVEDIMHTLAA
FUR_NEIGO       VEIGVATIYRVLTQFEQAGILHHFETGKAVYELDKGDH---HDHIVCVKCGEVTEFHNPEIEALQDKIAE
FUR_NEIMC       VEIGVATIYRVLTQFEQAGILHHFETGKAVYELDKGDH---HDHIVCVKCGEVTEFHNPEIEALQDKIAE
FUR_NEIMB       VEIGVATIYRVLTQFEQAGILHHFETGKAVYELDKGDH---HDHIVCVKCGEVTEFHNPEIEALQDKIAE
FUR_NEIMA       VEIGVATIYRVLTQFEQAGILHHFETGKAVYELDKGDH---HDHIVCVKCGEVTEFHNPEIEALQDKIAE
PERR_BACSU      PNMSVATVYNNLRVFRESGLVKELTDASSRFDFVTSDHYHA----ICENCGKIVDFHYPGLDEVEQLAAH
FUR2_MYCFO      PEVSHQAVYDSLHALTAAALVRRIQPSGSVVSRYESRIGDNHHHVVCRSCGAIADVDAPCLTA-----SE
FUR_BORPE       VEIGLATVYRVLTQFEQAGILTRFDTGKAVFELNDGDH---HDHLICTNCGTVFEFSDPDIEKRQYKVAK
FUR_BORPA       VEIGLATVYRVLTQFEQAGILTRFDTGKAVFELNDGDH---HDHLICTNCGTVFEFSDPDIEKRQYKVAK
FUR_BORBR       VEIGLATVYRVLTQFEQAGILTRFDTGKAVFELNDGDH---HDHLICTNCGTVFEFSDPDIEKRQYKVAK
FUR_RHILV       AKISISTVYRTVKLFEDAGIIARHDFRDGRSRYETPEEHH--DHLIDLKTGTVIEFRSPEIEALQERIAR
FUR_MYCTU       PDVSRQAVYDVLHALTAAGLVRKIQSVARYESRVGDNHHHI----VCRSCGVIADVDCAVGEAPCLTASD
FUR_MYCBO       PDVSRQAVYDVLHALTAAGLVRKIQSVARYESRVGDNHHHI----VCRSCGVIADVDCAVGEAPCLTASD
PERR_STAAN      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAAM      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAAW      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAAU      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAAS      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAAR      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAAC      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAAB      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAA8      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
PERR_STAA3      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQH
FUR_BRUSU       DSISLSTVYRTIKLLEERGAIHR------HAFAGGPSRFEQADHIIDMDSGDVVEFHSDKIEKLQEEIAR
FUR_BRUAB       DSISLSTVYRTMKLLEERGAIHR------HAFAGGPSRFEQADHIIDMDSGDVVEFHSDKIEKLQEEIAR
FUR_BRUA2       DSISLSTVYRTMKLLEERGAIHR------HAFAGGPSRFEQADHIIDMDSGDVVEFHSDKIEKLQEEIAR
PERR_STAS1      PNISVATIYNNLRVFKDIGIVKELPY-------GDSSSTHNHYHVICEQCGKIVDFHYPQLDEVEQLAQH
FUR_CAMJE       NVGIA-TVYRTLNLLEEAEMVTSISFGSAYELANKPHHDH----MICKNCGKIIEFENPIIERQQALIAK
FUR_CAMJ8       NVGIA-TVYRTLNLLEEAEMVTSISFGSAYELANKPHHDH----MICKNCGKIIEFENPIIERQQALIAK
ZUR_BACSU       PGLSFDTIYRNLSLYEELGILETTELSGEKLFRFKCSFTHHHHHFICLACGKTKEIESCPMDKLCD---D
FUR_SYNE7       SPISLSTIYRTLKLMARMGLLRELDLAEDHKHYELNQPLKHHHHLICVSCSKTIEFKSDSVLKIGAKTSE
PERR_STAES      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEKCGKIVDFHYPQLDEVEQLAQH
PERR_STAEQ      PNISVATIYNNLRVFKDIGIVKELTY-------GDSSNTHNHYHIICEKCGKIVDFHYPQLDEVEQLAQH
FUR1_MYCFO      PDVSHQTVYDXLNALTAAGLVRRIQSVARYETRVNDNHHHV----VCRSCGAIADVDCAVGDAPCLTAAD
PERR_STAHJ      PNISVATIYNNLRVFKSIGIVKELTYGDA--SSRFDFNTHNHYHVICEKCGKIVDFHYPQLDEVEQLAQH
FUR_STAES       PGISFDTVYRNLHLFKDLGIIESTEEMKFRIACTN----HHHHHFICENCGETKVIDFCPIEKI---KSQ
FUR_STAEQ       PGISFDTVYRNLHLFKDLGIIESTEEMKFRIACTN----HHHHHFICENCGETKVIDFCPIEKI---KSQ
FUR_BRUME       DSISLSTVYHTMKLLEERGAIHR------HAFAGGPSRFEQADHIIDMDSGDVVEFHSDKIEKLQEEIAR
ZURR_LISMO      PGISFDTIYRNLSLFVELGIFEETDERNFRLAC---TXXXXXXXFICMKCGKTKEIMMCPM-DFLTEALP
ZURR_LISIN      PGISFDTIYRNLSLFVELGIFEETDERNFRLAC---TXXXXXXXFICMKCGKTKEIMMCPM-DFLTEALP
FUR_LEGPN       EDVGLATVYRVLTQFEAAGLVSR----HNFEGGHSVFELSQGEHLVCVKCGRVEEF----VDEIIEQRQK
FUR_STAAW       PGISFDTIYRNLHLFKDLGIIENTEEMKFRIACTN----HHHHHFICEKCGDTKVIDYCPIDQI---KLS
FUR_STAAU       PGISFDTIYRNLHLFKDLGIIENTEEMKFRIACTN----HHHHHFICEKCGDTKVIDYCPIDQI---KLS
FUR_STAAS       PGISFDTIYRNLHLFKDLGIIENTEEMKFRIACTN----HHHHHFICEKCGDTKVIDYCPIDQI---KLS
FUR_STAAR       PGISFDTIYRNLHLFKDLGIIENTEEMKFRIACTN----HHHHHFICEKCGDTKVIDYCPIDQI---KLS
FUR_STAAN       PGISFDTIYRNLHLFKDLGIIENTEEMKFRIACTN----HHHHHFICEKCGDTKVIDYCPIDQI---KLS
FUR_STAAM       PGISFDTIYRNLHLFKDLGIIENTEEMKFRIACTN----HHHHHFICEKCGDTKVIDYCPIDQI---KLS
FUR_STAAC       PGISFDTIYRNLHLFKDLGIIENTEEMKFRIACTN----HHHHHFICEKCGDTKVIDYCPIDQI---KLS
FUR_STAA8       PGISFDTIYRNLHLFKDLGIIENTEEMKFRIACTN----HHHHHFICEKCGDTKVIDYCPIDQI---KLS
FUR_STAEP       PGISFDTVYRNLHLFKDLGIIESTEEMKFRIACTN----HHHHHFICENCGDTKVIDFCPIEQI----KQ
FUR_CAMUP       NVGIA-TVYRTLNLLEEAEMVTSLSLDSAYELSNKPHHDH----MICKVCGKIIEFENPIIERQQSLIAN
FUR_HELPY       KNTSISSVYRILNFLEKENFICVLETSKSYEIAAKEHHDHI----ICLHCGKIIEFADPEIENRQNEVVK
FUR_YERPE       GLA---TVYRVLNQFDDAGIVTR-HNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSNESIESLQREIAK
FUR_HELPJ       KNTSISSVYRILNFLEKENFICVLETSKSYEIAAKEHHDHI----ICLHCGKIIEFADPEI---------
FUR_RALME       MDIGLATVYRVLTQFEQAGLLSR----NNFESGKAIFELNEGKHLVCLDCGRVEEFFDADIEQRQQSIAR
FUR_SHIFL       EEIGLATVYRVLNQFDDAGIVTR-HNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQGEIAA
FUR_ECOLI       EEIGLATVYRVLNQFDDAGIVTR-HNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAA
FUR_ECOL6       EEIGLATVYRVLNQFDDAGIVTR-HNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAA
FUR_ECO57       EEIGLATVYRVLNQFDDAGIVTR-HNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAA
FUR_HAEDU       SDIGLATVYRVLNQFEEVGILLR-HNFDSNKAVFELNVDHEHDHIICMDCGKVFEFKDPDI---------


                         +         .         .         .         .         *         .:210
query           YLGFRVDRQTVEIRGLCPQCSGD
ZUR_SHIFL       KMGFALRHNVIEAHGLCAAC---
ZUR_ECOLI       KMGFALRHNVIEAHGLCAAC---
FUR_NEIGO       ENGYRIVDHALYMYGVCSDC---
FUR_NEIMC       ENGYRIVDHALYMYGVCSDC---
FUR_NEIMB       ENGYRIVDHALYMYGVCSDC---
FUR_NEIMA       ENGYRIVDHALYMYGVCSDC---
PERR_BACSU      VTGFKVSHHRLEIYGVCQECS--
FUR2_MYCFO      DHGFEIDEAEVIYWGTCPECS--
FUR_BORPE       DNGFVLESHAMVLYGICGNC---
FUR_BORPA       DNGFVLESHAMVLYGICGNC---
FUR_BORBR       DNGFVLESHAMVLYGICGNC---
FUR_RHILV       EHGFRLVDHRLELYGV-------
FUR_MYCTU       HNGFLLDEAEVIYWGLCPDCS--
FUR_MYCBO       HNGFLLDEAEVIYWGLCPDCS--
PERR_STAAN      MTDFDVTHHRMEIYGVCKEC---
PERR_STAAM      MTDFDVTHHRMEIYGVCKEC---
PERR_STAAW      MTDFDVTHHRMEIYGVCKEC---
PERR_STAAU      MTDFDVTHHRMEIYGVCKEC---
PERR_STAAS      MTDFDVTHHRMEIYGVCKEC---
PERR_STAAR      MTDFDVTHHRMEIYGVCKEC---
PERR_STAAC      MTDFDVTHHRMEIYGVCKEC---
PERR_STAAB      MTDFDVTHHRMEIYGVCKEC---
PERR_STAA8      MTDFDVTHHRMEIYGVCKEC---
PERR_STAA3      MTDFDVTHHRMEIYGVCKEC---
FUR_BRUSU       SLGFEIVHHRLEL----------
FUR_BRUAB       SLGFEIVHHRLEL----------
FUR_BRUA2       SLGFEIVHHRLEL----------
PERR_STAS1      VTDFNVTHHRMEIYGLCKDC---
FUR_CAMJE       EHGFKLTGHLMQLYGVCGDCN--
FUR_CAMJ8       EHGFKLTGHLMQLYGVCGDCN--
ZUR_BACSU       LDGYQVSGHKFEIYGTCPDCTAE
FUR_SYNE7       KEGYHLLDCQLTIHGVCPTC---
PERR_STAES      VTDFDVTHHRMEIYGVCKEC---
PERR_STAEQ      VTDFDVTHHRMEIYGVCKEC---
FUR1_MYCFO      DNGFDIDEAEV------------
PERR_STAHJ      ITEFDVTHHRMEIYGICKEC---
FUR_STAES       LPNVNIHTHKLEVYGICEEC---
FUR_STAEQ       LPNVNIHTHKLEVYGICEEC---
FUR_BRUME       SLGFEIVHHRLEL----------
ZURR_LISMO      --GYQIDGHKFEVYGECPEC---
ZURR_LISIN      --GYQIDGHKFEVYGECPEC---
FUR_LEGPN       AIAFKMTDHALNIYGICPQC---
FUR_STAAW       LPGVNIHKHKLEVYGVCESC---
FUR_STAAU       LPGVNIHKHKLEVYGVCESC---
FUR_STAAS       LPGVNIHKHKLEVYGVCESC---
FUR_STAAR       LPGVNIHKHKLEVYGVCESC---
FUR_STAAN       LPGVNIHKHKLEVYGVCESC---
FUR_STAAM       LPGVNIHKHKLEVYGVCESC---
FUR_STAAC       LPGVNIHKHKLEVYGVCESC---
FUR_STAA8       LPGVNIHKHKLEVYGVCESC---
FUR_STAEP       YLNVTIHTHKLEVYGVCESC---
FUR_CAMUP       EHHFKLTGHLMQLYGICSDCN--
FUR_HELPY       KYQAKLISHDMKMFVWCKEC---
FUR_YERPE       QHGIKLTNHSLYLYGHC------
FUR_HELPJ       -----------------------
FUR_RALME       ERGFALQEHALSLYGNC------
FUR_SHIFL       KHGIRLTNHSLYLYGHCAE----
FUR_ECOLI       KHGIRLTNHSLYLYGHCAE----
FUR_ECOL6       KHGIRLTNHSLYLYGHCAE----
FUR_ECO57       KHGIRLTNHSLYLYGHCAE----
FUR_HAEDU       -----------------------