[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58884.1

[Show Plain Result]


## Summary of Sequence Search
    1::193
    1::191     1e-84  70%  192 aa  SODF_LEGPH RecName: Full=Superoxide dismutase [Fe];       
    1::192     9e-84  70%  193 aa  SODF_PSEAE RecName: Full=Superoxide dismutase [Fe];       
    4::192     2e-81  72%  193 aa  SODF_PHOLE RecName: Full=Superoxide dismutase [Fe];       
    1::189     1e-79  68%  198 aa  SODF_PSEPK RecName: Full=Superoxide dismutase [Fe];       
    1::190     5e-79  66%  193 aa  SODF_COXBU RecName: Full=Superoxide dismutase [Fe];       
    1::189     3e-78  67%  198 aa  SODF_PSEPU RecName: Full=Superoxide dismutase [Fe];       
    4::192     3e-76  65%  192 aa  SODF_PSEHT RecName: Full=Superoxide dismutase [Fe];       
   19::192     3e-76  72%  192 aa  SODF_BORPE RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-74  65%  193 aa  SODF_SHIFL RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-74  65%  193 aa  SODF_ECOLI RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-74  65%  193 aa  SODF_ECOL6 RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-74  65%  193 aa  SODF_ECO57 RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-73  64%  193 aa  SODF_SALTY RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-73  64%  193 aa  SODF_SALTI RecName: Full=Superoxide dismutase [Fe];       
    1::192     4e-66  57%  199 aa  SODF_BABBO RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-64  55%  198 aa  SODF_PLAVI RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-64  55%  198 aa  SODF_PLAFX RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-64  55%  198 aa  SODF_PLAFA RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-64  55%  198 aa  SODF_PLAF7 RecName: Full=Superoxide dismutase [Fe];       
    1::192     2e-63  54%  198 aa  SODF_PLAMA RecName: Full=Superoxide dismutase [Fe];       
    1::190     2e-62  57%  190 aa  SODF_ENTHI RecName: Full=Superoxide dismutase [Fe];       
    1::197     4e-61  56%  199 aa  SODF_SYNY3 RecName: Full=Superoxide dismutase [Fe];       
    1::198     2e-60  57%  199 aa  SODF_PLEBO RecName: Full=Superoxide dismutase [Fe];       
    8::198     3e-58  58%  200 aa  SODF_ANASP RecName: Full=Superoxide dismutase [Fe];       
    1::193     4e-58  53%  193 aa  SODF_BACFR RecName: Full=Superoxide dismutase [Fe];       
    4::188     7e-58  55%  213 aa  SODF_HELPJ RecName: Full=Superoxide dismutase [Fe];       
    1::196     2e-57  54%  202 aa  SODM_BACHD RecName: Full=Superoxide dismutase [Mn];       
    4::188     2e-57  54%  213 aa  SODF_HELPY RecName: Full=Superoxide dismutase [Fe];       
    1::192     4e-57  54%  202 aa  SODM_LISMO RecName: Full=Superoxide dismutase [Mn];       
    1::196     2e-56  54%  202 aa  SODM_BACSU RecName: Full=Superoxide dismutase [Mn];       
    1::192     8e-56  53%  202 aa  SODM_LISIN RecName: Full=Superoxide dismutase [Mn];       
    1::197     1e-55  51%  201 aa  SODF_SYNE7 RecName: Full=Superoxide dismutase [Fe];       
    4::197     2e-55  51%  203 aa  SODM1_BACAN RecName: Full=Superoxide dismutase [Mn] 1;       
    4::196     2e-55  55%  220 aa  SODF_CAMCO RecName: Full=Superoxide dismutase [Fe];       
    1::187     4e-55  51%  191 aa  SODF_PORGI RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::188     5e-55  53%  199 aa  SODM2_STAAW RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
    1::188     5e-55  53%  199 aa  SODM2_STAAS RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
    1::188     5e-55  53%  199 aa  SODM2_STAAR RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
    1::188     5e-55  53%  199 aa  SODM2_STAAN RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
    1::188     5e-55  53%  199 aa  SODM2_STAAM RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
    1::188     5e-55  53%  199 aa  SODM2_STAAC RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
    1::188     5e-55  53%  199 aa  SODM2_STAA8 RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
    1::188     5e-55  53%  199 aa  SODM2_STAA3 RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
   16::207     5e-55  51%  209 aa  SODF_RICCN RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::192     7e-55  53%  202 aa  SODM_LISIV RecName: Full=Superoxide dismutase [Mn];       
   33::238     2e-54  56%  248 aa  SODF_SOYBN RecName: Full=Superoxide dismutase [Fe], chloroplastic; 
   16::207     2e-54  51%  209 aa  SODF_RICPR RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::188     2e-54  52%  199 aa  SODM2_STAAB RecName: Full=Superoxide dismutase [Mn/Fe] 2;       
    1::196     3e-54  47%  203 aa  SODM_XANCP RecName: Full=Superoxide dismutase [Mn];       
    1::196     3e-54  47%  203 aa  SODM_XANC8 RecName: Full=Superoxide dismutase [Mn];       
    1::194     3e-54  52%  202 aa  SODM_ENTFA RecName: Full=Superoxide dismutase [Fe];       
    4::196     4e-54  54%  220 aa  SODF_CAMJJ RecName: Full=Superoxide dismutase [Fe];       
    4::196     4e-54  54%  220 aa  SODF_CAMJE RecName: Full=Superoxide dismutase [Fe];       
   16::207     8e-54  52%  209 aa  SODF_RICTY RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::196     1e-53  52%  204 aa  SODM_BACCA RecName: Full=Superoxide dismutase [Mn];       
   16::207     1e-53  51%  209 aa  SODF_RICFE RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::196     3e-53  51%  204 aa  SODM_BACST RecName: Full=Superoxide dismutase [Mn];       
    2::195     6e-53  48%  202 aa  SODF_METJ RecName: Full=Superoxide dismutase [Mn/Fe];       
   25::212     1e-52  51%  218 aa  SODM1_BACCR RecName: Full=Superoxide dismutase [Mn] 1;       
    1::199     4e-52  47%  203 aa  SODM_PSEAE RecName: Full=Superoxide dismutase [Mn];       
    1::208     5e-52  52%  211 aa  SODM_DEIRA RecName: Full=Superoxide dismutase [Mn];       
    1::192     2e-51  49%  201 aa  SODM_STACA RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::191     5e-51  50%  199 aa  SODM_STAXY RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::191     3e-50  50%  199 aa  SODM_STAHJ RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::191     4e-50  47%  203 aa  SODM_PSEPU RecName: Full=Superoxide dismutase [Mn];       
    1::191     5e-50  49%  199 aa  SODM_STAS1 RecName: Full=Superoxide dismutase [Mn/Fe];       
   16::207     2e-49  49%  209 aa  SODF_RICBR RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::191     4e-49  49%  199 aa  SODM_STAES RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::191     4e-49  49%  199 aa  SODM_STAEQ RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::191     6e-49  49%  199 aa  SODM1_STAAW RecName: Full=Superoxide dismutase [Mn/Fe] 1;       
    1::191     6e-49  49%  199 aa  SODM1_STAAS RecName: Full=Superoxide dismutase [Mn/Fe] 1;       
    1::191     6e-49  49%  199 aa  SODM1_STAAR RecName: Full=Superoxide dismutase [Mn/Fe] 1;       
    1::191     6e-49  49%  199 aa  SODM1_STAAN RecName: Full=Superoxide dismutase [Mn/Fe] 1;       
    1::191     6e-49  49%  199 aa  SODM1_STAAM RecName: Full=Superoxide dismutase [Mn/Fe] 1;       
    1::191     6e-49  49%  199 aa  SODM1_STAAC RecName: Full=Superoxide dismutase [Mn/Fe] 1;       
    1::191     6e-49  49%  199 aa  SODM1_STAAB RecName: Full=Superoxide dismutase [Mn/Fe] 1;       
    1::191     6e-49  49%  199 aa  SODM1_STAA8 RecName: Full=Superoxide dismutase [Mn] 1;       
    1::191     6e-49  49%  199 aa  SODM1_STAA3 RecName: Full=Superoxide dismutase [Mn/Fe] 1;       
    8::197     1e-48  49%  202 aa  SODF_NICPL RecName: Full=Superoxide dismutase [Fe], chloroplastic; 
    1::193     2e-48  45%  206 aa  SODM2_PLEBO RecName: Full=Superoxide dismutase [Mn] 2;       
    5::195     2e-47  47%  201 aa  SODM_STRP1 RecName: Full=Superoxide dismutase [Mn];       
    1::191     2e-47  49%  199 aa  SODM_STAEP RecName: Full=Superoxide dismutase [Mn/Fe];       
    5::195     5e-47  47%  201 aa  SODM_STRP3 RecName: Full=Superoxide dismutase [Mn];       
    5::195     7e-47  46%  201 aa  SODM_STRP8 RecName: Full=Superoxide dismutase [Mn];       
    5::195     1e-46  46%  201 aa  SODM_STRP6 RecName: Full=Superoxide dismutase [Mn];       
   30::218     2e-46  49%  228 aa  SODM_ACIAD RecName: Full=Superoxide dismutase [Mn];       
    1::198     2e-46  51%  206 aa  SODM_LACLM RecName: Full=Superoxide dismutase [Mn];       
    1::198     2e-46  51%  206 aa  SODM_LACLA RecName: Full=Superoxide dismutase [Mn];       
    6::195     3e-46  46%  204 aa  SODM_THET8 RecName: Full=Superoxide dismutase [Mn];       
    6::195     3e-46  46%  204 aa  SODM_THET2 RecName: Full=Superoxide dismutase [Mn];       
    6::195     6e-46  47%  204 aa  SODM_THEAQ RecName: Full=Superoxide dismutase [Mn];       
    5::194     8e-46  46%  201 aa  SODM_STRPY RecName: Full=Superoxide dismutase [Mn];       
    5::195     5e-45  44%  208 aa  SODM2_BACCR RecName: Full=Superoxide dismutase [Mn] 2;       
    1::197     6e-45  43%  211 aa  SODM_BORPE RecName: Full=Superoxide dismutase [Mn];       
    2::191     1e-44  48%  198 aa  SODM_MACMU RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    2::191     1e-44  48%  198 aa  SODM_MACFU RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   26::215     1e-44  48%  222 aa  SODM_MACFA RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::207     1e-44  48%  218 aa  SODM_CHLRE RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   26::215     1e-44  48%  222 aa  SODM_PONPY RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    2::191     1e-44  48%  198 aa  SODM_PANTR RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    2::191     1e-44  48%  198 aa  SODM_HYLLA RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   26::215     1e-44  48%  222 aa  SODM_HUMAN RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   34::213     2e-44  45%  239 aa  SODM3_PLEBO RecName: Full=Superoxide dismutase [Mn] 3;       
   26::215     3e-44  47%  222 aa  SODM_MACNE RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    5::193     4e-44  46%  201 aa  SODM_STRR6 RecName: Full=Superoxide dismutase [Mn];       
    5::193     4e-44  46%  201 aa  SODM_STRPN RecName: Full=Superoxide dismutase [Mn];       
    5::195     7e-44  43%  208 aa  SODM2_BACAN RecName: Full=Superoxide dismutase [Mn] 2;       
   26::215     9e-44  48%  222 aa  SODM_HORSE RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::202     1e-43  46%  215 aa  SODM_HAEIN RecName: Full=Superoxide dismutase [Mn];       
    2::191     1e-43  48%  198 aa  SODM_CEBAP RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    2::191     1e-43  48%  198 aa  SODM_CALJA RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::200     2e-43  48%  200 aa  SODF_RHOCA RecName: Full=Superoxide dismutase [Fe];       
    1::191     3e-43  47%  199 aa  SODM_CORDI RecName: Full=Superoxide dismutase [Mn];       
    1::203     4e-43  47%  206 aa  SODM_SHIFL RecName: Full=Superoxide dismutase [Mn];       
    1::203     4e-43  47%  206 aa  SODM_ECO57 RecName: Full=Superoxide dismutase [Mn];       
    1::203     6e-43  46%  206 aa  SODM_ECOLI RecName: Full=Superoxide dismutase [Mn];       
    5::193     1e-42  44%  202 aa  SODM_STRAG RecName: Full=Superoxide dismutase [Mn/Fe];       
    5::193     1e-42  44%  202 aa  SODM_STRA5 RecName: Full=Superoxide dismutase [Mn/Fe];       
    5::193     1e-42  44%  202 aa  SODM_STRA3 RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::203     9e-42  46%  206 aa  SODM_SALTY RecName: Full=Superoxide dismutase [Mn];       
    1::203     9e-42  46%  206 aa  SODM_SALTI RecName: Full=Superoxide dismutase [Mn];       
    1::204     1e-41  44%  207 aa  SODM_YEREN RecName: Full=Superoxide dismutase [Mn];       
    1::200     2e-41  50%  213 aa  SODM_PASHA RecName: Full=Superoxide dismutase [Mn];       
    6::196     7e-41  48%  202 aa  SODF_METTM RecName: Full=Superoxide dismutase [Fe];       
    1::191     1e-40  48%  200 aa  SODF_RHIME RecName: Full=Superoxide dismutase [Mn];       
    9::199     2e-40  48%  205 aa  SODF_METTH RecName: Full=Superoxide dismutase [Fe];       
    5::195     3e-40  41%  203 aa  SODM_STRMU RecName: Full=Superoxide dismutase [Mn/Fe];       
   28::217     5e-40  42%  218 aa  SODM_SCHPO RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::202     5e-40  44%  203 aa  SODM_BUCAP RecName: Full=Superoxide dismutase [Mn];       
   45::226     1e-39  43%  248 aa  SODM1_PLEBO RecName: Full=Superoxide dismutase [Mn] 1;       
    1::170     3e-39  45%  170 aa  SODM_KLEPL RecName: Full=Superoxide dismutase [Fe];       
   26::217     5e-39  43%  221 aa  SODM1_CAEEL RecName: Full=Superoxide dismutase [Mn] 1,
   26::213     7e-39  44%  222 aa  SODM_BOVIN RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    5::196     3e-38  43%  206 aa  SODM_CHLTR RecName: Full=Superoxide dismutase [Mn];       
   17::197     3e-38  45%  212 aa  SODF_ARATH RecName: Full=Superoxide dismutase [Fe], chloroplastic; 
   26::215     4e-38  40%  218 aa  SODM2_CAEEL RecName: Full=Superoxide dismutase [Mn] 2,
    5::196     6e-38  45%  202 aa  SODM_RABIT RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::204     6e-38  42%  208 aa  SODM_BUCBP RecName: Full=Superoxide dismutase [Mn];       
    1::201     8e-38  42%  203 aa  SODM_BUCAI RecName: Full=Superoxide dismutase [Mn];       
    1::196     2e-37  46%  213 aa  SODM_HAEDU RecName: Full=Superoxide dismutase [Mn];       
   27::219     2e-37  42%  226 aa  SODM_DICDI RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    5::196     4e-37  42%  205 aa  SODM_CHLMU RecName: Full=Superoxide dismutase [Mn];       
   30::224     1e-36  42%  233 aa  SODM_HEVBR RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   20::211     1e-36  44%  216 aa  SODM_GLOMM RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   30::228     2e-36  43%  231 aa  SODM_ORYSJ RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    4::191     3e-36  41%  200 aa  SODM2_HALSA RecName: Full=Superoxide dismutase [Mn] 2;       
   27::221     4e-36  42%  228 aa  SODM_PRUPE RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   26::207     4e-36  44%  211 aa  SODM_CAVPO RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::201     7e-36  44%  214 aa  SODM_PASMU RecName: Full=Superoxide dismutase [Mn];       
    4::195     7e-36  41%  207 aa  SODM_MYCSM RecName: Full=Superoxide dismutase [Mn];       
    4::195     7e-36  41%  207 aa  SODM_MYCS2 RecName: Full=Superoxide dismutase [Mn];       
    1::195     2e-35  43%  200 aa  SODM_GANMI RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   27::221     2e-35  40%  228 aa  SODM_CAPAN RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   19::206     4e-35  42%  217 aa  SODM_DROME RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    6::196     4e-35  43%  207 aa  SODM_CHLPN RecName: Full=Superoxide dismutase [Mn];       
   34::232     5e-35  41%  235 aa  SODM1_MAIZE RecName: Full=Superoxide dismutase [Mn] 3.1,
    4::195     8e-35  42%  207 aa  SODM_MYCPA RecName: Full=Superoxide dismutase [Mn];       
    4::195     1e-34  42%  207 aa  SODM_MYCAV RecName: Full=Superoxide dismutase [Mn];       
   27::218     1e-34  40%  228 aa  SODM_NICPL RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    4::192     1e-34  42%  207 aa  SODM_MYCLP RecName: Full=Superoxide dismutase [Mn];       
   33::223     2e-34  41%  245 aa  SODM_NEUCR RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    4::195     2e-34  41%  207 aa  SODM_MYCFO RecName: Full=Superoxide dismutase [Mn];       
   22::191     2e-34  45%  224 aa  SODM_CHAFE RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   32::230     3e-34  40%  233 aa  SODM4_MAIZE RecName: Full=Superoxide dismutase [Mn] 3.4,
    4::195     4e-34  40%  207 aa  SODF_MYCTU RecName: Full=Superoxide dismutase [Fe];       
    4::195     4e-34  40%  207 aa  SODF_MYCBO RecName: Full=Superoxide dismutase [Fe];       
   80::263     4e-34  40%  281 aa  SODF_BACSU RecName: Full=Probable superoxide dismutase [Fe];       
    3::192     7e-34  40%  201 aa  SODM_PROFR RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::189     9e-34  43%  196 aa  SODF_TETPY RecName: Full=Superoxide dismutase [Fe];       
   32::229     1e-33  38%  232 aa  SODM2_MAIZE RecName: Full=Superoxide dismutase [Mn] 3.2,
   30::221     3e-33  43%  233 aa  SODM_YEAST RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    3::196     1e-32  37%  203 aa  SODM_BORBU RecName: Full=Superoxide dismutase [Fe];       
   32::230     1e-32  42%  233 aa  SODM3_MAIZE RecName: Full=Superoxide dismutase [Mn] 3.3,
    4::187     2e-32  41%  207 aa  SODM_NOCAS RecName: Full=Superoxide dismutase [Mn];       
    4::187     3e-32  39%  207 aa  SODM_MYCLE RecName: Full=Superoxide dismutase [Mn];       
   26::215     8e-32  40%  222 aa  SODM_RAT RecName: Full=Superoxide dismutase [Mn], mitochondrial;   
   36::225     1e-31  38%  234 aa  SODM_CANAL RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   26::215     2e-31  39%  222 aa  SODM_MOUSE RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   30::224     9e-31  37%  231 aa  SODM_ARATH RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    4::197     9e-31  40%  213 aa  SODF_STRCO RecName: Full=Superoxide dismutase [Fe-Zn] 1;       
    4::186     2e-30  38%  200 aa  SODM1_HALSA RecName: Full=Superoxide dismutase [Mn] 1;       
   14::205     4e-30  38%  211 aa  SODM_DEBHA RecName: Full=Probable superoxide dismutase [Mn],
    1::143     1e-29  45%  145 aa  SODM_STRAY RecName: Full=Superoxide dismutase [Mn/Fe];       
    7::192     1e-29  39%  210 aa  SODB_ASPNG RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   24::202     2e-29  42%  223 aa  SODM_ONCVO RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    7::199     3e-29  38%  214 aa  SODF_AERPE RecName: Full=Superoxide dismutase [Mn/Fe];       
    2::162     4e-29  41%  163 aa  SODM_MYCKA RecName: Full=Superoxide dismutase [Mn];       
    2::162     1e-28  41%  163 aa  SODM_MYCIT RecName: Full=Superoxide dismutase [Mn];       
   10::205     1e-28  37%  211 aa  SODF_SULSO RecName: Full=Superoxide dismutase [Fe];       
   42::221     2e-28  42%  233 aa  SODM_PEA RecName: Full=Superoxide dismutase [Mn], mitochondrial;   
    2::161     2e-28  41%  163 aa  SODM_MYCSC RecName: Full=Superoxide dismutase [Mn];       
   10::205     2e-28  40%  211 aa  SODF_SULAC RecName: Full=Superoxide dismutase [Fe];       
    1::143     2e-27  43%  145 aa  SODM_STRPA RecName: Full=Superoxide dismutase [Mn/Fe];       
   21::190     2e-27  39%  210 aa  SODM_ASPFU RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   10::205     2e-27  38%  211 aa  SODF_ACIAM RecName: Full=Superoxide dismutase [Fe];       
    4::191     6e-27  37%  210 aa  SODM_ASPOR RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    4::143     1e-26  43%  145 aa  SODM_STRIN RecName: Full=Superoxide dismutase [Mn/Fe];       
    4::143     2e-26  41%  145 aa  SODM_STRPO RecName: Full=Superoxide dismutase [Mn/Fe];       
    5::193     7e-26  37%  210 aa  SODM_PENCH RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::185     7e-26  40%  200 aa  SODM_AGABI RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    5::143     9e-26  42%  145 aa  SODM_STRCB RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::185     2e-24  34%  199 aa  SODM2_HALVO RecName: Full=Superoxide dismutase [Mn] 2;       
    4::186     8e-24  34%  200 aa  SODM1_HALVO RecName: Full=Superoxide dismutase [Mn] 1;       
    1::143     2e-23  40%  145 aa  SODM_STRMT RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::143     7e-23  39%  145 aa  SODM_STROR RecName: Full=Superoxide dismutase [Mn/Fe];       
    2::144     2e-22  42%  144 aa  SODM_BRAFL RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::144     3e-22  39%  144 aa  SODM_PALVU RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    1::143     4e-22  38%  145 aa  SODM_STRSL RecName: Full=Superoxide dismutase [Mn/Fe];       
    1::144     6e-22  45%  144 aa  SODM_PETMA RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    9::193     6e-22  32%  203 aa  SODM_HALMA RecName: Full=Superoxide dismutase [Mn];       
    2::138     3e-20  42%  138 aa  SODM_MYCMR RecName: Full=Superoxide dismutase [Mn];       
    1::138     3e-20  39%  138 aa  SODM_MYCCE RecName: Full=Superoxide dismutase [Mn];       
    1::144     3e-20  43%  144 aa  SODM_EPTST RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
   20::194     7e-20  36%  213 aa  SODF_AQUPY RecName: Full=Superoxide dismutase [Fe];       
   20::194     3e-19  36%  213 aa  SODF_AQUAE RecName: Full=Superoxide dismutase [Fe];       
    1::138     4e-19  41%  138 aa  SODM_MYCMA RecName: Full=Superoxide dismutase [Mn];       
    2::138     5e-19  40%  138 aa  SODM_MYCSZ RecName: Full=Superoxide dismutase [Mn];       
    2::138     8e-19  40%  138 aa  SODM_MYCPH RecName: Full=Superoxide dismutase [Mn];       
    1::144     1e-18  39%  144 aa  SODM_PIG RecName: Full=Superoxide dismutase [Mn], mitochondrial;   
    1::143     2e-18  35%  145 aa  SODM_STRAI RecName: Full=Superoxide dismutase [Mn/Fe];       
   39::265     2e-18  31%  268 aa  RT26A_SCHPO RecName: Full=Putative 37S ribosomal protein S26A,
    2::138     9e-18  40%  138 aa  SODM_MYCCH RecName: Full=Superoxide dismutase [Mn];       
    5::144     3e-16  34%  144 aa  SODM_PARCL RecName: Full=Superoxide dismutase [Mn], mitochondrial; 
    2::146     6e-16  35%  146 aa  SODM2_HALME RecName: Full=Superoxide dismutase [Mn] 2;       
   64::208     2e-15  35%  220 aa  RT26B_SCHPO RecName: Full=Putative 37S ribosomal protein S26B,
    7::182     3e-12  28%  211 aa  SODF_PYRAE RecName: Full=Superoxide dismutase [Fe];       
   34::144     3e-11  31%  144 aa  SODM1_HALME RecName: Full=Superoxide dismutase [Mn] 1;       
   91::192     2e-10  36%  197 aa  SODM_RALME RecName: Full=Superoxide dismutase [Fe];       
   28::144     6e-08  26%  144 aa  SODM_HALHI RecName: Full=Superoxide dismutase [Mn];       
    9::256     9e-07  29%  266 aa  RT26_YEAST RecName: Full=37S ribosomal protein S26, mitochondrial;
  165::181     4e-05  88%  189 aa  YTRE_LEPBI RecName: Full=Uncharacterized 22 kDa protein in trpE
    1::193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKASGTLFNNGAQ
SODF_LEGPH      MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKAKGGIFNNAAQ
SODF_PSEAE      MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKSSSGGIFNNAAQ
SODF_PHOLE      ----LPALPFAMNALEPHISQETLEYHYGKHHNTYVVKLNGLVEGTELAEKSLEEIIKTSTGGVFNNAAQ
SODF_PSEPK      MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSSSGGIFNNAAQ
SODF_COXBU      MAFELPDLPYKLNALEPHISQETLEYHHGKHHRAYVNKLNKLIEGTPFEKEPLEEIIRKSDGGIFNNAAQ
SODF_PSEPU      MAFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSSGGIFNNAAQ
SODF_PSEHT      ----LPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVCSSDGGVFNNAAQ
SODF_BORPE      ------------------ISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKSSGGVFNNAAQ
SODF_SHIFL      MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAQ
SODF_ECOLI      MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAQ
SODF_ECOL6      MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAQ
SODF_ECO57      MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAQ
SODF_SALTY      MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTSEGGIFNNAAQ
SODF_SALTI      MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTSEGGIFNNAAQ
SODF_BABBO      MAFKLPALPYGMRELIPHISEETLSFHYGKHHAGYVNKLNSLIKGTPLESCTIEELILGQTGAVFNNAAQ
SODF_PLAVI      MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
SODF_PLAFX      MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
SODF_PLAFA      MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
SODF_PLAF7      MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
SODF_PLAMA      MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
SODF_ENTHI      MSFQLPQLPYAYNALEPHISKETLEFHHDKHHATYVNKLNGLVKGTEQEHKTLEELIQKPTQAIYNNAAQ
SODF_SYNY3      MAYALPNLPYDYTALEPCISKSTLEFHHDKHHXXXXXXXXXXXXGTDLDNQSIEDVIKAVAGDIFNNAAQ
SODF_PLEBO      MAFTQPPLPFPKDALEPYMKAETFDYHYGKHHAAYVTNLNKLVEGTPMESLSLEDVIKQSFGDVFNNAAQ
SODF_ANASP      -------LPYDFNALEQYMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQIAKAGIFNNAAQ
SODF_BACFR      MTYEMPKLPYANNALEPVISQQTIDYHYGKHLQTYVNNLNSLVPGTEYEGKTVEAIVASADGAIFNNAGQ
SODF_HELPJ      ----LRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQ
SODM_BACHD      MAFELPKLPYPANALEPHIDEATMNIHHGKHHNTYVTKLNAALEGSALAEKSIEALVSDLDAVVRNNGGG
SODF_HELPY      ----LRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFDILTKSSGGVFNNAAQ
SODM_LISMO      MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGPELASKSAEELVTNLDGAVRNHGGG
SODM_BACSU      MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGTALANKSVEELVADLDSVVRNNGGG
SODM_LISIN      MTYELPKLPYTYDALEPNFDKETMELHYTKHHNTYVTKLNEAVSGPELAEKPVEELVANLDGAVRNHGGG
SODF_SYNE7      MSYELPALPFDYTALAPYITKETLEFHHDKHHXXXXXXXXXXXKDTDLDGQPIEAVIKAIAGDLFNNAAQ
SODM1_BACAN     --HELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGAELADKSVEELVANLNEVVRNNGGG
SODF_CAMCO      ----LRKLPYDTNAFGDFLSAETFSYHHGKHHNTYVTNLNNLIKYTEFASKDLVSIIKSSSGGVFNNAAQ
SODF_PORGI      MTHELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKSEGGIFNNAGQ
SODM2_STAAW     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODM2_STAAS     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODM2_STAAR     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODM2_STAAN     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODM2_STAAM     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODM2_STAAC     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODM2_STAA8     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODM2_STAA3     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODF_RICCN      ----LPDLPYEKESFKPHFTLETFDYHHGKHHNTYVXXXXXXXXXXXXXXXXXXXXXXNSNAAIFNNAAQ
SODM_LISIV      MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNIYVTKLNEAVPGEELV-ANLDSVPEEIRGAVRNHGGG
SODF_SOYBN      --------PYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQVVGTELDGKSLEEIIVTSYNKAFNNAAQ
SODF_RICPR      ----LPDLPYDKESFKPHFTRETFDYHHGKHHNSYVQNLNNLIKDRELQKKDLEEIIENAEVAILNNASQ
SODM2_STAAB     MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKSVRNNGGG
SODM_XANCP      MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPVEELVSKLKGPVRNNGGG
SODM_XANC8      MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPVEELVSKLKGPVRNNGGG
SODM_ENTFA      MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKPELGEKSVENLISDMNAAVRNNGGG
SODF_CAMJJ      ----LRKLPYDTNAFGDFLSAETFSYHHGKHHNTYVTNLNNLIKDTEFAGKDLVSIIKTSNGGVFNNAAQ
SODF_CAMJE      ----LRKLPYDTNAFGDFLSAETFSYHHGKHHNTYVTNLNNLIKDTEFAGKDLVSIIKTSNGGVFNNAAQ
SODF_RICTY      ----LPDLPYAKESFKPHFTCETFDYHHGKHHNSYVQNLNNLLKDRELQKKDLEGIIKWSSKTVFNNASQ
SODM_BACCA      MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGPDLQNKXXXXXXXXXXXAVRNNGGG
SODF_RICFE      ----LPDLPYDKESFKPHFTPETFDYHHGKHHNAYVXXXXXXXXXXXXXXXXXXXXXXNSNAAIFNNAAQ
SODM_BACST      MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGPDLQNKXXXXXXXXXXXAVRNNGGG
SODF_METJ       --YTLPPLDYAYTALEPHIDAQTMEIHHTKHHQTYINNVNAALEGTSFANEPVEALLQKLDGPVRNNGGG
SODM1_BACCR     --------PYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGAELADKSVEELVANLNEVVRNNGGG
SODM_PSEAE      MPHALPPLPYAYDALEPHIDALTMEIHHSKHHQTYVNNLNAALEGTPYAEQPVESLLRQLAGLVVNNGGG
SODM_DEIRA      MAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG
SODM_STACA      MAFELPNLPYEFDALEPYIDKETMEIHHDKHHNTYVTKLNAAIEGTDLENKSIEEIVANLDSVVRNNGGG
SODM_STAXY      MAFELPNLPYGFDALEPHIDQQTMEIHHGKHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM_STAHJ      MAFELPNLPYATDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM_PSEPU      MPHTLPALPYAYDALEPHIDAQTMEIHHTKHHQTYVNGLNAAIEGTEWAEWPVEKLVGAVKGAVTNHGGG
SODM_STAS1      MAFELPNLPYGFDALEPHIDKQTMEIHHDKHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODF_RICBR      ----LPNLPYEKESFKPHFTAETFEYHHGKHHNAYVXXXXXXXXXXXXXXXXXXXXIIDWSSXXXXXXXX
SODM_STAES      MAFELPNLPYAYDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLEAKSIEEIVANLDSVVRNNGGG
SODM_STAEQ      MAFELPNLPYAYDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLEAKSIEEIVANLDSVVRNNGGG
SODM1_STAAW     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM1_STAAS     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM1_STAAR     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM1_STAAN     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM1_STAAM     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM1_STAAC     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM1_STAAB     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM1_STAA8     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODM1_STAA3     MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVVRNNGGG
SODF_NICPL      --------PYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIITYNKGAAFNNAAQ
SODM2_PLEBO     MAFELKPLPYAYDALEPYIDATTMQLHHDKHHAAYVNNLNAAIEKSDLQSMSVEDLVTHLDRTVRNNAGG
SODM_STRP1      ----LPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADVTKTLINNGGG
SODM_STAEP      MAFELPKLPYAFDALEPHIDKETMEIHHDKHHNTYVTKLNAVVEGTDLEAKSIEEIVANLDSVVRNNGGG
SODM_STRP3      ----LPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADVTKALINNGGG
SODM_STRP8      ----LPELPYAYDALEPQFDAETMSLHHDKHHATYVANTNAALEKHPEIGENLEELLADVTKALINNGGG
SODM_STRP6      ----LPELPYAYDALEPQFDAETMTLHHDKHHATYVANANAALEKHPEIGENLEELLADVTKALINNGGG
SODM_ACIAD      -------LPYATNALQPAIDQQTMEIHYGKHHKAYVDNLNAQIKTDKTDLIQLQKQISKYNTAVRNNGGG
SODM_LACLM      MAFTLPELPYAPNALEPFFDEATMRLHHGKHHQTYVNNLNAAIEXXXXXXAIPEDIRTAVR----NNGGG
SODM_LACLA      MAFTLPELPYAPNALEPFFDEATMRLHHGKHHQTYVNNLNAAIEXXXXXXAIPEDIRTAVR----NNGGG
SODM_THET8      ---KLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLLRHLAALRNNGGG
SODM_THET2      ---KLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLLRHLAALRNNGGG
SODM_THEAQ      ---KLPELGYPYEALEPHIDARTMEIHHQKHHGAYVTNLNAALEGAEVETLHLTALPADIQAAVRNNGGG
SODM_STRPY      ----LPELPYAYDALEPQFDAETMTLHHDKHHATYVANTDAALEKHPEIGENLEELLADVPKALINNGGG
SODM2_BACCR     ---QLPKLSYDYDELEPHIDSNTLSIHHGKHHATYVNNLNATLENTELHNKSLEELLCNLDTAVRNNGGG
SODM_BORPE      MPYVLPALSYAYDALEPHIDARTMEIHHTRHHQTYVNGLNAALEGAGLDSEEVEQLLRRIPGAVRNHGGG
SODM_MACMU      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM_MACFU      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM_MACFA      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM_CHLRE      MAQALPPLPYDYGSLEPHVDATTMNIHHTKHHQTYVNNLNAALDKPELKDLGLVDL-NKAVGTIRNNGGG
SODM_PONPY      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM_PANTR      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM_HYLLA      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM_HUMAN      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM3_PLEBO     ---QLPPLPYDAGALSKAIDAETMRIHHDRHHQTYVDNLNALKDQPNLQNLSIEAMLRDLNATIRNNAGG
SODM_MACNE      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM_STRR6      ----LPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEGEDLEAADVESIPADIRQALINNGGG
SODM_STRPN      ----LPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEGEDLEAADVESIPADIRQALINNGGG
SODM2_BACAN     ---QLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENSELHNKSLEELLCNLETAVRNNGGG
SODM_HORSE      --HSLPDLQYDYGALEPYINAQIMQLHHSKHHAAYVNNLN--VTEEKYQEALAKGDVTAQPALKFNGGGH
SODM_HAEIN      MSYTLPELGYAYNALEPHFDAQTMEIHHSKHHQAYVNNANAALEGLPAELSNLDKIPAEKRGALRNNAGG
SODM_CEBAP      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNALAKGDVTAQIALQPALK------FNGGGH
SODM_CALJA      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNALAKGDVTAQIALQPALK------FNGGGH
SODF_RHOCA      MAFELPALPYAHDALASGMSKETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSVEEIVAVAQSGIFNNASQ
SODM_CORDI      MTYALPELDYAYDALEPHIAAEIMELHHSKHHANYVNGANAALEKLQKENGEIGAVVTALSKDLFNLGGH
SODM_SHIFL      MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESPEFANLPVEELITKKKTVLRNNAGG
SODM_ECO57      MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESPEFANLPVEELITKKKTVLRNNAGG
SODM_ECOLI      MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESPEFANLPVEELITKKKTVLRNNAGG
SODM_STRAG      ----LPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADVSQAVINNGGG
SODM_STRA5      ----LPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADVSQAVINNGGG
SODM_STRA3      ----LPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADVSQAVINNGGG
SODM_SALTY      MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVXXXXXXLENLEFASLPVEELITKLDQVLRNNAGG
SODM_SALTI      MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVXXXXXXLENLEFADLPVEELITKLDQVLRNNAGG
SODM_YEREN      MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESPELAKFSVEDLIKDLDKVMRNNAGG
SODM_PASHA      MAYTLPELGYAYDALEPHFDAKTMEIHHSKHHQAYINNAN----------AALEELLEKCPGALIKDLSQ
SODF_METTM      --YELPELPYPYDALEPYISEEQLRIHHEKHHQAYVDGANGVLRKLDDARENGEEVDIKAAELSFHVGGY
SODF_RHIME      MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKSYGTLFNNAGQ
SODF_METTH      --YELPELPYPYDALEPHISREQLTIHHQKHHQAYVDGANALLRKLDEARESDTDVDIKAAELSFHVGGY
SODM_STRMU      ----LPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALENLEVLLADVEQIPADIRQSLINNGGG
SODM_SCHPO      ----LPPLPYAYNALEPALSETIMKLHHDKHHQTYVNNLNAAQEKLADPNLDLEGEVALQAAIKFNGGGH
SODM_BUCAP      MSYSLPDLSYAYNALEPFFDEETMRIHHTKHHQNYINNTNSILERTNFSSLSIEELMSENKNVLRNNAGG
SODM1_PLEBO     ---KLDPLPYDYAALEPYIDAQTMRLHHDKHHATYVNNINETLKAPDLQKQSVDSLIQNLNQVIRNNGGG
SODM_KLEPL      MAYELPQLPYAYDALEPHIDAKTXEIHHSKHHNTYVTNLNAAVEGTEFADKDINDLIAMLDAAVRNNGGG
SODM1_CAEEL     --HSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNVKEAIALQPALKFNGGGH
SODM_BOVIN      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVAEEKYRLEKGDVTAQIALQPALKFNGGGH
SODM_CHLTR      -SYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKSLDVANATLARLIAINPALRFNGGSH
SODF_ARATH      --------PFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIITYNNGDLFNNAAQ
SODM2_CAEEL     --HTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNLKEAIALQPALKFNGGGH
SODM_RABIT      MKHSLPDLPYDYGALEPHINAQIMELHHSKHHAAYVNNLNALARGDVTAHVALQPALK------FKGGGH
SODM_BUCBP      MTYVLPSLPYSYNSLEPFFDEKTMIIHHTRHHQAYINNTNSILNGTHYENLLIEELISKLNLALQNNAGG
SODM_BUCAI      MSYVLPSLPYSYNALEPFFDEETMKIHHTKHHQNYINNTNSILENTTFXXXXXXXXXXXKKNALRNNAGG
SODM_HAEDU      MTYQLPELGYAYDALEPYFDKETMEIHHSKHHQAYVNNSNALLPGALLKD--LTQVPAEKRTAVRNNLGG
SODM_DICDI      -SYTLPDLPYDYGALSPVISPEIMTLHHKKHHQTYVNNLNXXXXXXXXXXXXXXQMIALQSAIKFNGGGH
SODM_CHLMU      -SYKLPDLPYDYDALEPVISAEIMHLHHQKHHQGYINNLNEALKSLDVASATLTGLIAINPALRFNGGGH
SODM_HEVBR      -TFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALENDAIEKGDSAAVVKLQSAIKFNGGGH
SODM_GLOMM      --HTLPKLPYDYGALAPIISKDILEVHHGKHHQTYVNNLNAVEEQTEHSKKDVNKVVELSKNYAFNWGGH
SODM_ORYSJ      -TVALPDLPYDYGALEPAISGEIMRLHHQKHHATYVANYNKALEQLDAAVAKGDAIVHLQSAIKFNGGGH
SODM2_HALSA     --HELPSLPYDYDALEPHISEQVVTWHHDTHHQSYVDGLNS-AEETLAENRETGDHASTAGGDVTHNGCG
SODM_PRUPE      -TFSLPDLPYNYGALEPAISGDIMQLHHQNHHQTYVTNYNKALEQLHISKGDAPTVAKLHSAIKFNGGGH
SODM_CAVPO      --HSLPDLPYDYGALQPHINAEIMQLHHSKHHAAYLNNLN--IAEEKYQEALAKGDVTAQPALKFNGGGH
SODM_PASMU      MAYTLPELGYAYDALEPHFDAMTMEIHHSKHHQAYVXXXXXXXPGQLL--TKLAEVPADKLTAIRNNVGG
SODM_MYCSM      --YTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGVNDAIAKLEEARANGDHIFLNEKNLAFHLGGH
SODM_MYCS2      --YTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGVNDAIAKLEEARANGDHIFLNEKNLAFHLGGH
SODM_GANMI      MAHVLPDLPYAYNALEPFISQQIMELHHKKHHQTYVNSLNAAEQA--YAKASTKERIALQSALKFNGGGH
SODM_CAPAN      -TFSLPDLSYDYGALEPAISGEIMQLHHQKHHQTYITNYNNALQQLDAINKGDSPTVAKLQGAIKFNGGG
SODM_DROME      --HTLPKLPYDYAALEPIICREIMELHHQKHHQTYVXXXXXXXXXXXXXKSKSDKLIQLAPALRFNGGGH
SODM_CHLPN      --YSLPELPYDYDALEPVISSEIMILHHQKHHQIYINNLNAALKRLDAAETNLNELIALEPALRFNGGGH
SODM1_MAIZE     -TVTLPDLSYDFGALEPAISGEIMRLHHQKHHATYVANYNKALEQLEVSKGDASAVVQLQAAIKFNGGGH
SODM_MYCPA      --YTLPDLDWDYAALEPHISGQINEIHHTKHHATYVKGVNDALAKLEEARANEDHIFLNEKNLAFHLGGH
SODM_MYCAV      --YTLPDLDWDYAALEPHISGQINEIHHTKHHATYVKGVNDALAKLEEARANEDHIFLNEKNLAFHLGGH
SODM_NICPL      -TFSLPDLPYDYGALEPAISGDIMQLHHQNHHQTYVTNYNKALEQLHISKGDAPTVAKLHSAIKFNGGGH
SODM_MYCLP      --YTLPDLDWDYEALEPHISGQINEIHHTKHHATYVKGVNDALAKLEEARANEDHIFLNEKNLAFHLGGH
SODM_NEUCR      -TYSLPQLPYAYNALEPYISAQIMELHHSKHHQTYVTNLNNAVHVAAIASSDIPAQIAQQPAIKFNGGGH
SODM_MYCFO      --YTLPDLDYDYGALEPHISGQINELHHSKHHAAYVKGVNDAVAKLDEARANGDHIFLNEKNLAFHLGGH
SODM_CHAFE      --HTLPDLPYDYGALEPTISAEIMQLHHSKHHQTYVNNLNXXXXXXXXXXGDVSTIISLAPALRFNGGGH
SODM4_MAIZE     -TVALPDLSYDFGALEPAISGEIMRLHHQKHHATYVGNYNKALEQLDAAVAKGDSAVVQLQGAIKFNGGG
SODF_MYCTU      --YTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHILLNEKNLAFNLAGH
SODF_MYCBO      --YTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHILLNEKNLAFNLAGH
SODF_BACSU      --HVLPKLPYKYSALEPYISRDIMILHHTKHHQSYVDGLNKAESELKKARATKNDLITHWERELAFHGAG
SODM_PROFR      --YTLPELPYDYSALEPYISGEIMELHHDKHHKAYVDGANALDKLAEARDKADFGAINKLEKDLAFNLAG
SODF_TETPY      -------LNYEYSDLEPVLSAHLLSFHHGKHHQAYVNNLNATIAAATKENDA-HKIATLQSALRFNLGGH
SODM2_MAIZE     -TVALPDLSYDFGALEPVISGEIMRLHHQKHHATYVVNYNKALEQLDAVVVKGDSAVVQLQGAIKFNGGG
SODM_YEAST      ----LPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDAKEPSPANARKMIAIQQNIKFHGGGF
SODM_BORBU      ---KLPELGYDYDAVEPYIDAKTMEIHHSKHHNGFVMNLNGKIHLTDVSNINIHDFPEEFQTLIRNNAGG
SODM3_MAIZE     -TVALPDLSYDFGALEPVISGEIMRLHHQKNHATYVVNYNKALE-------QIDDVVVKGDDSAFNGGGH
SODM_NOCAS      --YTLPDLDYDYSALEPHISGQINELHHSKHHAAYVAGANTALEKLEAEAGDHSAIFLHEKNLAFHLGGH
SODM_MYCLE      --YTLPDLDWDYAALEPHISGEINEIHHTKHHAAYVKGVNDALAKLDEARAKDDHIFLNEKNLAFHLGGH
SODM_RAT        --HSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLN--VTEEKYHEALAKGDVTTQPALKFNGGGH
SODM_CANAL      --YSLPELDYEFSATEPYISGQINEIHYTKHHQTYVNNLNASIEQAAKSKGEVKKLVALEKAINFNGGGY
SODM_MOUSE      --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNA-TEEKYHEALAKGDVTTQVAALKFNGGGH
SODM_ARATH      -TFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDVNKGDASTVVKLQSAIKFNGGGH
SODF_STRCO      --YTLPELPYDYSALAPVISPEIIELHHDKHHAAYVDTLEQLAEARDKENGLEKNLAFHLSGHIL-----
SODM1_HALSA     --YELPPLPYDYDALEPHISEQVLTWHHDTHHQGYVNGWND-AEETLAENRETGDHASTAGGDVTHNGSG
SODM_DEBHA      ----LPQLDWAYDSLEPYISGKINEIHHKKHHQTYVNGYNSAIEQLEAESGDVKKAIVIQQNIKFHGGGH
SODM_STRAY      -----------------YIDKETMILHHDKHHATYLANANAALEDLEFLLSDVTRIPEDIRQALINNGGG
SODB_ASPNG      ----LPDLPYDYDALEPIISKQIMELHHKKHHQTYVXXXXXXXXXXXXXXXXITQLISIQQKLKFNGGGH
SODM_ONCVO      LKHVLPDLPYDYGALEPILSAEIMQVHHGKHHAAYVNALN---QAEEKVKEALAKGDTQAAGTKFNTGGH
SODF_AERPE      --YELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSNYAG
SODM_MYCKA      --------------------------HHSKHHATYVKGANDAVAKLEEARAKEDHILLNEKNLAFNLAGH
SODM_MYCIT      --------------------------HHSKHHATYVKGVNDALSKLEEARANEDHIFLNEKNLAFHLGGH
SODF_SULSO      --YELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEVVKGDLQDIQGIIRGLTFNNGHK
SODM_PEA        ----LPDLAYDYGALEPVISGEIMQIHHQKHHQTYITNYNKALEQLHVAKADTSTTVKLQNAIKFNGGGH
SODM_MYCSC      --------------------------HHSKHHATYVKGVNDAVAKLQEARANDDHIFLNEKNLAFHLGGH
SODF_SULAC      --YEFPQLPYKVDALEPYISKDIIDVHYNGHHKGYVDRLEKLIKGDLPQGQDLQGIL---RGLTFNNGHK
SODM_STRPA      -----------------YIDEETMHLHHDKHHQTYVNNVNAALEGEDLESADVESIPADIRQAVINNGGG
SODM_ASPFU      ------------------ISQQIMELHHKKHHQTYVNXXXXXXXXXXXXXXDVPKLVSVQQAIKFNGGGH
SODF_ACIAM      --YELPPLPYNLDALEPYISKEIIDVHYNGHHRGYVDRVNKILKGEI--SSGQYDIQGLLRGLVFNNGHK
SODM_ASPOR      -TFSLPPLPYAYDALEPVICKQIMEIHHQKHHQTYITXXXXXXXXXXXXXXXIPQLINLQQKIKFNGGGH
SODM_STRIN      --------------------QETMTLHHDKHHATYVANANAALEKHPEIGENLEELLANVESALINNGGG
SODM_STRPO      --------------------KETMILHHDKHHATYVANANAALEKHPEIGENLEELLADVSAALVNNGGG
SODM_PENCH      -THTLPPLPYAYDALEPVISKQIMELHHQKHHQTYIXXXXXXXXXXXXXXXDVPTLISLQQKLRFNGGGH
SODM_AGABI      MAHVLPDLPYAYDALEPYISRQIMELHHKKHCRGCLRHSTAVVGGFDL---SLFFILTTLGHI-------
SODM_STRCB      ---------------------ETMTLHHDKHHATYVANANAALEKHPEIGENLKELLADVTKALINNGGG
SODM2_HALVO     MSYELDPLPYEYDALEPHISEQVLTWHHDTHHQGYVNGWNA-DDETLAENREAGEFGSSAGANVTHNGSG
SODM1_HALVO     --YELDPLPYEYDALEPHISEQVLTWHHDTHHQGYVNGWNA-DDETLAENREAGEFGSSAGANVTHNGSG
SODM_STRMT      -----------------YIDAETMHLHHDKHHQTYVNNANAALEGEDLEAADVESIPADIRQALINNGGG
SODM_STROR      -----------------YIDAETMHLHHDKHHQAYVNNANAALEGEDLEAADVESIPADIRQALINNGGG
SODM_BRAFL      ------------------ISAEIMQVHHQKHHATYVXXXXXXXXXXXIHKQDVTKMIALQSAIKFNGGGH
SODM_PALVU      -----------------HISEMIMQIHHTKHHQAYINNLKACTE--KLKQAEQANDVAAMNALLFNGGGH
SODM_STRSL      -----------------YIDAETMTLHHDKHHATYVANANAALEGEDLEAADVEQIPADIRQALINNGGG
SODM_PETMA      -----------------HISANIMQLHHSKHHATYVNNLN-------VAEQKLAEAVAKGDVTAFNGGGH
SODM_HALMA      ----LPPLPYDYDALEPHISEQVLTWHHDTHHQGYVNGLES-AEETLAENRDAGDFGSSAAGNVTHNGCG
SODM_MYCMR      ---------------------------HSKHHATYVKGANDAV--TKLEEARAKEILLNEKNLAFNLAGH
SODM_MYCCE      --------------------------HHSKHHATYVKGANDALEKLEEARAKDDQVLLNEKNLAFNLAGH
SODM_EPTST      -----------------HISAEIMQLHHSKHHAAYXEKLEALGKGDVNTQVSLQPAFR------FNGGGH
SODF_AQUPY      ------------------ISNEQIEPHFEAHYKGYVAKYNEIQEKLADQNFASEYRELKVEETFNYMGVV
SODF_AQUAE      ------------------ISNEQIEPHFEAHYKGYVAKYNEIQEKLADQNFASEYRELKVEETFNYMGVV
SODM_MYCMA      --------------------------HHSKHHAAYVKGVNDAVAKLEEARAKDDHIFLNEKNLAFHLGGH
SODM_MYCSZ      ---------------------------HSKHHATYVKGANDAVAKLEEARAQFSSILLSEKNLAFNLAGH
SODM_MYCPH      ---------------------------HSKHHATYVKGVNDAIAKLEEARANGDHIFLHEKNLAFHLGGH
SODM_PIG        -----------------HINAQIMQLHHSEHHAAYVNNLN--VVEEKYQEALKKGDVTAQPALKFNGGGH
SODM_STRAI      -----------------HIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLSDVDAALINNGGG
RT26A_SCHPO     --HTVPNL--SQRNLLPLFSPEALDIAWDQHQRQVVKELNDRVKGTELEDSSVFNIIFQTAAATFQFASQ
SODM_MYCCH      ---------------------------HSKHHAAYVAGVNSAVAKLEEEKGDHAAIFLNEKNLAFHLGGH
SODM_PARCL      ---------------------DIMELHHKKHHATYTXXXXXXXXXXXXXXGDIGGMIALQPALKFNGGGF
SODM2_HALME     ----------------------------------YVNGLNA-AEETLRENRSSGDMDGSAAASVSHNGCG
RT26B_SCHPO     -----------------------------------------------------------ARANLFNYSSQ
SODF_PYRAE      --YTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRARDLSFHLNGH
SODM1_HALME     -----------------------------------------------------------------HNGCG
SODM_RALME      ----------------------------------------------------------------------
SODM_HALHI      -----------------------------------------------------------AMGNVTHNGCG
RT26_YEAST      --HVVPKLPNSKALLQPNILSSSGFKTVWFDYQRYLDKLTLATAGQSLESYYPFHILLKTAGNIFNLASS
YTRE_LEPBI      ---------------------ETLEFHYGKHHQTYVTK--------------------------------


                         .         .         *         .         .         .         .:140
query           VWNHTFYWNCLTPQGGGEPSGALLEAIEKNFGSFSDFKEKFSQSATTLFGSGWAWLVKNSDGSLDIVGTS
SODF_LEGPH      VWNHTFYWHSMSPNGGGEPKGRLAEAINKSFGSFAAFKEQFSQTAATTFGSGWAWLVQDQSGALKIINTS
SODF_PSEAE      VWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKKADGSLALASTI
SODF_PHOLE      VWNHTFYWNCLAPNAGGEPTGEVAAAIEKAFGSFAEFKAKFTDSAINNFGSSWTWLVKNANGSLAIVNTS
SODF_PSEPK      VWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKKADGSLALASTI
SODF_COXBU      HWNHTFYWHCMSPDGGGDPSGELASAIDKTFGSLEKFKALFTDSANNHFGSGWAWLVKDNNGKLEVLSTV
SODF_PSEPU      VWNHTFYWNCLAPNAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKKADGSLALASTI
SODF_PSEHT      IWNHTFYWNSLSPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKLADGSLDIVNTS
SODF_BORPE      VWNHTFYWNSLSPNGGGEPSGALADAIKAKWGSVDAFKEAFNKSAAGNFGSGWTWLVKKADGTLDIVNTS
SODF_SHIFL      VWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTS
SODF_ECOLI      VWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTS
SODF_ECOL6      VWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTS
SODF_ECO57      VWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTS
SODF_SALTY      VWNHTFYWNCLAPNAGGEPTGKLADAIAASFGSFAEFKAQFTDAAIKNFGSGWTWLVKSADGKLAIVSTS
SODF_SALTI      VWNHTFYWNCLAPNAGGEPTGKLADAIAASFGSFAEFKAQFTDAAIKNFGSGWTWLVKSADGKLAIVSTS
SODF_BABBO      IWNHTFYWNSMGPNCGGEPTGPIRKKIEEKFGSFSAFKTDFSNLLAGHFGSGWGWLVLKDDGTADIVQTH
SODF_PLAVI      IWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
SODF_PLAFX      IWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
SODF_PLAFA      IWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
SODF_PLAF7      IWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
SODF_PLAMA      IWNHTFYWDSMGPDCGGEPHGGIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
SODF_ENTHI      AWNHAFYWKCMC-GCGVKPSEQLIAKLTAAFGGLEEFKKKFTEKAVGHFGSGWCWLVEH-DGKLEIIDTH
SODF_SYNY3      AWNHSFYWNCMKPGGGGQPSGALADKINADFGSFDAFVEAFKQAGATQFGSGWAWLVLD-NGTLKVTKTG
SODF_PLEBO      VWNHTFFWNCLKAGGGGAPTGELAAKIDAAFGSLDKFKEEFSNAAATQFGSGWAWLV-DDGGTLKVTKTP
SODF_ANASP      VWNHTFFWNSLKPAGGGAPTGEFAAKINQDFGSFDKLKEEFSNAAATQFGSGWAWLI-DDGGTLKVTKTP
SODF_BACFR      VLNHTLYFLQFAPKPANEPAGKLGEAIKRDFGSFENFKKEFNAASVGLFGSGWAWLSVDKDGKLHITKEP
SODF_HELPJ      IYNHDFYWDCLSPKATA-LSDELKEALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDQKIEIIQTS
SODM_BACHD      HANHTLFWQILSPNGGGAPTGELADAINAEFGSFDQFKEKFADAAANRFGSGWAWLVVN-DGKLEITSTP
SODF_HELPY      IYNHDFYWDCLSPKATA-LSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDQKIEIIQTS
SODM_LISMO      HANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFNXXXXXRFGSGWAWLVVN-DGKLEIVSTA
SODM_BACSU      HANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFXXXXXGRFGSGWAWLVVNN-GKLEITSTP
SODM_LISIN      HANHTLFWSILSPNGGGAPTGDLKSAIESEFGTFDDFKEKFNXXXXXRFGSGWAWLVVN-NGKLEIVSTA
SODF_SYNE7      AWNHSFYWNSIKPNGGGAPTGALADKIAADFGSFENFVTEFKQAAATQFGSGWAWLVLD-NGTLKITKTG
SODM1_BACAN     HANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVN-NGELEVTSTP
SODF_CAMCO      VYNHDFYFDCIKPITGCGCGGSLQAALEKEFGSLENFKAEFIKGATGVFGSGWFWLVYNTNQKLEFVGTS
SODF_PORGI      TLNHNLYFTQFRXXXXXXXXXXXXEAIDKQFGSFEKFKEEFNTAGTTLFGSGWVWLASDANGKLSIEKEP
SODM2_STAAW     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVN-DGKLEIVTTP
SODM2_STAAS     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVN-DGKLEIVTTP
SODM2_STAAR     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVN-DGKLEIVTTP
SODM2_STAAN     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVN-DGKLEIVTTP
SODM2_STAAM     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVN-DGKLEIVTTP
SODM2_STAAC     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVN-DGKLEIVTTP
SODM2_STAA8     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVN-DGKLEIVTTP
SODM2_STAA3     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVN-DGKLEIVTTP
SODF_RICCN      IWNHTFFWHSIKPQGGGKPSGKILEQINKDFGSFEEFCEQFKQEAVGQFGSGWAWLIYH-DNRLQIIKTA
SODM_LISIV      HANHTLFWSSLSPNGGGAPTGNLKAAIESEFGTFDEFKEKFNXXXXXRFGSGWAWLVVN-NGKLEIVSTA
SODF_SOYBN      VWNHDFFWECMKPGGGGKPSGELLELIERDFGSFVKFLDEFKAAAATQFGSGWAWLAPDEDNKLVVLKSP
SODF_RICPR      IWNHTFFWYSIKPHGGGKPSGKVFEQISKDFGSFEQFCAQFKQEAVGQFGSGWTWVVYH-DNKLQIIKTS
SODM2_STAAB     HFNHSLFWEILSPNS--EEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVNN-GKLEIVTTP
SODM_XANCP      HANHSLFWTVMSPNGGGEPKGEVAKAIDKDIGGFEKFKEAFTKAALSRFGSGWAWLSVTPDKKVVVESTA
SODM_XANC8      HANHSLFWTVMSPNGGGEPKGEVAKAIDKDIGGFEKFKEAFTKAALSRFGSGWAWLSVTPDKKVVVESTA
SODM_ENTFA      HANHTFFWEIMAPNAGGQPTGAIKEAIDETFGSFDEMKAAFKTAATGRFGSGWAWLVVN-NGKLEITSTP
SODF_CAMJJ      VYNHDFYFDCIKPXXXXXXDANLQAALEKEFGSLENFKAEFIKGATGVFGSGWFWLVYNTNQKLEFVGTS
SODF_CAMJE      VYNHDFYFDCIKPXXXXXXDANLQAALEKEFGSLENFKAEFIKGATGVFGSGWFWLVYNTNQKLEFVGTS
SODF_RICTY      IWNHTFFWYSIKPHGGGKPSGKVFEQISQDFGSFEQFCEQFKQEALGQFGSGWVWVVYNNN-KLQIIKTS
SODM_BACCA      HANHSLFWTILSPNGGGEPTGELAEAINKKFGSFTAFKDEFSKAAAGRFGSGWAWLVVN-NGELEITSTP
SODF_RICFE      IWNHSFFWHSIKPQGGGKPSGKILEQINKDFGSFEGFCEQFKQEAVGQFGSGWAWLVYH-DNRLQIIKTA
SODM_BACST      HANHSLFWTILSPNGGGEPTGELADAINKKFGSFTAFKDEFSKAAAGRFGSGWAWLVVN-NGELEITSTP
SODF_METJ       HANHSLFWKVLTPNGGGEPKGALADAIKSDIGGLDTFKEAFTKAALTRFGSGWAWLSVTPEKKLVVESTG
SODM1_BACCR     HANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVN-NGELEVTSTP
SODM_PSEAE      HANHSLFWTVMSPQGGGRPDGDLGRAIDEQLGGFEAFKDAFTKAALTRFGSGWAWLSVTPQGSLLVESSG
SODM_DEIRA      HANHSMFWQIMXXXXXXXPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-KDGKLDVVSTA
SODM_STACA      HLNHSLFWQLLTPNS--EEKGTVIDKIKEEWGSLXXXXXXXXXXXXGQFGSGWAWLVVDKDGKLEIVSTP
SODM_STAXY      HLNHSLFWELLTPNS--EEKGTVVDKIKEQWGSLXXXXXXXXXXXXXRFGSGWAWLVVNN-GNLEIVTTP
SODM_STAHJ      HLNHSLFWELLTPNS--EEKGTVVDKIKEQWGSLXXXXXXXXXXXXXRFGSGWAWLVVNN-GQLEIVTTP
SODM_PSEPU      HANHSLFWTVMSPQGGGEPHGQLAQAIASQLGGFDAFKEAFTKAALTRFGSGWAWLSVTPQKTLVVESSG
SODM_STAS1      HLNHSLFWELLTPNS--EEKGTVVDKIKEQWGSLXXXXXXXXXXXXXRFGSGWAWLVVNN-GNLEIVTTP
SODF_RICBR      VWNHTFFWHSIKPNGGGKPSGKILKQINEDFGSFEEFCEQFKAEATGQFGSGWAWLVYHNN-RLQIVKTA
SODM_STAES      HLNHSLFWELLSPNS--EEKGEVVDKIKEQWGSLXXXXXXXXXXXXXRFGSGWAWLVVNN-GQLEIVTTP
SODM_STAEQ      HLNHSLFWELLSPNS--EEKGEVVDKIKEQWGSLXXXXXXXXXXXXXRFGSGWAWLVVNN-GQLEIVTTP
SODM1_STAAW     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODM1_STAAS     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODM1_STAAR     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODM1_STAAN     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODM1_STAAM     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODM1_STAAC     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODM1_STAAB     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODM1_STAA8     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODM1_STAA3     HLNHSLFWELLSPNS--EEKGTVVEKIKEQWGSLXXXXXXXXXXXXXXXGSGWAWLVVNN-GQLEIVTTP
SODF_NICPL      AWNHQFFWESMKPNXXXXXXXXXXXXINRDFGSYDAFVKEFKAAAATQFGSGWAWLAKPEEKKLALVKTP
SODM2_PLEBO     HVNHTMFWEIMGANGSGAPTGAISEAINNSFGSFDAFKQQFNDAGTKRFGSGWVWLVRSQQGDLQILSTP
SODM_STRP1      HLNHALFWELLSPEKQ-DVTPDVAQAIDDAFGSFDAFKEQFTAAATGRFGSGWAWLVVNKEGQLEITSTA
SODM_STAEP      HLNHSLFWELLTPNSXXXXXXXXXXXXQ--WGSLXXXXXXXXXXXXXRFGSGWAWLVVNN-GQLEIVTTP
SODM_STRP3      HLNHALFWELLSPEKQDVTSD-VAQAIDDAFGSFDAFKEQFTAAATGRFGSGWAWLVVNKEGQLEITSTA
SODM_STRP8      HLNHALFWELLSPEKQ-DVTPDVAQAIDDAFGSFDAFKEQFTAAATGRFGSGWAWLVVNKEGQLEITSTA
SODM_STRP6      HLNHALFWELLSPEKQ-DITPDVAQAIDDAFGSFDAFKEQFTAAATGRFGSGWAWLVVNKEGQLEITSTA
SODM_ACIAD      HFNHTFFWESLAATNKGQPSPALVKQITQDFGSLDAFKQKFNEAASGRFGSGWAWLIVTPNGKLAVTSTP
SODM_LACLM      HLNHSQFWLWLRPNTDGSENGEIGDAIAKEFGSFETFKTEFKAAATGRFGSGWAWLVVDEAGKLKVVSTA
SODM_LACLA      HLNHSQFWLWLRPNTDGSENGEIGDAIAKEFGSFETFKTEFKAAATGRFGSGWAWLVVDEAGKLKVVSTA
SODM_THET8      HLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTP
SODM_THET2      HLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTP
SODM_THEAQ      HLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFAALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVISTA
SODM_STRPY      HLNHALFWELLSPEKQ-DVTPDVAQAIDDAFGSFDAFKEQFTAAATGRFGSGWAWLVVNKEGQLEITSTA
SODM2_BACCR     HYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGE-ELSVMSTP
SODM_BORPE      HANHSLLWTVMSPSGGGRPDGRLAADIQAQLGGHDAFQAAFTQAALGRFGSGWAWLTVTPAGRLRVDSSA
SODM_MACMU      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFEKFKEKLTAASVGVQGSGWGWLGFNKEGQLQIAACP
SODM_MACFU      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFEKFKEKLTAASVGVQGSGWGWLGFNKEGQLQIAACP
SODM_MACFA      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFEKFKEKLTAASVGVQGSGWGWLGFNKEGQLQIAACP
SODM_CHLRE      HYNHSFFWKVMTPSNTNGPNGDVKAAIEASFGSVDEMKAKFNAAAAGRFGSGWAWLSVKPDGSLSIDSTP
SODM_PONPY      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
SODM_PANTR      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
SODM_HYLLA      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTATSVGVQGSGWGWLGFNKEGHLQIAACP
SODM_HUMAN      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKEGHLQIAACP
SODM3_PLEBO     HLNHTIFWQIMSPDGGGQPTGAIAQAINQTFGNFESFRKQFNEAGGDRFGSGWVWLVRNAQGQLQIVSTA
SODM_MACNE      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFEKYKEKLTAASVGVQGSGWGWLGFNKEGQLQIAACL
SODM_STRR6      HLNHALFWELMTPEKTA-PSAELAAAIDATFGSXXXXXXXXXXXXXXRFGSGWAWLVVNKEGKLEVTSTA
SODM_STRPN      HLNHALFWELMTPEKTA-PSAELAAAIDATFGSXXXXXXXXXXXXXXRFGSGWAWLVVNKEGKLEVTSTA
SODM2_BACAN     HYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGE-ELSVMSTP
SODM_HORSE      I-NHTIFWTNLSPNGGGEPKGKLLDAIKRDFGSFDKFKEKLTAVSAGVQGSGWGWLGFNKDGRLQIVACP
SODM_HAEIN      HTNHSLFWKSL--KKGTTLQGALKDAIERDFGSVDXXXXXXXXXXXTRFGSGWAWLVLTAEGKLAVVSTA
SODM_CEBAP      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKERLTAASVGVQGSGWGWLGFNKEGHLQIAACP
SODM_CALJA      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKERLTAASVGVQGSGWGWLGFNKEGHLQIAACP
SODF_RHOCA      HWNHAQFWEMMGPGEDKKMPGALEKALVESFGSVAKFKEDXXXXXXXXXXXXXXXLVKDSDGALKITKTE
SODM_CORDI      T-NHSIFWKNLSPNGGGEPTGALAEAIAKEFGSFEKFKDHFSAAALGLQGSGWAVLGYDHIGGRLVIETD
SODM_SHIFL      HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
SODM_ECO57      HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
SODM_ECOLI      HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGD-KLAVVSTA
SODM_STRAG      HLNHALFWELMSPEET-QISQELSEDINATFGSFEDFKXXXXXXXXXXXXSGWAWLVVNAEGKLEVLSTA
SODM_STRA5      HLNHALFWELMSPEET-QISQELSEDINATFGSFEDFKXXXXXXXXXXXXSGWAWLVVNAEGKLEVLSTA
SODM_STRA3      HLNHALFWELMSPEET-QISQELSEDINATFGSFEDFKXXXXXXXXXXXXSGWAWLVVNAEGKLEVLSTA
SODM_SALTY      HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAATRFGSGWAWLVLKGD-KLAVVSTA
SODM_SALTI      HANHSLFWKGL--KKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAATRFGSGWAWLVLKGD-KLAVVSTA
SODM_YEREN      HANHSLFWXXXXXXXXXXXXXXA--AIERDFGSVDSFKEKFEAAAATRFGSGWAWLVLKDDGKLAVVSTA
SODM_PASHA      VVNHTLFWKGL--KTGTTLQGALKEAIERDFGSVEAFQSEFEKAATTRVGSGWAWLVLE-EGKLAVVSTA
SODF_METTM      VL-HLFFWGNMGPECGGEPDGRLAEYIEKDFGSFQRFKKEFSQAAVSAEGSGWAVLTQRTDRLFIMQVEK
SODF_RHIME      HYNHVHFWKWMKKGGGGTSPGKLDAAIKSDLGGYDKFRADXXXXXXXXXXXXXXXLVKN--GKLEISKTP
SODF_METTH      VL-HLFFWGNMGPECGGEPSGKLAEYIEKDFGSFERFRKEFSQAAISAEGSGWAVLTQRTDRLFIMQVEK
SODM_STRMU      HLNHALFWELLSPEKT-KVTAEVAAAINEAFGSXXXXXXXXXXXXXXRFGSGWAWLVVDKEGKLEVTSTA
SODM_SCHPO      I-NHSLFWKILAPQGGGKPSGSLHKAITSKWGSLEDFQKEMNAALASIQGSGWAWLIVDKDGSLRITTTA
SODM_BUCAP      HINHSLFWKGL--KIGTILQGDLKSEINKQFGSVEYFKSKFEDIALNHFGSGWIWLV-NQNGILSIVSTI
SODM1_PLEBO     HVNHTMFWQIMAPKAGGTPTGAVAKAIDQTFGSFDAFKQQFNKAGADRFGSGWAWLVSDRQGKLSITSTA
SODM_KLEPL      HANHTLFWEVIAPGGSNTPVGEVAKAIDAKFGSFDXXXXXXXXXXXXRFGSGWAWLIVDGD-SVAVTSTP
SODM1_CAEEL     I-NHSIFWTNLA-KDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATC
SODM_BOVIN      I-NHSIFWTNLSPNGGGEPQGELLEAIKRDFGSFAKFKEKLTAXXXXXXXXXXXXXXFNKEGRLQIAACS
SODM_CHLTR      I-NHSLFWEMLAPQGKGPPRHELLKLIEKFWGSFDNFLKNFITSSAAVQGSGWGWLAFCPQKQELMVQTT
SODF_ARATH      AWNHEFFWXXXXXXXXXXXXXXXXALLERDFTSYEKFYEEFNXXXXXXXXXXXXXLAYSNE-KLKVVKTP
SODM2_CAEEL     I-NHSIFWTNLA-KDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATC
SODM_RABIT      I-NHTIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKERLTAXXXXXXXXXXXXXXFNKEGHLQIAACA
SODM_BUCBP      HINHSLFWKWLKLNTILKDDFKII--LEKNFKSVDFFKKQFEKIALSHFGSGWIWLIKKYDNTLRIVTTV
SODM_BUCAI      HINHSFFWKSL--KSGTVLTNDLKIEIEKQFGTIDEFKEKFESVALNHFGSGWVWLV-NQNGVLSIVSTV
SODM_HAEDU      HVNHTLFWKGL--KTGTTLQGALKDAIIRDFGSVXXXXXXXXXXXXTRFGSGWAWLVLE-EGKLAVVSTA
SODM_DICDI      V-NHSIFWTNLAPKGGVAPSGPLADAINKQYGSIEKLIEKMSAETTAIQGSGWGWLGYDKANDRLVIQTQ
SODM_CHLMU      I-NHSLFWEMLAPQGGTPPRHELLKLIEKFWGSFDNFLKNFISSSAAVQGSGWGWLAFCPKKQELMIQTT
SODM_HEVBR      V-NHSIFWKNLAPEGGGEPHGSLGWAIDADFGSLEKLIQLMNAEGAALQGSGWVWLALDKELKKLVVETT
SODM_GLOMM      L-NHSIYWQNLSPT-KSEPSADLKKAIEEQFSSFEQFKKDLSALSIGVQGSGWGWLGYNKKXKLQILAVS
SODM_ORYSJ      V-NHSIFWNNLKPEGGGDPPHAKLGAIDEDFGSFEALVKKMSAEGAALQGSGWVWLALDKEAKLSVETTA
SODM2_HALSA     HYLHTMFWEHMSPDGGGEPSGALADRIAADFGSYENWRAEFEVAAGA--ASGWALLVYDPVAQLRNVAVD
SODM_PRUPE      I-NHSIFWKNLAPEGGGEPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWLALDKELKKLVVETT
SODM_CAVPO      I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAXXXXXXXXXXXXXXFNKEGCLQIAACS
SODM_PASMU      HLNHSLFWKSL--KKGTTLQGALKDAIVRDFGSVXXXXXXXXXXXXTRFGSGWAWLVLQENGKLAVVSTA
SODM_MYCSM      I-NHSIWWKNLSPNGGDKPTGELAAAIDDQFGSFDKFQAQFTAAANGLQGSGWAVLGYDSLGGRLLLYDQ
SODM_MYCS2      I-NHSIWWKNLSPNGGDKPTGELAAAIDDQFGSFDKFQAQFTAAANGLQGSGWAVLGYDSLGGRLLLYDQ
SODM_GANMI      I-NHSLFWKNLAPNGGALADGPLKSAIEQNWGSVDNFIKEFNATTAAIQGSGWGWLGLNATKRLEITTTA
SODM_CAPAN      HINHSVFWKNLAPEGGGEPKGSLGSAIDTNFGSLEAVIQKMNAEGAALQGSGWVWLGLDKELKRLVIETT
SODM_DROME      I-NHTIFWQNLSPNKT-QPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGFNKSGKLQLAALP
SODM_CHLPN      I-NHSLFWETLAPQGGGQPKHELLSLIERFWGTMDNFLKKLIEVAAGVQGSGWAWLPAKQELVLQATANQ
SODM1_MAIZE     V-NHSIFWKNLKPEGGGEPPGKLGWAIDEDFGSFEALVKKMNAEGAALQGSGWVWLALDKEAKKVSVETT
SODM_MYCPA      V-NHSIWWKNLSPDGGDKPTGELAAAIDDAFGSFDKFRAQFSAAANGLQGSGWAVLGYDTVGSRLLLYDQ
SODM_MYCAV      V-NHSIWWKNLSPDGGDKPTGELAAAIDDAFGSFDKFRAQFSAAANGLQGSGWAVLGYDTLGSRLLLYDQ
SODM_NICPL      I-NHSIFWKNLAPEGGGEPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWLGVDKELKRLVIETT
SODM_MYCLP      V-NHSLWWKNLSPDGGDKPTGELAAAIDDAFGSFDKFRAQFSAAANGLQGSGWAVLGYDTLGSRLLLYDQ
SODM_NEUCR      I-NHSLFWKNLAPAETPEAAPSLAAEIEKTWGSFDEFKKAFSAALLGIQGSGWGWLVKESKGRLRIITTK
SODM_MYCFO      V-NHSIWWKNLSPNGGDKPTGDLAAAIDDQFGSFDKFQAQFTAAANGLQGSGWAVLGYDSLGDRLLLYDQ
SODM_CHAFE      I-NHSIFWQNLSAD-GGEPEGELLAAINRDFGSVENMKNQLSAQTVAVQGSGWGWLGYIAEGALQIATCP
SODM4_MAIZE     HVNHSIFWKNLKPEGGGEPPGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEPKLSVETTA
SODF_MYCTU      V-NHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNLLIFQVY
SODF_MYCBO      V-NHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNLLIFQVY
SODF_BACSU      HYLHSIFWFSMHPNGKRRPTGALFQMIDLSFGSYSAFKEHFTQASKKVEGVGWAILVAPRSGRLEILTAE
SODM_PROFR      HVNHSVFWKNMAPKGSARPTDELGAAIDEFFGSFDNMKAQFTAAATGIQGSGWASLVWDPLGKINTLQFY
SODF_TETPY      V-NHWIYWDNLAPSGGGDEHSPLTKAIKEKWGSYENFITLFNTRTAAIQGSGWGWLGYDTSKSLRLFELG
SODM2_MAIZE     HFNHSIFWENLKPEGGEPPHGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEPKLSVETTA
SODM_YEAST      T-NHCLFWENLAPQGGGEPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNNGGKLDVVQTY
SODM_BORBU      YSNHTLYFRTLRPGNKDNLFEKFKDDINAAFGSLDVLKANLKDTAMKIFGSGWAWLVLCPESGLKVISMP
SODM3_MAIZE     V-NHSIFWKNLKPEGGGEPPGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEAKKVSVETT
SODM_NOCAS      V-NHSIWWKNLSPNGGDKPVGELAAAIDDQFGSFDKFRAQFTAAANGLQGSGWAVLGYDTLGQKLLLYDQ
SODM_MYCLE      V-NHSIWWKNLSPNGGDKPTGGLATDIDETFGSFDKFRAQFSAAANGLQGSGWAVLGYDTLGNLLTFQLY
SODM_RAT        I-NHSIFWTNLSXXXXXXXXXXXXXAIKRDFGSFEKFKEKLTAXXXXXXXXXXXXXXFNKEGRLQIAACS
SODM_CANAL      L-NHCLWWKNLAPQGGGQPDSKLGKQIVKQFGSLDKLIEITNGKLAGIQGSGWAFIVKNNGDTIDVITTA
SODM_MOUSE      I-NHTIFWTNLSXXXXXXXXXXXXXAIKRDFGSFEKFKEKLTAXXXXXXXXXXXXXXFNKEGRLQIAACS
SODM_ARATH      V-NHSIFWKNLAXXXXXXXXXXXXXAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTT
SODF_STRCO      ---HSIYWHNMTGDGGGEPLGELADAIAESFGSFAGFRAQLTKAAATTQGSGWGVLAYEPSGRLIVEQIY
SODM1_HALSA     HILHTLFWQSMSPAGGDEPSGALADRIAADFGSYENW--RXXXXXXXXXXXGWALLVYDSSNTLRNVAVD
SODM_DEBHA      T-NHVLFWKSLAPQNGGKHPGSLGKKIIEQYGSIDNLISITNAKLASIQGSGWAFIVKNKQGNLDVVTTY
SODM_STRAY      HLNHALFWELLTPEKQ-EPTAEVLAAIEDAFGSFEDFKTAFTQAATTRFGSGWAWLVVNQEGKLEVMSTG
SODB_ASPNG      I-NHSLFWKNLSPATNLERSASLKDAIEKQWGSVKNFTDAFEAVLLGIQGSGWGWLVSSGKGFLEIVTTK
SODM_ONCVO      I-NHTLFWEGLTAKNSGEPNSELMTAIKKDFGSLETMIDKLNAKTIAIQGSGWGWLAYDKEMQLACCPNQ
SODF_AERPE      HIMHTIFWPNMAXXXXXXXXXXVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPTEELRILQVE
SODM_MYCKA      V-NHTIWWKNLSPNGGDKPTGELAAAIDEAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNLLIFQVY
SODM_MYCIT      V-NHSIWWKNLSPDGGDKPTGELAAAIDDAFGSFDRFRAQFSAAANGLQGSGWAVLGYDTLGNRLLLYDQ
SODF_SULSO      L--HALYWENMAPSXXXXXXXALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTEGNLQIMTFE
SODM_PEA        I-NHSIFWKNLAPEGGGEPPKESLGAIDTNFGSLEALIQKINAE-----GAALQWLGLDKDLKRLVVETT
SODM_MYCSC      V-NHSIWWKNLSPDGGDKPTGELAAAIDDAFGSFDKFRAQFSAAANGLQGSGWAVLGYDTLGSRLLLYDQ
SODF_SULAC      L--HAIYWNNMXXXXXXXXXXXLADLINKQYGSFDRFKQVFSESANSLPGSGWTVLYDNESGNLQIMTVE
SODM_STRPA      HLNHALFWELMTPEQTA-PSAELAAAIDATFGSFEDFKXXXXXXXXXRFGSGWAWSVVNKEGKLEVTSTA
SODM_ASPFU      I-NHSLFWKNLAPEGGGKIDQALKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGPGKLDIT-TT
SODF_ACIAM      L--HSLYWQNMXXXXXXXXXXXXVDLIEKQYGSFEKFKALFTEAANSLPGTGWTVLYYEENGNLQIMTFE
SODM_ASPOR      I-NHSLFWKNLAPHASPETNPVLKAAIEAQYGSVEKFKEAFGATXXXXXXXXXXXXVANGPGGLEIVSTK
SODM_STRIN      HLNHALFWELLSPEKT-EVTKEVASAIDQAFGSFDAFKEQFAAAATGRFGSGWAWLVVTKEGSLEITSTA
SODM_STRPO      HLNHALFWELLSPEKT-EVTSDVASAIDEAFGSFESFKDAFTTAATSRFGSGWAWLVVNKEGKLEVMSTA
SODM_PENCH      I-NHSLFWKNLTPPGAGAP--ALREAIVSRWGSHEAFVKAFGAEXXXXXXXXXXXXVSGAKGRLEIVTTK
SODM_AGABI      --NHSLFWQNLAPAGGQLKPGPLKDAIDQTFGGLDNLKKEFNTTTAGIQGSGWGWLVNPSNKRLEISTTP
SODM_STRCB      HLNHALFWELLSPEKQ-EITADVAQAIDEAFGSFDAFKEQFTAAATGRFGSGWAWLVVNKEGQLEITSTA
SODM2_HALVO     HILHDLFWQNMSPEGGDEPEGLLAERIAEDFGSYXXXXXXXXXXXXXXXXXXLLVYDSFSNQLRNVVVDK
SODM1_HALVO     HILHDLFWQNMSPEGGDEPEGLLAERIAEDFGSYXXXXXXXXXXXXXXXXXXLLVYDSFSNQLRNVVVDK
SODM_STRMT      HLNHALFWELMTPEKTA-PSAELAAAIDATFGSXXXXXXXXXXXXXXRFGSGWAWLVVNKEGKLEVTSTA
SODM_STROR      HLNHALFWELMTPEKTA-PSAELAAAIDATFGSXXXXXXXXXXXXXXRFGSGWAWLVVNKEGKLEVTSTA
SODM_BRAFL      I-NHSIFWNNLCPSGGGEPTGPLAEAITRDFGSFEAFKEKMTAATVAVQGSGWGWLLDPTSKKLRIVACP
SODM_PALVU      I-NHTIFWTNMAPSAGGEPAGPVADAITKEFGSFQAFKDKFSTASVGVKGSGWGWLGYCPKNDKLAVATC
SODM_STRSL      HLNHALFWELLSPEKQ-EPTAEVAAAINEAFGSXXXXXXXXXXXXXXRFGSGWAWLVVNDEGKLEVVSTA
SODM_PETMA      I-NHSIFWTNLSPNGGGAPTGDLQKAIETDFGSFTKLQEKMSAVSVAVQGSGWGWLGYDKEGRLRIAACA
SODM_HALMA      HYLHTLFWXXXXXXXXXXXXXXXXXRIEEDFGSYEGWKGEF-EXXXXXXXXXXLLVYDPVAKQLRNVPVD
SODM_MYCMR      V-NHTIWWKNLSPNGGDKPTGELAAAIDEAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNLLIFQVY
SODM_MYCCE      V-NHTIWWKNLSPNGGDKPTGELAAAIDDAFGSFDKFRAQFHAAATTVQGSGWAALGWDNLGKLLIFQVY
SODM_EPTST      I-NHSIFWRNLSPSGGGQPCGDLLKAIENDFGSVDKLREKLVAAAVGVQGSGWAWLGFNKESKRLQIATC
SODF_AQUPY      L--HELYFGMLTPGGKGEPSEALKKKIEEDIGGLDACTNELKAAAMAF--RGWAILGLDIFSGRLVVNGL
SODF_AQUAE      L--HELYFGMLAPGGKGEPSEALKKKIEEDLGGLDACTNELKAAAIAF--RGWAILGLDIFSGRLVVNGL
SODM_MYCMA      V-NHSIWWKNLSPNGGDKPTGDLASAIDDAFGSFDKFRAQFSAAANGLQGSGWAVLGYDSLGDKLLLYDQ
SODM_MYCSZ      V-NHTIWWKNLSPNGGDKPTGELAAAIDDAFGSFDTFSAQFHAASTTVQGSGWAALGWDTLGNLLIFQVY
SODM_MYCPH      V-NHTIWWKNLSPHGGDKPTGDLAAAIDDQFGSFDNFRAQFTAAANGLQGSGWAVLGYDTLGDRLLLYDQ
SODM_PIG        I-NHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFEKFKEKLTAXXXXXXXXXXXXXXFNKEGRLQIAACS
SODM_STRAI      HLNHALFWELLSPEKT-EISAELAADIDETFGSXXXXXXXXXXXXXXXXGSGWAFLVVNPKGKLEVISTA
RT26A_SCHPO     AYNNHFFFQSLIGKRAAEANAAINKAVNENFGSKENLLSKIHELASNSFGACWLWIVIDDYNRLNLLRTF
SODM_MYCCH      V-NHSIWWKNLSPNGGDKPTGDLAAAIDDQFGSFDKFQAQFTAAANGLQGSGWAVLGYDSLGQKLLLYDQ
SODM_PARCL      I-NHCIFWTNLSPQGGGVPEGDLADAINRDFGSFDSFKTTLTAATVAIQGSGWGWLGFDPKTHHLKIATC
SODM2_HALME     HYLHHLFWRCMTPNGGGEPTGDLRDRIESDFGSYEGWEAEFREAASWPAG-GWALLVYDPTKQLRNLAVQ
RT26B_SCHPO     LVNHDFFFSGLIPSADADLGAINLKGIDASFGSFGELKSQMVDVGNSVFGDGWLWLVYSPEKSLSLLCTY
SODF_PYRAE      ILHSIFWPNAXXXXXXXXXXXXIADLINXXXXXXXXXXXXXXQAAKNVEGVGWAILVYXXXXXXXXXXXX
SODM1_HALME     HILHDLFWQNMSPEGGDEPAGALADRIAEDFGSY-DXXXXXXXXXXXXXXXXXLLVYDSFSNQLRNVVVD
SODM_RALME      ---------------------ALKTAIERDFGSVERWQAEFTAMGKALGGSGWVLLTYSPDGRLVNQWAS
SODM_HALHI      HYLHTLFWXXXXXXXXXXXXXXXXXRIEEDFGSYEGWKGEF-EXXXXXXXXXXLLVYDPVAKQLRNVPVD
RT26_YEAST      IHNNHLFVENILPSAKTEPSRLFLSKIKDSFNG-SDWEEMIYRAENEVLGQGWLFLVENNEKKLFILTSN
YTRE_LEPBI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLEAFWKLANWDFVAKNLAN
SODF_LEGPH      NAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIEAFWSLVNWDFASSNL--
SODF_PSEAE      GAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWDFVAKNFA-
SODF_PHOLE      NAGCPITEGVTPLLTVDLWEHAYYIDYRNLRPSYMDGFWALVNWDFVSKNLA-
SODF_PSEPK      GAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWAFVAE----
SODF_COXBU      NARNPMTEGKKPLMTCDVWEHAYYIDTRNDRPKYVNNFWQVVNWDFVMKN---
SODF_PSEPU      GAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWAFVAE----
SODF_PSEHT      NAATPLTDGVTPILTVDLWEHAYYIDYRNVRPDYLKGFWSLVNWEFANANFA-
SODF_BORPE      NAATPLTTADKALLTCDVWEHAYYIDYRNARPKYLENFWALVNWEFAAKNFA-
SODF_SHIFL      NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLA-
SODF_ECOLI      NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLA-
SODF_ECOL6      NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLA-
SODF_ECO57      NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLA-
SODF_SALTY      NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPNYLEHFWALVNWEFVAKNLA-
SODF_SALTI      NAGXXXXXXXXXXXXXXXWEHAYYIDYRNARPNYLEHFWALVNWEFVAKNLA-
SODF_BABBO      DAGSPLKENGRPLLCCDVWEHAYYIDYKNDRLSYINSWWNLVNWDFANKNL--
SODF_PLAVI      DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENL--
SODF_PLAFX      DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENL--
SODF_PLAFA      DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENL--
SODF_PLAF7      DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENL--
SODF_PLAMA      DAGNPIKDNTIPILTCDIWEHAYCIDYRNDRASYVKAWWNLVNWNFANENL--
SODF_ENTHI      DAVNPMTNGMKPLLTCDVWEHAYYIDTRNNRAAYLEHWWNVVNWKFVEEQL--
SODF_SYNY3      NAENPMTAGQTPLLTMDVWEHAYYLDYQNRRPDYIADFGKLVNWDFVAANLA-
SODF_PLEBO      NAENPLVHGQKPLLTLDVWEHAYYLDFQNARPAFIKNFLNLVNWDFVAQNLA-
SODF_ANASP      NAENPLAHGQKALLTLDVWEHAYYIDFRNARPAFIKNYLNLVNWDFAAANYA-
SODF_BACFR      NGSNPVRAGLKPLLGFDVWEHAYYLDYQNRRADHVNKLWEIIDWDVVEKRL--
SODF_HELPJ      NAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHVNWHFVSQ----
SODM_BACHD      NQDTPLMEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVAK----
SODF_HELPY      NAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQ----
SODM_LISMO      NQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPEYIETFWNVINWD--------
SODM_BACSU      NQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVAR----
SODM_LISIN      NQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPEYIDTFWNVVNWD--------
SODF_SYNE7      NADTPIAHGQTPLLTIDVWEHAYYLDYQNRRPDYISTFEKLANWDFASANYA-
SODM1_BACAN     NQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEK----
SODF_CAMCO      NAATPITEDKVPLLVVDVWEHAYYVDHRNARPAYLEKFYAHINWEFVAK----
SODF_PORGI      NAGNPVRKGLNPLLGFDVWEHAYYLTYQNRRADHLKDLWSIVDWDIV------
SODM2_STAAW     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODM2_STAAS     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODM2_STAAR     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODM2_STAAN     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODM2_STAAM     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODM2_STAAC     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODM2_STAA8     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODM2_STAA3     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODF_RICCN      NAGTPIAHGMKPLLACDVWEHAYYIDYRNKRPDYVDIFIKMINWKFVEDNL--
SODM_LISIV      NQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRPEYIDTFWNVINWD--------
SODF_SOYBN      NAVNPLVGGYYPLLTIDVWEHAYYLDFQNRRPDYISVFMKLVSWDAVSSRL--
SODF_RICPR      NAGTPIVNFMKPILACDVWEHAYYIDYRNKRSDYIDIFIRMINWKFVEDNL--
SODM2_STAAB     NQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNW---------
SODM_XANCP      NQDSPLFEGNTPILGLDVWEHAYYLKYQNRRPDYIGAFYNVVNWDEVER----
SODM_XANC8      NQDSPLFEGNTPILGLDVWEHAYYLKYQNRRPDYIGAFYNVVNWDEVER----
SODM_ENTFA      NQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRPDYIEAFWNVVNWDKV------
SODF_CAMJJ      NAATPITEDKVPLLVVDVWEHAYYVDHRNARPAYLEKFYAHINWEFVAK----
SODF_CAMJE      NAATPITEDKVPLLVVDVWEHAYYVDHRNARPAYLEKFYAHINWEFVAK----
SODF_RICTY      NADTPIVNLMKPILVCDVWEHAYYIDYRNKRSDYIDIFISMINWKFVEDNL--
SODM_BACCA      NQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPEYIAAFWNIVNWDEVAK----
SODF_RICFE      NAGTPIANGMKPLLACDVWEHAYYIDYRNKRPDYVDIFIKMINWKFVEDNL--
SODM_BACST      NQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPEYIAAFWNVVNWDEVAK----
SODF_METJ       NQDSPLSTGNTPILGLDVWEHAYYLKYQNRRPEYIGAFFNVVNWDEVSR----
SODM1_BACCR     NQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEK----
SODM_PSEAE      NQDSPLMNGNTPILGLDVWEHAYYLKYQNRRPEYIGAFYNVIDWREVARRYA-
SODM_DEIRA      NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
SODM_STACA      NQDNPITEGKTPILGLDVWEHAYYLKYQNKRPDYIDAFWNVVNWNKV------
SODM_STAXY      NQDNPITEGKTPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWEKV------
SODM_STAHJ      NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWEKV------
SODM_PSEPU      NQDSPLMFGNTPIFGLDVWEHAYYLKYQNRRPEYIGAFYNVIDW---------
SODM_STAS1      NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWEKV------
SODF_RICBR      NAGTPIANGMQPLLACDVWEHAYYIDYRNKRPDYVDIFIKMINWEFVENNL--
SODM_STAES      NQDNPITEGKTPILGLDVWEHAYYLKYQNKRPDYINAFWNVVNWEKV------
SODM_STAEQ      NQDNPITEGKTPILGLDVWEHAYYLKYQNKRPDYINAFWNVVNWEKV------
SODM1_STAAW     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODM1_STAAS     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODM1_STAAR     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODM1_STAAN     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODM1_STAAM     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODM1_STAAC     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODM1_STAAB     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODM1_STAA8     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODM1_STAA3     NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKV------
SODF_NICPL      NAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYISIFMKLVSWEAVSSRL--
SODM2_PLEBO     NQDSPLIEGHTPIMGNDVWEHAYYLKYQNRRPEYLNAWWNVLNWE--------
SODM_STRP1      NQDTPISEGKKPILALDVWEHAYYLNYRNVRPNYIKAFFEIVNWKKVSE----
SODM_STAEP      NQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWEKV------
SODM_STRP3      NQDTPISEGKKPILALDVWEHAYYLNYRNVRPNYIKAFFEIINWKKVSE----
SODM_STRP8      NQDTPISEGKKPILALDVWEHAYYLNYRNVRPNYIKAFFEIINWKKVSE----
SODM_STRP6      NQDTPISEGKKPILALDVWEHAYYLNYRNVRPNYIKAFFEIINWKKVSE----
SODM_ACIAD      NQDNPLTKG-TPLLGLDVWEHAYYLKYQNRRADYIKAFWSVVNWNKV------
SODM_LACLM      NQDNPISEGLTPVLGLDVWEHAYYLKYHNVRPDYIEAFFNLVNWDKV------
SODM_LACLA      NQDNPISEGLTPVLGLDVWEHAYYLKYHNVRPDYIEAFFNLVNWDKV------
SODM_THET8      NQDNPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWD--------
SODM_THET2      NQDNPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWD--------
SODM_THEAQ      NQDNPVMGGFAPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWD--------
SODM_STRPY      NQDTPISEGKKPILALDVWEHAYYLNYRNVRPNYIKAFFEIINWKKVS-----
SODM2_BACCR     NQDTPLQEGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDQV------
SODM_BORPE      NQDSPLMEGNTPILGLDVWEHAYYLQYQNRRPEYIEAFYRVVDWAEVAR----
SODM_MACMU      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_MACFU      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_MACFA      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_CHLRE      NQDNPLVAGGIPLLGLDVWEHAYYLKYQNRRPEYIAAWWNVVNWEQVAEN---
SODM_PONPY      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_PANTR      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_HYLLA      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_HUMAN      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM3_PLEBO     NQDNPIMEGNYPIMGNDVWEHAYYLRYQNRRADYL------------------
SODM_MACNE      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_STRR6      NQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDYIKAFFSVINWNKV------
SODM_STRPN      NQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDYIKAFFSVINWNKV------
SODM2_BACAN     NQDTPLQEGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDRV------
SODM_HORSE      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSE----
SODM_HAEIN      NQDNPLMGKEVPLLGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDFVAE----
SODM_CEBAP      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_CALJA      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODF_RHOCA      NGVNPLCFGQTALLGCDVWEHSYYIDFRNKRPAYLTNFLKLVNWENVASRM--
SODM_CORDI      QQGN-ISANLTPLLMLDMWEHAFYLQYKNVKADYVKAVWNVFNWDDVA-----
SODM_SHIFL      NQDSPLMASGFPILGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
SODM_ECO57      NQDSPLMASGFPILGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
SODM_ECOLI      NQDSPLMASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
SODM_STRAG      NQDTPIMEGKKPILGLDVWEHAYYLNYRNVRPNYIKAFFEIINWNKV------
SODM_STRA5      NQDTPIMEGKKPILGLDVWEHAYYLNYRNVRPNYIKAFFEIINWNKV------
SODM_STRA3      NQDTPIMEGKKPILGLDVWEHAYYLNYRNVRPNYIKAFFEIINWNKV------
SODM_SALTY      NQDSPLMASGFPILGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
SODM_SALTI      NQDSPLMASGFPILGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
SODM_YEREN      NQDSPLVSGASPIVGLDVWEHAYYLKFQNRRPDYIKAFWNVVNWDEAAARFA-
SODM_PASHA      NQDNPLMGKEVPILVLDVWEHAYYLNYQNRRPDFIKAFWNVVNWDEAAR----
SODF_METTM      HNVNVIPHFRI-LMVLDVWEHAYYIDYRNVRPDYVEAFWNIVNWKEVEK----
SODF_RHIME      NGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEAFVNLINWDYV------
SODF_METTH      HNVNVIPHFRI-LLVLDVWEHAYYIDYRNVRPDYVEAFWNIVNWKEVEK----
SODM_STRMU      NQDTPISQGLKPILALDVWEHAYYLNYRNVRPNYIKAFFEVINWNTVAR----
SODM_SCHPO      NQ-DTIVKSK-PIIGIDAWEHAYYPQYENRKAEYFKAIWNVINWKEAESRYSN
SODM_BUCAP      NQDNPLTHG-NPIFGLDLWEHAYYLKYQNRRLDYIKSFWNVVNWDEASRRLS-
SODM1_PLEBO     NQDNPLMSNPNPILGNDVWEHAYYLKYQNRRAEYL------------------
SODM_KLEPL      NQDSPVMEGKTPVLGLDVWEHAYY-----------------------------
SODM1_CAEEL     ANQDPLTTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFA-
SODM_BOVIN      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENV------
SODM_CHLTR      ANQDPLTTGMIPLLGVDVWEHAYYLQYKNARMDYLKSFPSIINWDYI------
SODF_ARATH      NAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMNLVSW---------
SODM2_CAEEL     ANQDPL-EGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFAN
SODM_RABIT      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVITWENVTE----
SODM_BUCBP      NQNTPLM-GKXXXXXXDLWEHAYYLKYKNNRSDYVNAFWNVVNWDEVSYRFFN
SODM_BUCAI      NQDSPLM-GKLPIIGLDIWEHAYYLKYQNRRLDYIKSFWNVVNWEEASNRL--
SODM_HAEDU      NQDSPIM-GKDPIFTLDVWEHAYYLHYQNRRPDYIKAFWNVVNWD--------
SODM_DICDI      QNQDPLSSGYVPLLGIDVWEHAYYLDYKNVRADYVKNIWQIVNWKNVAE----
SODM_CHLMU      ANQDPLTTGMIPLLGVDVWEHAYYLQYKNARLDYLKNFPSIINWDYI------
SODM_HEVBR      ANQDPLTKGPTPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYASE----
SODM_GLOMM      NQ-EPLVTGLVPLFAIDVWEHAYYLQXKNXXAKYVEAXWDIANWKBISDRYA-
SODM_ORYSJ      NQDPLVTKGANPLLGIDVWEHAYYLQYKNVRPDYLSNIWKVMNWKYAGEVYEN
SODM2_HALSA     NHDEGALWGSHPILALDVWEHSYYYDYGPDRGSFVDAFFEVIDWDPIAAN---
SODM_PRUPE      ANQDPLTKGPTPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASE----
SODM_CAVPO      NQ-DPLTTGLIPLLGIDVWEHAYYLQLKNVRPDYLKAIWKV------------
SODM_PASMU      NQDSPVM-GKAPLLGLDVWEHAYYLKFQNRRPDYIKEFWHVVNWDFVAE----
SODM_MYCSM      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWDDVQNRFA-
SODM_MYCS2      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWDDVQNRFA-
SODM_GANMI      NQ-DPLL-SHVPIIGVDIWEHAFYLQYLNVKADYLAAIWIVINFKEAERRL--
SODM_CAPAN      ANQDPLVPNLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWKVINWKYAAE----
SODM_DROME      NQ-DPLSTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIANWDDIS-----
SODM_CHLPN      DPLEPLT-GKLPLLGVDVWEHAYYLQYKNVRMDYLKAFPQIINWGHI------
SODM1_MAIZE     ANQDPLTKGASPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYEN
SODM_MYCPA      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWADVQKRYA-
SODM_MYCAV      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWADVQKRYA-
SODM_NICPL      ANQDPLVSNLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKY-------
SODM_MYCLP      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWADVQK----
SODM_NEUCR      DQ-DXXXXXXXXXXXXDMWEHAYYLQYLNGKAAYVENIWKVINW---------
SODM_MYCFO      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWEDVQNRYA-
SODM_CHAFE      NQ-DPLTTGLVPLFGIDVWEHAYYLQYKNVR----------------------
SODM4_MAIZE     NQDPLVTKGASPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYEN
SODF_MYCTU      DHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYA-
SODF_MYCBO      DHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYA-
SODF_BACSU      KHQLFSQWDVIPLLPLDVWEHAYYLQYKNDRASYVDHWWNVVDW---------
SODM_PROFR      DHQNNLPAGSIPLLQLDMWEHAFYLQYKNVKGDYVKSWWNVVNWDDVA-----
SODF_TETPY      NQDMPEWSSIVPLLTIDVWEHAYYLDYQNLRPKYLTEVWKIVNWREVEK----
SODM2_MAIZE     NQDPLVTKGASPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYEN
SODM_YEAST      NQ-DTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNW---------
SODM_BORBU      NQDSPLMNSYKPILGIDVWEHAYYLKYQNRRIEYVDAFLKALNWEEVSK----
SODM3_MAIZE     ANQDPLTKGASPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYEN
SODM_NOCAS      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVTAFWNVVNW---------
SODM_MYCLE      DQQANVSLGIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNW---------
SODM_RAT        NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSQ----
SODM_CANAL      NQDTVTDPNLVPLIAIDAWEHAYYLQYQNVKADYFKNLWHVINW---------
SODM_MOUSE      NQ-DPLTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTE----
SODM_ARATH      ANQDPLTKGGSPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASE----
SODF_STRCO      DHQGNVGQGSTPILVFDAWEHAFYLQYKNQKVDFIDAMWAVVNWQDVAR----
SODM1_HALSA     NHDEGALWGSHPILALDVWEHSYYYDYGPDRGSFVDAFFEVVDWD--------
SODM_DEBHA      NQ-DTVTDPLVPLIAIDAWEHAYYLQYQNVKADYFKAIWNVINWEEASK----
SODM_STRAY      NQDNPISQGKQPIL---------------------------------------
SODB_ASPNG      DQ-DPVT-GPIPVFGVDMWEHAYYLQYLNNKASYVQNIWKVINWE--------
SODM_ONCVO      DLLEP-TTGLIPLFCIDVWEHAYYLQYKNLRPDFV------------------
SODF_AERPE      KHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRL--
SODM_MYCKA      DHQTNFPLGIIPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWD--------
SODM_MYCIT      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWD--------
SODF_SULSO      NHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKL--
SODM_PEA        Q--DPLTKGASPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINW---------
SODM_MYCSC      QANVPL--GIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNW---------
SODF_SULAC      NHFMNHIAELPVILIVDEFEHAYYLQYKNKRGDYLNAWWNVVNWDDAEKRL--
SODM_STRPA      NQDTPLSEGKTPIL---------------------------------------
SODM_ASPFU      HDQDPVT-GAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINW---------
SODF_ACIAM      NHFQNHIAELPILLILDEFEHAYYLQYKNKRADYVNNWWNLVNWDFADKKL--
SODM_ASPOR      DQ-DPVTD-KVPVFGVDMWEHAYYLQYFNNKASYVEGIWKVLNW---------
SODM_STRIN      NQDTPISEGKKPIL---------------------------------------
SODM_STRPO      NQDTPISEGKQPIL---------------------------------------
SODM_PENCH      DQ-DPVNAPDVPVFGVDMWEHAYYLQYLNNKAGYVEGIWKIIHW---------
SODM_AGABI      NQ-DPLL-NLVPIIGVDIWEHAFYLQYLNVKADYLNAIWSVINFD--------
SODM_STRCB      NQDTPISEGKKPIL---------------------------------------
SODM2_HALVO     HDQGALW-GSHPILALDVWEHSYYHDYGPARGDFVSAFFEVVDWD--------
SODM1_HALVO     HDQGALW-GSHPILALDVWEHSYYHDYGPARGDFVSAFFEVVDWD--------
SODM_STRMT      NQDTPISEGKKPIL---------------------------------------
SODM_STROR      NQDTPISEGKKPIL---------------------------------------
SODM_BRAFL      NQ-DPLTTGLKPLLGIDV-----------------------------------
SODM_PALVU      QNQDPLTHGLIPLLGLDV-----------------------------------
SODM_STRSL      NQDTPISDGKKPIL---------------------------------------
SODM_PETMA      NQ-DPLTTGLIPLLGIDV-----------------------------------
SODM_HALMA      KHDQGALWGSHPILALDVWEHSYYYDYGPARGDFIDAFFEVVDWDKAAE----
SODM_MYCMR      DHQTNFPLGIVPLLLLDMWEHA-------------------------------
SODM_MYCCE      DHQSNFPLGVVPLLLLDMWEHA-------------------------------
SODM_EPTST      ANQDPLTTGLFPLLGIDV-----------------------------------
SODF_AQUPY      DAHNVYNTGLIPLIVIDTYEHAYYVDYKNKRPPYIDAFFKNINWDVV------
SODF_AQUAE      DAHNVYNTGLIPLIVIDTYEHAYYVDYKNKRPPYIDAFFKNINWDVV------
SODM_MYCMA      QANVPL--GIIPLLQVDMWEHA-------------------------------
SODM_MYCSZ      DHQTNFPLGIVPLLLLDMWEHA-------------------------------
SODM_MYCPH      QANVPL--GIIPLLLVDMWEHA-------------------------------
SODM_PIG        NQ-DPLTTGLVPLLGIDV-----------------------------------
SODM_STRAI      NQDTPITQGLKPIL---------------------------------------
RT26A_SCHPO     QAGSPYKYAHVPILNLCLWNHAYYKDYGLLRSRYIDTWFDCIDWSVIEERLTN
SODM_MYCCH      QANVPL--GIIPLLQVDMWEHA-------------------------------
SODM_PARCL      VNQDPLTTGMVPLFGIDV-----------------------------------
SODM2_HALME     KHNDGALWSAHPILALDVWEHSYYFQYGPDRGGFVDA----------------
RT26B_SCHPO     NASNAFTNAIVPLLCVNLWQYAYLDDYLNGKKMYITKWWDMINWTVV------
SODF_PYRAE      XKHNLMXXXXXXXXXXXXWEHAYYLQYKNDRGSY-------------------
SODM1_HALME     KHDQGALWGSHPILALDVWEHSYYHDYGPARGDFISA----------------
SODM_RALME      DHAHTLAGG-TPVLALDMYEHSYHMDYGAKAAAYVDAFMQNIHWQRAATRFA-
SODM_HALHI      KHDQGALWGSHPILALDVWEHSYYYDYGPARGDFIDA----------------
RT26_YEAST      NNGTPVQDWTMPIICVNLWDHAYLHDYGGNRSKYVKNVLDNLNWSVV------
YTRE_LEPBI      -----------------------------------------------------