[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA58912.1

[Show Plain Result]


## Summary of Sequence Search
    1::124
  542::609     6e-04  34%  831 aa  DBP7_PHANO RecName: Full=ATP-dependent RNA helicase DBP7;       
    1::124

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSLESLVNQPDLHAMGKTNIRNALLRR
DBP7_PHANO      -------------------------------------------THAESPVLSPKSHAVTAYRLHGSLQQS


                         .         .         *         .         .         .         .:140
query           LDINDVAHVSKENIEIIKTRRTVTVAVDYEVRTPFLGNIDLMAHFNPxxxxxxx
DBP7_PHANO      LRTSTLAHFTKNN------DAAVLIATDVASRGLDLPNVDLVVEFDP-------