[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA59023.1

[Show Plain Result]


## Summary of Sequence Search
    1::212
    1::212     e-121 100%  212 aa  RRMJ_NITOC RecName: Full=Ribosomal RNA large subunit
    1::204     2e-66  60%  209 aa  RRMJ_VIBF1 RecName: Full=Ribosomal RNA large subunit
    1::204     2e-65  60%  209 aa  RRMJ_VIBFM RecName: Full=Ribosomal RNA large subunit
    2::200     2e-65  60%  205 aa  RRMJ_AZOSB RecName: Full=Ribosomal RNA large subunit
    5::204     4e-65  60%  209 aa  RRMJ_PHOPR RecName: Full=Ribosomal RNA large subunit
    5::204     1e-64  59%  209 aa  RRMJ_VIBCM RecName: Full=Ribosomal RNA large subunit
    5::204     1e-64  59%  209 aa  RRMJ_VIBCH RecName: Full=Ribosomal RNA large subunit
    5::204     1e-64  59%  209 aa  RRMJ_VIBC3 RecName: Full=Ribosomal RNA large subunit
    5::204     9e-64  58%  209 aa  RRMJ_VIBVY RecName: Full=Ribosomal RNA large subunit
    5::204     9e-64  58%  209 aa  RRMJ_VIBVU RecName: Full=Ribosomal RNA large subunit
    1::202     2e-63  57%  206 aa  RRMJ_LEGPC RecName: Full=Ribosomal RNA large subunit
    3::202     2e-63  57%  206 aa  RRMJ_LEGPH RecName: Full=Ribosomal RNA large subunit
    3::202     2e-63  57%  206 aa  RRMJ_LEGPA RecName: Full=Ribosomal RNA large subunit
    1::206     3e-63  57%  210 aa  RRMJ_METCA RecName: Full=Ribosomal RNA large subunit
    3::202     4e-63  56%  206 aa  RRMJ_LEGPL RecName: Full=Ribosomal RNA large subunit
    5::204     6e-63  56%  209 aa  RRMJ_VIBPA RecName: Full=Ribosomal RNA large subunit
    5::204     2e-62  60%  209 aa  RRMJ_AERS4 RecName: Full=Ribosomal RNA large subunit
    5::204     3e-62  57%  209 aa  RRMJ_PSEHT RecName: Full=Ribosomal RNA large subunit
    5::204     3e-62  58%  209 aa  RRMJ_ERWT9 RecName: Full=Ribosomal RNA large subunit
    5::204     4e-62  58%  209 aa  RRMJ_PHOLL RecName: Full=Ribosomal RNA large subunit
    5::204     4e-62  58%  209 aa  RRMJ_ERWCT RecName: Full=Ribosomal RNA large subunit
    4::203     4e-62  58%  208 aa  RRMJ_EDWI9 RecName: Full=Ribosomal RNA large subunit
    5::204     5e-62  55%  209 aa  RRMJ_VIBHB RecName: Full=Ribosomal RNA large subunit
    5::204     5e-62  58%  209 aa  RRMJ_TOLAT RecName: Full=Ribosomal RNA large subunit
    5::204     6e-62  54%  209 aa  RRMJ_VIBSL RecName: Full=Ribosomal RNA large subunit
    5::204     8e-62  56%  209 aa  RRMJ_PROMH RecName: Full=Ribosomal RNA large subunit
    5::204     8e-62  58%  209 aa  RRMJ_AERHH RecName: Full=Ribosomal RNA large subunit
    1::202     1e-61  56%  206 aa  RRMJ_THICR RecName: Full=Ribosomal RNA large subunit
    4::203     2e-61  58%  208 aa  RRMJ_ACTSZ RecName: Full=Ribosomal RNA large subunit
    5::204     2e-61  57%  209 aa  RRMJ_SHEAM RecName: Full=Ribosomal RNA large subunit
    5::204     2e-61  58%  209 aa  RRMJ_PECCP RecName: Full=Ribosomal RNA large subunit
    5::204     3e-61  56%  208 aa  RRMJ_SALAR RecName: Full=Ribosomal RNA large subunit
    5::204     4e-61  58%  209 aa  RRMJ_SERP5 RecName: Full=Ribosomal RNA large subunit
    1::205     4e-61  58%  207 aa  RRMJ_AZOVD RecName: Full=Ribosomal RNA large subunit
    5::204     5e-61  56%  208 aa  RRMJ_SALPK RecName: Full=Ribosomal RNA large subunit
    5::204     5e-61  56%  208 aa  RRMJ_SALPA RecName: Full=Ribosomal RNA large subunit
    4::203     5e-61  57%  208 aa  RRMJ_MANSM RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  57%  209 aa  RRMJ_YERE8 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_SHISS RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_SHIFL RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_SHIF8 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_SHIBS RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_SHIB3 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_SHELP RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALTY RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALSV RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALPB RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALNS RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALHS RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALG2 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALEP RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALDC RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  208 aa  RRMJ_SALA4 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ESCF3 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOUT RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOSM RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOSE RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOLU RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOLI RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOLC RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOL6 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOL5 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOK1 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOHS RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECODH RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECOBW RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO8A RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO81 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO7I RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO5E RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO57 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO55 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO45 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO27 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_ECO24 RecName: Full=Ribosomal RNA large subunit
    5::204     7e-61  56%  209 aa  RRMJ_CITK8 RecName: Full=Ribosomal RNA large subunit
    5::204     9e-61  54%  209 aa  RRMJ_SHEPW RecName: Full=Ribosomal RNA large subunit
    5::204     9e-61  56%  208 aa  RRMJ_SALTI RecName: Full=Ribosomal RNA large subunit
    5::204     9e-61  56%  208 aa  RRMJ_SALPC RecName: Full=Ribosomal RNA large subunit
    5::204     9e-61  56%  208 aa  RRMJ_SALCH RecName: Full=Ribosomal RNA large subunit
    5::204     9e-61  56%  209 aa  RRMJ_KLEP7 RecName: Full=Ribosomal RNA large subunit
    5::204     9e-61  55%  208 aa  RRMJ_ENT38 RecName: Full=Ribosomal RNA large subunit
    5::204     9e-61  56%  209 aa  RRMJ_ALISL RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  57%  209 aa  RRMJ_YERPY RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  57%  209 aa  RRMJ_YERPS RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  57%  209 aa  RRMJ_YERPP RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  57%  209 aa  RRMJ_YERPN RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  57%  209 aa  RRMJ_YERPE RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  57%  209 aa  RRMJ_YERPB RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  57%  209 aa  RRMJ_YERPA RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  57%  209 aa  RRMJ_YERP3 RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  58%  209 aa  RRMJ_SODGM RecName: Full=Ribosomal RNA large subunit
    5::204     1e-60  56%  209 aa  RRMJ_KLEP3 RecName: Full=Ribosomal RNA large subunit
    5::204     2e-60  56%  209 aa  RRMJ_SHESW RecName: Full=Ribosomal RNA large subunit
    5::204     2e-60  56%  209 aa  RRMJ_SHEPC RecName: Full=Ribosomal RNA large subunit
    5::204     2e-60  54%  209 aa  RRMJ_SHEPA RecName: Full=Ribosomal RNA large subunit
    1::205     2e-60  57%  207 aa  RRMJ_PSEAE RecName: Full=Ribosomal RNA large subunit
    1::205     2e-60  57%  207 aa  RRMJ_PSEAB RecName: Full=Ribosomal RNA large subunit
    1::205     2e-60  57%  207 aa  RRMJ_PSEA8 RecName: Full=Ribosomal RNA large subunit
    4::203     2e-60  58%  208 aa  RRMJ_HAEDU RecName: Full=Ribosomal RNA large subunit
    5::204     2e-60  54%  209 aa  RRMJ_SHESH RecName: Full=Ribosomal RNA large subunit
    1::205     2e-60  57%  207 aa  RRMJ_PSEA7 RecName: Full=Ribosomal RNA large subunit
    1::202     2e-60  55%  211 aa  RRMJ_CELJU RecName: Full=Ribosomal RNA large subunit
    5::204     3e-60  54%  209 aa  RRMJ_SHEHH RecName: Full=Ribosomal RNA large subunit
    5::204     3e-60  56%  209 aa  RRMJ_SHEFN RecName: Full=Ribosomal RNA large subunit
    1::205     3e-60  56%  207 aa  RRMJ_PSEMY RecName: Full=Ribosomal RNA large subunit
    1::205     3e-60  57%  209 aa  RRMJ_PSEF5 RecName: Full=Ribosomal RNA large subunit
    5::204     3e-60  56%  209 aa  RRMJ_ENTS8 RecName: Full=Ribosomal RNA large subunit
    5::204     3e-60  54%  209 aa  RRMJ_SHEWM RecName: Full=Ribosomal RNA large subunit
    5::204     3e-60  56%  209 aa  RRMJ_SHEON RecName: Full=Ribosomal RNA large subunit
    5::204     3e-60  58%  209 aa  RRMJ_PASMU RecName: Full=Ribosomal RNA large subunit
    5::204     5e-60  55%  209 aa  RRMJ_SHESM RecName: Full=Ribosomal RNA large subunit
    5::204     5e-60  55%  209 aa  RRMJ_SHESA RecName: Full=Ribosomal RNA large subunit
    5::204     5e-60  56%  209 aa  RRMJ_SHEDO RecName: Full=Ribosomal RNA large subunit
    1::209     5e-60  55%  216 aa  RRMJ_PSE14 RecName: Full=Ribosomal RNA large subunit
    1::209     8e-60  55%  216 aa  RRMJ_PSEU2 RecName: Full=Ribosomal RNA large subunit
    5::204     8e-60  58%  209 aa  RRMJ_HAES1 RecName: Full=Ribosomal RNA large subunit
    5::204     1e-59  56%  209 aa  RRMJ_SHIDS RecName: Full=Ribosomal RNA large subunit
    5::204     1e-59  55%  209 aa  RRMJ_SHESR RecName: Full=Ribosomal RNA large subunit
    5::204     1e-59  54%  209 aa  RRMJ_PSEA6 RecName: Full=Ribosomal RNA large subunit
    1::203     1e-59  55%  208 aa  RRMJ_PSEE4 RecName: Full=Ribosomal RNA large subunit
    1::206     2e-59  54%  210 aa  RRMJ_XANOR RecName: Full=Ribosomal RNA large subunit
    1::206     2e-59  54%  210 aa  RRMJ_XANOP RecName: Full=Ribosomal RNA large subunit
    1::206     2e-59  54%  210 aa  RRMJ_XANOM RecName: Full=Ribosomal RNA large subunit
    1::209     2e-59  55%  216 aa  RRMJ_PSESM RecName: Full=Ribosomal RNA large subunit
    1::206     2e-59  54%  210 aa  RRMJ_XANC5 RecName: Full=Ribosomal RNA large subunit
    1::206     2e-59  54%  210 aa  RRMJ_XANAC RecName: Full=Ribosomal RNA large subunit
    5::204     4e-59  56%  209 aa  RRMJ_HAEI8 RecName: Full=Ribosomal RNA large subunit
    1::203     5e-59  55%  208 aa  RRMJ_PSEPW RecName: Full=Ribosomal RNA large subunit
    4::203     5e-59  56%  208 aa  RRMJ_HAEPS RecName: Full=Ribosomal RNA large subunit
    1::209     1e-58  54%  216 aa  RRMJ_PSEFS RecName: Full=Ribosomal RNA large subunit
    2::205     1e-58  52%  207 aa  RRMJ_METFK RecName: Full=Ribosomal RNA large subunit
    5::204     2e-58  56%  209 aa  RRMJ_HAEIN RecName: Full=Ribosomal RNA large subunit
    1::203     2e-58  55%  207 aa  RRMJ_PSEPK RecName: Full=Ribosomal RNA large subunit
    1::203     2e-58  55%  208 aa  RRMJ_PSEPG RecName: Full=Ribosomal RNA large subunit
    1::203     2e-58  55%  207 aa  RRMJ_PSEP1 RecName: Full=Ribosomal RNA large subunit
    1::206     3e-58  53%  210 aa  RRMJ_XANCP RecName: Full=Ribosomal RNA large subunit
    1::206     3e-58  53%  210 aa  RRMJ_XANCB RecName: Full=Ribosomal RNA large subunit
    1::206     3e-58  53%  210 aa  RRMJ_XANC8 RecName: Full=Ribosomal RNA large subunit
    2::205     3e-58  53%  206 aa  RRMJ_NITMU RecName: Full=Ribosomal RNA large subunit
    1::205     4e-58  54%  207 aa  RRMJ_MARAV RecName: Full=Ribosomal RNA large subunit
    1::203     4e-58  55%  210 aa  RRMJ_DICNV RecName: Full=Ribosomal RNA large subunit
    3::205     6e-58  55%  206 aa  RRMJ_HAHCH RecName: Full=Ribosomal RNA large subunit
    1::200     7e-58  56%  213 aa  RRMJ_XYLFM RecName: Full=Ribosomal RNA large subunit
    1::200     7e-58  56%  213 aa  RRMJ_XYLFA RecName: Full=Ribosomal RNA large subunit
    4::201     7e-58  56%  208 aa  RRMJ_ALCBS RecName: Full=Ribosomal RNA large subunit
    9::213     9e-58  53%  216 aa  RRMJ_ACIBY RecName: Full=Ribosomal RNA large subunit
    9::213     9e-58  53%  216 aa  RRMJ_ACIBT RecName: Full=Ribosomal RNA large subunit
    9::213     9e-58  53%  216 aa  RRMJ_ACIBS RecName: Full=Ribosomal RNA large subunit
    9::213     9e-58  53%  216 aa  RRMJ_ACIBC RecName: Full=Ribosomal RNA large subunit
    9::213     9e-58  53%  216 aa  RRMJ_ACIB5 RecName: Full=Ribosomal RNA large subunit
    9::213     9e-58  53%  216 aa  RRMJ_ACIB3 RecName: Full=Ribosomal RNA large subunit
    9::213     9e-58  53%  216 aa  RRMJ_ACIAD RecName: Full=Ribosomal RNA large subunit
    5::204     2e-57  55%  209 aa  RRMJ_SHEB9 RecName: Full=Ribosomal RNA large subunit
    5::204     2e-57  55%  209 aa  RRMJ_SHEB8 RecName: Full=Ribosomal RNA large subunit
    5::204     2e-57  55%  209 aa  RRMJ_SHEB5 RecName: Full=Ribosomal RNA large subunit
    5::204     2e-57  55%  209 aa  RRMJ_SHEB2 RecName: Full=Ribosomal RNA large subunit
    4::203     3e-57  54%  208 aa  RRMJ_IDILO RecName: Full=Ribosomal RNA large subunit
   13::204     4e-57  54%  208 aa  RRMJ_HAMD5 RecName: Full=Ribosomal RNA large subunit
    1::205     6e-57  53%  205 aa  RRMJ_CHRVO RecName: Full=Ribosomal RNA large subunit
    3::202     1e-56  54%  206 aa  RRMJ_SACD2 RecName: Full=Ribosomal RNA large subunit
    5::204     1e-56  52%  209 aa  RRMJ_COLP3 RecName: Full=Ribosomal RNA large subunit
    1::200     2e-56  54%  213 aa  RRMJ_XYLFT RecName: Full=Ribosomal RNA large subunit
    1::200     2e-56  54%  213 aa  RRMJ_XYLF2 RecName: Full=Ribosomal RNA large subunit
    3::202     2e-56  54%  207 aa  RRMJ_THISH RecName: Full=Ribosomal RNA large subunit
   14::205     2e-56  57%  210 aa  RRMJ_CHRSD RecName: Full=Ribosomal RNA large subunit
    4::203     4e-56  54%  208 aa  RRMJ_ACTPJ RecName: Full=Ribosomal RNA large subunit
    4::203     4e-56  54%  208 aa  RRMJ_ACTP7 RecName: Full=Ribosomal RNA large subunit
    4::203     4e-56  54%  208 aa  RRMJ_ACTP2 RecName: Full=Ribosomal RNA large subunit
    6::210     5e-56  52%  220 aa  RRMJ_THIDA RecName: Full=Ribosomal RNA large subunit
   13::205     5e-56  56%  209 aa  RRMJ_ALHEH RecName: Full=Ribosomal RNA large subunit
    1::201     2e-55  53%  209 aa  RRMJ_PSEPF RecName: Full=Ribosomal RNA large subunit
    3::203     3e-55  52%  210 aa  RRMJ_VESOH RecName: Full=Ribosomal RNA large subunit
    7::200     3e-55  52%  206 aa  RRMJ_NITEC RecName: Full=Ribosomal RNA large subunit
    1::206     4e-55  51%  206 aa  RRMJ_NEIMF RecName: Full=Ribosomal RNA large subunit
    1::206     4e-55  51%  206 aa  RRMJ_NEIMB RecName: Full=Ribosomal RNA large subunit
    1::206     4e-55  51%  206 aa  RRMJ_NEIMA RecName: Full=Ribosomal RNA large subunit
    1::206     4e-55  51%  206 aa  RRMJ_NEIM0 RecName: Full=Ribosomal RNA large subunit
    1::206     4e-55  50%  206 aa  RRMJ_NEIG1 RecName: Full=Ribosomal RNA large subunit
    1::206     6e-55  50%  206 aa  RRMJ_NEIG2 RecName: Full=Ribosomal RNA large subunit
    5::206     2e-54  50%  206 aa  RRMJ_BUCAI RecName: Full=Ribosomal RNA large subunit
    2::202     5e-54  50%  206 aa  RRMJ_PSEU5 RecName: Full=Ribosomal RNA large subunit
   18::212     8e-54  52%  217 aa  RRMJ_PSYIN RecName: Full=Ribosomal RNA large subunit
    7::200     1e-53  51%  206 aa  RRMJ_NITEU RecName: Full=Ribosomal RNA large subunit
    1::206     2e-52  50%  210 aa  RRMJ_STRM5 RecName: Full=Ribosomal RNA large subunit
    1::218     2e-52  49%  220 aa  RRMJ_BURCM RecName: Full=Ribosomal RNA large subunit
    1::218     2e-52  49%  220 aa  RRMJ_BURA4 RecName: Full=Ribosomal RNA large subunit
    1::206     3e-52  50%  210 aa  RRMJ_STRMK RecName: Full=Ribosomal RNA large subunit
    1::215     3e-52  49%  220 aa  RRMJ_BURVG RecName: Full=Ribosomal RNA large subunit
    1::218     3e-52  48%  220 aa  RRMJ_BURP8 RecName: Full=Ribosomal RNA large subunit
    1::215     5e-52  49%  220 aa  RRMJ_BURCJ RecName: Full=Ribosomal RNA large subunit
    1::215     5e-52  49%  220 aa  RRMJ_BURCH RecName: Full=Ribosomal RNA large subunit
    1::215     5e-52  49%  220 aa  RRMJ_BURCC RecName: Full=Ribosomal RNA large subunit
    1::215     5e-52  49%  220 aa  RRMJ_BURCA RecName: Full=Ribosomal RNA large subunit
    2::205     6e-52  49%  205 aa  RRMJ_DECAR RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURS3 RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURPS RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURP6 RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURP1 RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURP0 RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURMS RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURMA RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURM9 RecName: Full=Ribosomal RNA large subunit
    1::218     6e-52  48%  220 aa  RRMJ_BURM7 RecName: Full=Ribosomal RNA large subunit
    8::208     1e-51  51%  212 aa  RRMJ_HALHL RecName: Full=Ribosomal RNA large subunit
    1::214     1e-51  49%  220 aa  RRMJ_BURM1 RecName: Full=Ribosomal RNA large subunit
    1::214     2e-51  49%  220 aa  RRMJ_BURTA RecName: Full=Ribosomal RNA large subunit
    1::215     4e-51  51%  219 aa  RRMJ_ACIF5 RecName: Full=Ribosomal RNA large subunit
    1::215     4e-51  51%  219 aa  RRMJ_ACIF2 RecName: Full=Ribosomal RNA large subunit
    9::208     5e-51  48%  210 aa  RRMJ_PSYCK RecName: Full=Ribosomal RNA large subunit
    9::208     5e-51  48%  210 aa  RRMJ_PSYA2 RecName: Full=Ribosomal RNA large subunit
    5::201     7e-51  48%  206 aa  RRMJ_FRATN RecName: Full=Ribosomal RNA large subunit
    1::215     7e-51  50%  221 aa  RRMJ_CUPTR RecName: Full=Ribosomal RNA large subunit
    5::201     9e-51  48%  206 aa  RRMJ_FRATW RecName: Full=Ribosomal RNA large subunit
    5::201     9e-51  48%  206 aa  RRMJ_FRATT RecName: Full=Ribosomal RNA large subunit
    5::201     9e-51  48%  206 aa  RRMJ_FRATM RecName: Full=Ribosomal RNA large subunit
    5::201     9e-51  48%  206 aa  RRMJ_FRAT1 RecName: Full=Ribosomal RNA large subunit
    1::215     1e-50  50%  221 aa  RRMJ_RALME RecName: Full=Ribosomal RNA large subunit
    1::215     2e-50  50%  221 aa  RRMJ_RALEH RecName: Full=Ribosomal RNA large subunit
    5::201     2e-50  47%  206 aa  RRMJ_FRATO RecName: Full=Ribosomal RNA large subunit
    5::201     2e-50  47%  206 aa  RRMJ_FRATH RecName: Full=Ribosomal RNA large subunit
    5::201     2e-50  47%  206 aa  RRMJ_FRATF RecName: Full=Ribosomal RNA large subunit
    2::202     2e-50  54%  212 aa  RRMJ_COXBR RecName: Full=Ribosomal RNA large subunit
    2::202     2e-50  54%  212 aa  RRMJ_COXBU RecName: Full=Ribosomal RNA large subunit
    2::202     2e-50  54%  212 aa  RRMJ_COXBN RecName: Full=Ribosomal RNA large subunit
    2::202     2e-50  54%  212 aa  RRMJ_COXB2 RecName: Full=Ribosomal RNA large subunit
    1::218     2e-50  49%  220 aa  RRMJ_BURPP RecName: Full=Ribosomal RNA large subunit
    1::218     3e-50  48%  220 aa  RRMJ_BURXL RecName: Full=Ribosomal RNA large subunit
    3::203     4e-50  47%  207 aa  RRMJ_RUTMC RecName: Full=Ribosomal RNA large subunit
    1::219     4e-50  49%  225 aa  RRMJ_RALEJ RecName: Full=Ribosomal RNA large subunit
    2::202     7e-50  54%  212 aa  RRMJ_COXB1 RecName: Full=Ribosomal RNA large subunit
    1::207     9e-50  50%  211 aa  RRMJ_BORPD RecName: Full=Ribosomal RNA large subunit
    6::218     9e-50  47%  218 aa  RRMJ_ACIAC RecName: Full=Ribosomal RNA large subunit
    1::207     2e-49  50%  210 aa  RRMJ_BORPE RecName: Full=Ribosomal RNA large subunit
    1::216     3e-49  47%  221 aa  RRMJ_RALPJ RecName: Full=Ribosomal RNA large subunit
    1::207     3e-49  50%  210 aa  RRMJ_BORPA RecName: Full=Ribosomal RNA large subunit
    1::207     3e-49  50%  210 aa  RRMJ_BORBR RecName: Full=Ribosomal RNA large subunit
    2::200     3e-49  50%  207 aa  RRMJ_AZOSE RecName: Full=Ribosomal RNA large subunit
    1::216     4e-49  47%  221 aa  RRMJ_RALSO RecName: Full=Ribosomal RNA large subunit
    6::215     8e-49  45%  242 aa  RRMJ_VEREI RecName: Full=Ribosomal RNA large subunit
    5::212     2e-48  48%  222 aa  RRMJ_VARPS RecName: Full=Ribosomal RNA large subunit
    2::206     2e-48  45%  206 aa  RRMJ_BUCAP RecName: Full=Ribosomal RNA large subunit
    1::208     4e-48  46%  214 aa  RRMJ_HERAR RecName: Full=Ribosomal RNA large subunit
    6::212     5e-48  48%  220 aa  RRMJ_ACISJ RecName: Full=Ribosomal RNA large subunit
    5::201     1e-47  46%  206 aa  RRMJ_FRAP2 RecName: Full=Ribosomal RNA large subunit
   21::238     2e-47  48%  247 aa  RRMJ_POLSJ RecName: Full=Ribosomal RNA large subunit
    6::217     3e-47  48%  232 aa  RRMJ_LEPCP RecName: Full=Ribosomal RNA large subunit
    5::205     4e-47  46%  209 aa  RRMJ_BAUCH RecName: Full=Ribosomal RNA large subunit
   33::237     1e-46  49%  245 aa  RRMJ_POLNA RecName: Full=Ribosomal RNA large subunit
    1::208     5e-46  45%  214 aa  RRMJ_JANMA RecName: Full=Ribosomal RNA large subunit
   14::217     8e-46  47%  224 aa  RRMJ_RHOFD RecName: Full=Ribosomal RNA large subunit
    1::208     8e-46  48%  214 aa  RRMJ_MAGSM RecName: Full=Ribosomal RNA large subunit
    6::212     8e-46  46%  217 aa  RRMJ_DELAS RecName: Full=Ribosomal RNA large subunit
   18::219     1e-45  52%  231 aa  RRMJ_BRASB RecName: Full=Ribosomal RNA large subunit
   14::217     2e-45  48%  224 aa  RRMJ_METPP RecName: Full=Ribosomal RNA large subunit
   18::219     2e-45  51%  231 aa  RRMJ_BRASO RecName: Full=Ribosomal RNA large subunit
   18::219     4e-45  51%  228 aa  RRMJ_BRAJA RecName: Full=Ribosomal RNA large subunit
   10::208     9e-45  44%  208 aa  RRMJ_BLOPB RecName: Full=Ribosomal RNA large subunit
    1::207     2e-44  46%  219 aa  RRMJ_BORA1 RecName: Full=Ribosomal RNA large subunit
   14::210     5e-44  47%  210 aa  RRMJ_PSYWF RecName: Full=Ribosomal RNA large subunit
   18::219     5e-43  48%  237 aa  RRMJ_RHOPT RecName: Full=Ribosomal RNA large subunit
   18::219     5e-43  48%  237 aa  RRMJ_RHOPA RecName: Full=Ribosomal RNA large subunit
    4::205     5e-43  45%  210 aa  RRMJ_BUCBP RecName: Full=Ribosomal RNA large subunit
   26::219     7e-43  50%  225 aa  RRMJ_OLICO RecName: Full=Ribosomal RNA large subunit
   18::228     1e-42  48%  230 aa  RRMJ_NITWN RecName: Full=Ribosomal RNA large subunit
   18::220     2e-42  47%  236 aa  RRMJ_RHOP2 RecName: Full=Ribosomal RNA large subunit
   33::236     3e-42  47%  244 aa  RRMJ_MAGSA RecName: Full=Ribosomal RNA large subunit
   18::219     6e-42  49%  235 aa  RRMJ_RHOPS RecName: Full=Ribosomal RNA large subunit
   26::223     7e-42  46%  225 aa  RRMJ_ACICJ RecName: Full=Ribosomal RNA large subunit
   23::223     1e-41  46%  254 aa  RRMJ_XANP2 RecName: Full=Ribosomal RNA large subunit
   23::223     4e-41  45%  240 aa  RRMJ_AZOC5 RecName: Full=Ribosomal RNA large subunit
   45::255     5e-41  46%  263 aa  RRMJ_RHORT RecName: Full=Ribosomal RNA large subunit
   24::224     5e-41  47%  230 aa  RRMJ_GRABC RecName: Full=Ribosomal RNA large subunit
   18::219     1e-40  47%  235 aa  RRMJ_RHOP5 RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUSU RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUSI RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUO2 RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUME RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUMB RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUC2 RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUAB RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUA2 RecName: Full=Ribosomal RNA large subunit
   36::236     2e-40  46%  240 aa  RRMJ_BRUA1 RecName: Full=Ribosomal RNA large subunit
   31::240     3e-40  46%  254 aa  RRMJ_PARL1 RecName: Full=Ribosomal RNA large subunit
   36::236     3e-40  46%  240 aa  RRMJ_OCHA4 RecName: Full=Ribosomal RNA large subunit
   27::227     4e-40  45%  265 aa  RRMJ_RHILO RecName: Full=Ribosomal RNA large subunit
   32::231     7e-40  46%  239 aa  RRMJ_BARBK RecName: Full=Ribosomal RNA large subunit
   20::219     9e-40  47%  238 aa  RRMJ_RHOPB RecName: Full=Ribosomal RNA large subunit
    1::218     3e-39  42%  224 aa  RRMJ_POLSQ RecName: Full=Ribosomal RNA large subunit
   23::234     6e-39  44%  239 aa  RRMJ_RHILW RecName: Full=Ribosomal RNA large subunit
    4::199     6e-39  44%  263 aa  RRMJ_HALMA RecName: Full=Ribosomal RNA large subunit
   23::234     8e-39  44%  239 aa  RRMJ_RHIE6 RecName: Full=Ribosomal RNA large subunit
   32::231     8e-39  46%  242 aa  RRMJ_BART1 RecName: Full=Ribosomal RNA large subunit
    3::209     2e-38  37%  209 aa  RRMJ_BUCCC RecName: Full=Ribosomal RNA large subunit
   32::231     2e-38  44%  241 aa  RRMJ_BARQU RecName: Full=Ribosomal RNA large subunit
   23::234     3e-38  44%  239 aa  RRMJ_RHIEC RecName: Full=Ribosomal RNA large subunit
   28::225     4e-38  45%  261 aa  RRMJ_AGRVS RecName: Full=Ribosomal RNA large subunit
   28::225     6e-38  44%  245 aa  RRMJ_RHISN RecName: Full=Ribosomal RNA large subunit
   23::223     8e-38  44%  239 aa  RRMJ_RHIL3 RecName: Full=Ribosomal RNA large subunit
   65::259     8e-38  44%  268 aa  RRMJ_GLUOX RecName: Full=Ribosomal RNA large subunit
   35::231     8e-38  45%  247 aa  RRMJ_BARHE RecName: Full=Ribosomal RNA large subunit
   28::225     1e-37  43%  245 aa  RRMJ_SINMW RecName: Full=Ribosomal RNA large subunit
   20::223     1e-37  41%  227 aa  RRMJ_RICAH RecName: Full=Ribosomal RNA large subunit
   79::274     2e-37  41%  279 aa  RRMJ_MARMM RecName: Full=Ribosomal RNA large subunit
    6::196     2e-37  43%  197 aa  RRMJ_SYNFM RecName: Full=Ribosomal RNA large subunit
   14::205     3e-37  42%  216 aa  RRMJ_WOLTR RecName: Full=Ribosomal RNA large subunit
   34::234     3e-37  40%  234 aa  RRMJ_HYPNA RecName: Full=Ribosomal RNA large subunit
   28::225     4e-37  43%  245 aa  RRMJ_RHIME RecName: Full=Ribosomal RNA large subunit
    6::191     4e-37  40%  272 aa  RRMJ_METAC RecName: Full=Ribosomal RNA large subunit
    5::193     4e-37  42%  259 aa  RRMJ_HALSA RecName: Full=Ribosomal RNA large subunit
    5::193     4e-37  42%  259 aa  RRMJ_HALS3 RecName: Full=Ribosomal RNA large subunit
   12::191     7e-37  41%  263 aa  RRMJ_METBF RecName: Full=Ribosomal RNA large subunit
   20::223     9e-37  41%  227 aa  RRMJ_RICCK RecName: Full=Ribosomal RNA large subunit
   28::225     9e-37  45%  239 aa  RRMJ_AGRRK RecName: Full=Ribosomal RNA large subunit
   20::223     1e-36  41%  227 aa  RRMJ_RICPR RecName: Full=Ribosomal RNA large subunit
    8::164     1e-36  45%  206 aa  RRMJ_BLOFL RecName: Full=Ribosomal RNA large subunit
   20::223     2e-36  42%  227 aa  RRMJ_RICTY RecName: Full=Ribosomal RNA large subunit
   23::225     3e-36  42%  246 aa  RRMJ_AGRT5 RecName: Full=Ribosomal RNA large subunit
    7::205     3e-36  41%  245 aa  RRMJ_METJA RecName: Full=Ribosomal RNA large subunit
   22::215     6e-36  42%  221 aa  RRMJ_ZYMMO RecName: Full=Ribosomal RNA large subunit
   28::223     6e-36  41%  227 aa  RRMJ_RICBR RecName: Full=Ribosomal RNA large subunit
   28::223     6e-36  41%  227 aa  RRMJ_RICB8 RecName: Full=Ribosomal RNA large subunit
    4::188     6e-36  42%  252 aa  RRMJ_NATPD RecName: Full=Ribosomal RNA large subunit
   23::228     1e-35  43%  233 aa  RRMJ_SILPO RecName: Full=Ribosomal RNA large subunit
   28::223     1e-35  41%  227 aa  RRMJ_RICRS RecName: Full=Ribosomal RNA large subunit
   28::223     1e-35  41%  227 aa  RRMJ_RICRO RecName: Full=Ribosomal RNA large subunit
    6::191     1e-35  40%  268 aa  RRMJ_METMA RecName: Full=Ribosomal RNA large subunit
   28::223     1e-35  41%  227 aa  RRMJ_RICFE RecName: Full=Ribosomal RNA large subunit
   28::223     1e-35  41%  227 aa  RRMJ_RICCN RecName: Full=Ribosomal RNA large subunit
   31::225     1e-35  44%  235 aa  RRMJ_MESSB RecName: Full=Ribosomal RNA large subunit
   11::195     2e-35  44%  207 aa  RRMJ_DESAA RecName: Full=Ribosomal RNA large subunit
    6::191     2e-35  39%  196 aa  RRMJ_BDEBA RecName: Full=Ribosomal RNA large subunit
   28::223     2e-35  41%  227 aa  RRMJ_RICPU RecName: Full=Ribosomal RNA large subunit
   28::223     2e-35  41%  227 aa  RRMJ_RICAE RecName: Full=Ribosomal RNA large subunit
   28::233     4e-35  43%  240 aa  RRMJ_ROSDO RecName: Full=Ribosomal RNA large subunit
   17::215     4e-35  43%  220 aa  RRMJ_ERYLH RecName: Full=Ribosomal RNA large subunit
   18::219     5e-35  44%  228 aa  RRMJ_NITHX RecName: Full=Ribosomal RNA large subunit
   15::207     7e-35  40%  213 aa  RRMJ_NEOSM RecName: Full=Ribosomal RNA large subunit
   28::233     9e-35  41%  238 aa  RRMJ_SILST RecName: Full=Ribosomal RNA large subunit
    3::204     1e-34  42%  212 aa  RRMJ_EHRCR RecName: Full=Ribosomal RNA large subunit
   18::215     2e-34  39%  229 aa  RRMJ_SPHWW RecName: Full=Ribosomal RNA large subunit
   42::242     3e-34  42%  247 aa  RRMJ_ANAPZ RecName: Full=Ribosomal RNA large subunit
   31::240     7e-34  40%  256 aa  RRMJ_PARDP RecName: Full=Ribosomal RNA large subunit
    6::190     9e-34  39%  255 aa  RRMJ_METTP RecName: Full=Ribosomal RNA large subunit
   20::206     1e-33  43%  212 aa  RRMJ_SORC5 RecName: Full=Ribosomal RNA large subunit
    4::192     1e-33  40%  269 aa  RRMJ_HALLT RecName: Full=Ribosomal RNA large subunit
    7::189     2e-33  39%  207 aa  RRMJ_METHJ RecName: Full=Ribosomal RNA large subunit
    4::198     3e-33  40%  211 aa  RRMJ_METTH RecName: Full=Ribosomal RNA large subunit
    6::191     3e-33  36%  267 aa  RRMJ_METBU RecName: Full=Ribosomal RNA large subunit
   34::234     5e-33  40%  246 aa  RRMJ2_HUMAN RecName: Full=Putative ribosomal RNA methyltransferase
    3::183     6e-33  44%  201 aa  RRMJ_ANAMM RecName: Full=Ribosomal RNA large subunit
    3::183     6e-33  44%  201 aa  RRMJ_ANAMF RecName: Full=Ribosomal RNA large subunit
    2::202     8e-33  38%  206 aa  RRMJ_METST RecName: Full=Ribosomal RNA large subunit
    4::190     1e-32  42%  204 aa  RRMJ_DESVV RecName: Full=Ribosomal RNA large subunit
    4::190     1e-32  42%  204 aa  RRMJ_DESVH RecName: Full=Ribosomal RNA large subunit
   32::220     1e-32  41%  226 aa  RRMJ_CAUSK RecName: Full=Ribosomal RNA large subunit
    4::192     2e-32  39%  256 aa  RRMJ_HALWD RecName: Full=Ribosomal RNA large subunit
    3::182     2e-32  41%  192 aa  RRMJ_WOLPM RecName: Full=Ribosomal RNA large subunit
   17::215     2e-32  39%  222 aa  RRMJ_NOVAD RecName: Full=Ribosomal RNA large subunit
    8::191     1e-31  35%  197 aa  RRMJ_NITMS RecName: Full=Ribosomal RNA large subunit
    5::190     3e-31  39%  191 aa  RRMJ_ARCFU RecName: Full=Ribosomal RNA large subunit
    4::197     3e-31  41%  201 aa  RRMJ_DESVM RecName: Full=Ribosomal RNA large subunit
    6::189     4e-31  40%  256 aa  RRMJ_UNCMA RecName: Full=Ribosomal RNA large subunit
    4::190     4e-31  42%  207 aa  RRMJ_DESDG RecName: Full=Ribosomal RNA large subunit
    7::189     6e-31  40%  193 aa  RRMJ_METB6 RecName: Full=Ribosomal RNA large subunit
    2::190     1e-30  39%  199 aa  RRMJ_DESAD RecName: Full=Ribosomal RNA large subunit
   15::205     1e-30  41%  213 aa  RRMJ_MYXXD RecName: Full=Ribosomal RNA large subunit
   32::220     1e-30  40%  226 aa  RRMJ_CAUCR RecName: Full=Ribosomal RNA large subunit
    8::199     1e-30  38%  276 aa  RRMJ_ANADF RecName: Full=Ribosomal RNA large subunit
    7::190     3e-30  42%  203 aa  RRMJ_METMJ RecName: Full=Ribosomal RNA large subunit
    7::202     3e-30  36%  269 aa  RRMJ_META3 RecName: Full=Ribosomal RNA large subunit
    4::190     1e-29  44%  200 aa  RRMJ_LAWIP RecName: Full=Ribosomal RNA large subunit
   21::221     2e-29  38%  230 aa  RRMJ_SPHAL RecName: Full=Ribosomal RNA large subunit
    7::202     2e-29  34%  258 aa  RRMJ_METM7 RecName: Full=Ribosomal RNA large subunit
   23::228     4e-29  39%  237 aa  RRMJ_JANSC RecName: Full=Ribosomal RNA large subunit
    7::202     5e-29  33%  258 aa  RRMJ_METM5 RecName: Full=Ribosomal RNA large subunit
  390::635     5e-29  41%  640 aa  RRMJL_DICDI RecName: Full=Probable ribosomal RNA methyltransferase
    7::202     7e-29  33%  258 aa  RRMJ_METM6 RecName: Full=Ribosomal RNA large subunit
    7::201     9e-29  33%  259 aa  RRMJ_METVS RecName: Full=Ribosomal RNA large subunit
    7::202     1e-28  33%  258 aa  RRMJ_METMP RecName: Full=Ribosomal RNA large subunit
    8::190     2e-28  39%  196 aa  RRMJ_CENSY RecName: Full=Ribosomal RNA large subunit
    7::189     3e-28  38%  203 aa  RRMJ_METPE RecName: Full=Ribosomal RNA large subunit
   34::242     5e-28  36%  250 aa  RRMJ1_DROME RecName: Full=Putative ribosomal RNA methyltransferase
    3::196     6e-28  33%  210 aa  RRMJ_METS3 RecName: Full=Ribosomal RNA large subunit
   12::198     1e-27  35%  841 aa  RRMJ3_PONAB RecName: Full=Putative rRNA methyltransferase 3;       
   12::198     1e-27  35%  847 aa  RRMJ3_HUMAN RecName: Full=Putative rRNA methyltransferase 3;       
   10::212     2e-27  38%  218 aa  YBOF_SCHPO RecName: Full=Putative ribosomal RNA methyltransferase
    2::182     3e-27  39%  203 aa  RRMJ_PELUB RecName: Full=Ribosomal RNA large subunit
    7::189     3e-27  35%  203 aa  RRMJ_METLZ RecName: Full=Ribosomal RNA large subunit
   12::198     5e-27  34%  829 aa  RRMJ3_RAT RecName: Full=Putative rRNA methyltransferase 3;       
   12::198     5e-27  34%  838 aa  RRMJ3_MOUSE RecName: Full=Putative rRNA methyltransferase 3;       
    9::197     7e-27  36%  329 aa  RRMJ1_HUMAN RecName: Full=Putative ribosomal RNA methyltransferase
   24::229     1e-26  36%  244 aa  RRMJ_RHOS1 RecName: Full=Ribosomal RNA large subunit
   24::229     3e-26  35%  244 aa  RRMJ_RHOS4 RecName: Full=Ribosomal RNA large subunit
   14::199     6e-26  33%  802 aa  SPB1_SCHPO RecName: Full=AdoMet-dependent rRNA methyltransferase
   11::198     6e-26  37%  203 aa  RRMJ_DESAH RecName: Full=Ribosomal RNA large subunit
   10::193     7e-26  36%  199 aa  RRMJ_TREDE RecName: Full=Ribosomal RNA large subunit
   15::201     1e-25  35%  833 aa  SPB1_KLULA RecName: Full=AdoMet-dependent rRNA methyltransferase
   12::198     1e-25  34%  832 aa  RRMJ3_CHICK RecName: Full=Putative rRNA methyltransferase 3;       
    1::198     2e-25  34%  831 aa  SPB1_NEUCR RecName: Full=AdoMet-dependent rRNA methyltransferase
    9::198     2e-25  33%  203 aa  RRMJ_WIGBR RecName: Full=Ribosomal RNA large subunit
    6::190     2e-25  36%  197 aa  RRMJ_THEVO RecName: Full=Ribosomal RNA large subunit
   13::195     2e-25  35%  207 aa  RRMJ_DESOH RecName: Full=Ribosomal RNA large subunit
   14::200     2e-25  35%  837 aa  SPB1_CANGA RecName: Full=AdoMet-dependent rRNA methyltransferase
    1::198     5e-25  33%  884 aa  SPB1_MAGGR RecName: Full=AdoMet-dependent rRNA methyltransferase
   16::199     5e-25  33%  833 aa  RRMJ3_DICDI RecName: Full=rRNA methyltransferase 3 homolog;        
    6::190     6e-25  35%  205 aa  RRMJ_THEAC RecName: Full=Ribosomal RNA large subunit
    1::198     8e-25  34%  795 aa  SPB1_ASPFU RecName: Full=AdoMet-dependent rRNA methyltransferase
   14::200     8e-25  35%  845 aa  SPB1_ASHGO RecName: Full=AdoMet-dependent rRNA methyltransferase
   14::200     1e-24  35%  841 aa  SPB1_YEAST RecName: Full=AdoMet-dependent rRNA methyltransferase
    1::198     1e-24  34%  806 aa  SPB1_EMENI RecName: Full=AdoMet-dependent rRNA methyltransferase
   14::198     2e-24  35%  850 aa  SPB1_YARLI RecName: Full=AdoMet-dependent rRNA methyltransferase
   14::200     2e-24  34%  831 aa  SPB1_DEBHA RecName: Full=AdoMet-dependent rRNA methyltransferase
    4::200     5e-24  35%  845 aa  SPB1_CANAL RecName: Full=AdoMet-dependent rRNA methyltransferase
    9::200     7e-24  33%  270 aa  RRMJ1_DICDI RecName: Full=rRNA methyltransferase 1 homolog;        
    5::191     9e-24  31%  193 aa  RRMJ_BRAHW RecName: Full=Ribosomal RNA large subunit
    9::196     9e-24  33%  337 aa  RRMJ1_CAEEL RecName: Full=Putative ribosomal RNA methyltransferase
    9::203     1e-23  35%  285 aa  YEK3_SCHPO RecName: Full=Putative ribosomal RNA methyltransferase
    8::193     1e-23  36%  267 aa  RRMJ_ANADE RecName: Full=Ribosomal RNA large subunit
   14::199     2e-23  34%  908 aa  SPB1_CRYNE RecName: Full=AdoMet-dependent rRNA methyltransferase
    1::169     3e-23  36%  171 aa  RRMJ_EHRCJ RecName: Full=Ribosomal RNA large subunit
    9::203     4e-23  34%  310 aa  TRM7_YEAST RecName: Full=tRNA (uridine-2'-O-)-methyltransferase
   15::200     1e-22  32%  921 aa  SPB1_USTMA RecName: Full=AdoMet-dependent rRNA methyltransferase
    4::198     2e-22  33%  202 aa  RRMJ_TREPR RecName: Full=Ribosomal RNA large subunit
    6::214     4e-22  31%  214 aa  RRMJ2_CAEEL RecName: Full=Putative ribosomal RNA methyltransferase
   19::198     7e-21  30%  201 aa  RRMJ_DESPS RecName: Full=Ribosomal RNA large subunit
    9::203     9e-21  35%  320 aa  RMJ1B_DROME RecName: Full=Putative ribosomal RNA methyltransferase
    9::203     3e-20  32%  302 aa  RMJ1A_DROME RecName: Full=Putative ribosomal RNA methyltransferase
   23::192     9e-19  35%  200 aa  RRMJ_TREPS RecName: Full=Ribosomal RNA large subunit
   23::192     9e-19  35%  200 aa  RRMJ_TREPA RecName: Full=Ribosomal RNA large subunit
    3::185     3e-18  33%  189 aa  RRMJ_BORAP RecName: Full=Ribosomal RNA large subunit
    4::189     8e-17  30%  194 aa  RRMJ_PICTO RecName: Full=Ribosomal RNA large subunit
   30::310     3e-16  39%  320 aa  MRM2_YEAST RecName: Full=Ribosomal RNA methyltransferase MRM2,
    3::188     8e-15  29%  192 aa  RRMJ_BORGA RecName: Full=Ribosomal RNA large subunit
    6::188     2e-14  29%  193 aa  RRMJ_BORRA RecName: Full=Ribosomal RNA large subunit
    6::188     2e-14  29%  193 aa  RRMJ_BORDL RecName: Full=Ribosomal RNA large subunit
    4::119     3e-14  38%  129 aa  RRMJ_EHRRW RecName: Full=Ribosomal RNA large subunit
    4::119     4e-14  38%  129 aa  RRMJ_EHRRG RecName: Full=Ribosomal RNA large subunit
    6::188     4e-13  29%  192 aa  RRMJ_BORBZ RecName: Full=Ribosomal RNA large subunit
    6::188     4e-13  29%  192 aa  RRMJ_BORBU RecName: Full=Ribosomal RNA large subunit
   63::269     9e-13  37%  301 aa  YIKA_SCHPO RecName: Full=Putative ribosomal RNA methyltransferase
  184::258     1e-05  47%  351 aa  RRMT_XYLFM RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  184::258     1e-05  45%  351 aa  RRMT_XYLFT RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  185::223     2e-05  56%  352 aa  RRMT_METCA RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  181::239     3e-05  48%  351 aa  RRMT_PSEMY RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  184::258     7e-05  44%  351 aa  RRMT_XYLFA RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  203::254     7e-05  45%  364 aa  RRMT_AZOSB RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  209::282     1e-04  35%  360 aa  RRMT_ALHEH RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  182::240     2e-04  46%  352 aa  RRMT_PSEAE RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  182::240     2e-04  46%  352 aa  RRMT_PSEAB RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  182::240     2e-04  46%  352 aa  RRMT_PSEA8 RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  182::240     2e-04  46%  352 aa  RRMT_PSEA7 RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  181::239     2e-04  46%  353 aa  RRMT_AZOVD RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  204::289     2e-04  35%  368 aa  RRMT_AZOSE RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  189::247     3e-04  50%  358 aa  RRMT_MARAV RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  174::245     3e-04  50%  339 aa  RRMT_HALHL RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  182::228     3e-04  50%  350 aa  RRMT_CELJU RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  208::319     3e-04  30%  767 aa  FTSJ1_MOUSE RecName: Full=FtsJ methyltransferase domain-containing
  208::316     4e-04  30%  770 aa  FTSJ1_HUMAN RecName: Full=FtsJ methyltransferase domain-containing
  186::232     6e-04  45%  366 aa  RRMT_SODGM RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  182::240     6e-04  48%  350 aa  RRMT_MARMS RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  225::316     8e-04  24%  370 aa  Y1111_HALSA RecName: Full=Uncharacterized GTP-binding protein
   66::99      8e-04  47%  254 aa  UBIE_THICR RecName: Full=Ubiquinone/menaquinone biosynthesis
  186::232     8e-04  45%  366 aa  RRMT_PECCP RecName: Full=Putative RNA 2'-O-ribose methyltransferase
  186::232     8e-04  45%  366 aa  RRMT_ERWCT RecName: Full=Putative RNA 2'-O-ribose methyltransferase
    1::212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAKRKSHSARWLREHFRDSYVIQAKAQGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAER
RRMJ_NITOC      MAKRKSHSARWLREHFRDSYVIQAKAQGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAER
RRMJ_VIBF1      MSKNKASSGRWLKEHFDDKYVLEAQKRGYRSRAIFKIEEIQNKDKLLKPGMTVVDLGAAPGGWSQYAVEQ
RRMJ_VIBFM      MSKNKASSGRWLKEHFDDKYVLEAQKRGYRSRAIFKIEEIQNKDKLLKSGMTVVDLGAAPGGWSQYAVEQ
RRMJ_AZOSB      --KRNKTSKAWMHEHLNDTYVQRANAEGYRARAAYKLMEIDERDRLLRPGRVVVDLGAAPGSWCQVARQR
RRMJ_PHOPR      --KQSASSGRWLKEHFDDKYVQEAQKRGYRSRAIFKIEEIQKKDKLLKPGMTVVDLGAAPGGWSQYAAEV
RRMJ_VIBCM      --KHSASSTRWLKEHFDDKYVNEAKKKGYRSRAIFKIEEIQNKDKLLKAGMTVVDLGAAPGGWSQFAAKV
RRMJ_VIBCH      --KHSASSTRWLKEHFDDKYVNEAKKKGYRSRAIFKIEEIQNKDKLLKAGMTVVDLGAAPGGWSQFAAKV
RRMJ_VIBC3      --KHSASSTRWLKEHFDDKYVNEAKKKGYRSRAIFKIEEIQNKDKLLKAGMTVVDLGAAPGGWSQFAAKV
RRMJ_VIBVY      --KHSASSSRWLKEHFDDKYANEARRKGYRSRAIFKLEEIQQKDKLLKPGMTVVDLGAAPGGWSQYAIGV
RRMJ_VIBVU      --KHSASSSRWLKEHFDDKYANEARRKGYRSRAIFKLEEIQQKDKLLKPGMTVVDLGAAPGGWSQYAIGV
RRMJ_LEGPC      MSRTKS-SKRWLQEHFDDVYVKKAQAEGYRSRAVYKLKEIDDKESLIKPGMTVVDLGAAPGGWTQYASEK
RRMJ_LEGPH      ---RTKSSKRWLQEHFDDVYVKKAQAEGYRSRAVYKLKEIDDKESLIKPGMTVVDLGAAPGGWTQYASEK
RRMJ_LEGPA      ---RTKSSKRWLQEHFDDVYVKKAQAEGYRSRAVYKLKEIDDKESLIKPGMTVVDLGAAPGGWTQYASEK
RRMJ_METCA      MAKRSRSSGRWLAEHFSDEYVRLAQEKGYRSRAVFKLMELDEHDRLFAPGTTVIDLGAAPGGWSQYAARR
RRMJ_LEGPL      ---RTKSSKRWLQEHFDDVYVKKAQAEGYRSRAVYKLKEIDDKESLIKPGMTVVDLGASPGGWTQYASEK
RRMJ_VIBPA      --KHSASSGRWLKEHFDDKYANEARKKGYRSRAYFKIDEIQTKDKLLKPGMTVVDLGAAPGGWSQYAAKI
RRMJ_AERS4      --KRSPSSTRWLKEHFDDQYVKKAQKLGLRSRAVFKIDEIQGKDKLLRTGMTVVDLGAAPGGWSQFAVEQ
RRMJ_PSEHT      --KQSASSQRWLKEHFDDKYVQEAQKKGWRSRAVFKLDEVQSRDKLLRPAMTVVDLGAAPGSWSQYLAEK
RRMJ_ERWT9      --KRSASSSRWLQEHFSDKYVLQAQKKGLRSRAWFKLDEIQQGDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_PHOLL      --KRSASSSRWLQEHFSDKYVLQAQKKGLRSRAWFKLDEIQQSDKIFKPGMTVVDLGAAPGGWSQYAVSQ
RRMJ_ERWCT      --KRSASSSRWLQEHFSDKYVLQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_EDWI9      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQGTDKIFRPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_VIBHB      --KHSASSGRWLKEHFDDKYANEARKKGYRSRAYFKIEEIQTKDKLLKSGMTVVDLGAAPGGWSQYAAKI
RRMJ_TOLAT      --KRTASSTRWLKEHFDDKYVQQAQKQGLRSRAVFKIDEIQQKDKLIKQGMTVVDLGAAPGGWSQFCVEQ
RRMJ_VIBSL      --KHSASSGRWLKEHFDDKYANEARKKGYRSRAYFKMEEIQTKDKLLTPGMTIVDLGAAPGGWSQYAAKI
RRMJ_PROMH      --KRSASSSRWLQEHFSDKYVQQAKKKGFRSRAWFKLEEIQQSDNIFKPGMTVVDLGAAPGGWSQYVVQQ
RRMJ_AERHH      --KHSPSSTRWLKEHFDDQYVKKAQKLGLRSRAVFKIDEIQGKDKLLKPGMTVVDLGAAPGGWSQFAIDQ
RRMJ_THICR      MARSKS-SAGWLKEHFDDYYVNKAKQDGWRSRAIYKLQEIDEKDQLFSKGMTVIDLGAAPGGWSQWTTHQ
RRMJ_ACTSZ      --KRSASSSRWLNEHFKDPFVQKAHKQKLRSRAYFKLDEIQQTDRLFKPGMTVVDLGAAPGGWSQYAVTQ
RRMJ_SHEAM      --KRSASSTRWMQEHFDDHYVKLAQKRGLRSRAAFKLEELQEKDHLIKPGMTVVDLGAAPGGWSQVAVKL
RRMJ_PECCP      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALAR      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SERP5      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_AZOVD      MARSKT-SHRWLKEHFDDPYVKMAQKDGYRSRASYKLLEIQEKDRILRPGMTVVDLGAAPGGWSQVTSRL
RRMJ_SALPK      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALPA      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_MANSM      --KRSASSSRWLNEHFKDPFVQKAHKQKLRSRAYFKLDEIQQSDRLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_YERE8      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHISS      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHIFL      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHIF8      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHIBS      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHIB3      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHELP      --KRTASSTRWMQEHFDDHYVKLSQKRGLRSRAAFKIEEIQQKDKLIRPGMTVVDLGAAPGGWSQIAVKL
RRMJ_SALTY      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALSV      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALPB      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALNS      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALHS      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALG2      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALEP      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALDC      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALA4      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ESCF3      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOUT      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOSM      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOSE      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOLU      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOLI      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOLC      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOL6      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOL5      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOK1      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOHS      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECODH      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECOBW      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO8A      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO81      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO7I      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO5E      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO57      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO55      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO45      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO27      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_ECO24      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_CITK8      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHEPW      --KRTASSSRWMQEHFDDHYVKLAQKRGFRSRAAFKIEEIQEKDKLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_SALTI      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALPC      --KRSASSSRWLHEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SALCH      --KRSASSSRWLHEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_KLEP7      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKIFKPGMTVVDLGAAPGGWSQYAVTQ
RRMJ_ENT38      --KRSASSSRWLQEHFSDKYVLQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTIVDLGAAPGGWSQYAVTQ
RRMJ_ALISL      --KLSASSGRWLKEHFDDKYVLEAQKRGYRSRAIFKLEEIQNKDKLLKPGMTVVDLGAAPGGWSQYAVEQ
RRMJ_YERPY      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKQGMTVVDLGAAPGGWSQYAVTQ
RRMJ_YERPS      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKQGMTVVDLGAAPGGWSQYAVTQ
RRMJ_YERPP      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKQGMTVVDLGAAPGGWSQYAVTQ
RRMJ_YERPN      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKQGMTVVDLGAAPGGWSQYAVTQ
RRMJ_YERPE      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKQGMTVVDLGAAPGGWSQYAVTQ
RRMJ_YERPB      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKQGMTVVDLGAAPGGWSQYAVTQ
RRMJ_YERPA      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKQGMTVVDLGAAPGGWSQYAVTQ
RRMJ_YERP3      --KRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQSDKLFKQGMTVVDLGAAPGGWSQYAVTQ
RRMJ_SODGM      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFRPGMTVVDLGAAPGGWSQYVATQ
RRMJ_KLEP3      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKIFKPGMTIVDLGAAPGGWSQYAVTQ
RRMJ_SHESW      --KRTASSNRWMLEHFDDHYVKLAQKRGLRSRAAFKLEELQQKDQLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_SHEPC      --KRTASSNRWMLEHFDDHYVKLAQKRGLRSRAAFKLEELQQKDQLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_SHEPA      --KRTASSSRWMQEHFDDHYVKLSQKRGLRSRAAFKIEEIQEKDKLIRPGMTVVDLGAAPGGWSQIAVKL
RRMJ_PSEAE      MARSKT-SQRWLKEHFDDPYVKMAQRDGYRSRASYKLLEIQEKDRILRPGMTVVDLGAAPGGWSQVTSRV
RRMJ_PSEAB      MARSKT-SQRWLKEHFDDPYVKMAQRDGYRSRASYKLLEIQEKDRILRPGMTVVDLGAAPGGWSQVTSRV
RRMJ_PSEA8      MARSKT-SQRWLKEHFDDPYVKMAQRDGYRSRASYKLLEIQEKDRILRPGMTVVDLGAAPGGWSQVTSRV
RRMJ_HAEDU      --KRSASSSRWLAEHFKDQFVQKAHKQKLRSRAYFKLDEIQQSDRLFRPGMTVVDLGAAPGGWSQYAVTQ
RRMJ_SHESH      --KRTASSSRWMQEHFDDHYVKLAQKRGFRSRAAFKIEEIQEKDKLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_PSEA7      MARSKT-SQRWLKEHFDDPYVKMAQRDGYRSRASYKLLEIQEKDRILRPGMTVVDLGAAPGGWSQVTSRV
RRMJ_CELJU      MARSKS-SNRWLEEHFSDQYVKKSHADGYRTRASYKLLELNDKDRLIRPGMLVVDLGAAPGGWSQVAGQQ
RRMJ_SHEHH      --KRTASSSRWMQEHFDDHYVKLAQKRGLRSRAAFKIEEIQEKDKLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_SHEFN      --KRTASSTRWMQEHFDDHYVKLAQKRGLRSRAAFKLEEIQEKDHLIKQGMTVVDLGAAPGGWSQVAAKL
RRMJ_PSEMY      MARSKT-SQRWLKEHFDDPYVKMAQKDGYRSRASYKLLEIQEKDRILRPGMTVVDLGAAPGGWSQVTSRV
RRMJ_PSEF5      MARSKT-SHNWLKEHFNDPFVKMAQKDGYRSRASYKLLEIQEKDRLIRPGMSVIDLGAAPGGWSQVTSRL
RRMJ_ENTS8      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKIFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHEWM      --KRTASSSRWMQEHFDDHYVKLAQKRGFRSRAAFKIEEIQEKDKLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_SHEON      --KRTASSNRWMLEHFDDHYVKLAQKRGLRSRAAFKLEELQQKDQLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_PASMU      --KRSASSSRWLNEHFKDPFVQKAHKQKLRSRAYFKLDEIQQTDRLFKPGMTVVDLGAAPGGWSQYVVSQ
RRMJ_SHESM      --KRTASSTRWMQEHFDDHYVKLAQKRGLRSRAAFKLEELQEKDQLIRPGMTVVDLGAAPGGWSQIAVKL
RRMJ_SHESA      --KRTASSTRWMQEHFDDHYVKLAQKRGLRSRAAFKLEELQEKDQLIRPGMTVVDLGAAPGGWSQIAVKL
RRMJ_SHEDO      --KRTASSARWMQEHFDDHYVKLAQKRGLRSRAAFKLEEIQQKDHLIRQGMTVVDLGAAPGGWSQVAVKL
RRMJ_PSE14      MARSKT-SHNWLKEHFDDKYVKMAQKDGYRSRASYKLLEIQEKDKLIRPGMTVIDLGAAPGGWSQVTSRL
RRMJ_PSEU2      MARSKT-SHNWLKEHFDDKYVKMAQKDGYRSRASYKLLEIQEKDKLIRPGMTVIDLGAAPGGWSQVTSRL
RRMJ_HAES1      --KRSASSSRWLNEHFKDPFVQKAHKQKLRSRAYFKLDEIQQSDRLFKHGMTVVDLGAAPGGWSQYAIRQ
RRMJ_SHIDS      --KRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
RRMJ_SHESR      --KRTASSNRWMLEHFDDHYVKLAQKRGLRSRAAFKLEELQQKDQLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_PSEA6      --KQSESSKRWLKEHFDDKYVIKAKKQGLRSRAVFKLEEIQAKDGLIKPGMTVVDLGAAPGGWSQYAVKQ
RRMJ_PSEE4      MVQRSKSSANWLREHFNDPFVKQAQKDGYRSRASYKLLEIQEKDRLIRPGMSVIDLGAAPGGWSQVTSRL
RRMJ_XANOR      MPSRSKSSQRWLKEHFADPYVKKARAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAPGGWSQQVRKS
RRMJ_XANOP      MPSRSKSSQRWLKEHFADPYVKKARAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAPGGWSQQVRKS
RRMJ_XANOM      MPSRSKSSQRWLKEHFADPYVKKARAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAPGGWSQQVRKS
RRMJ_PSESM      MARSKT-SHNWLKEHFDDKYVKMAQKDGYRSRASYKLLEIQEKDKIIRPGMTVIDLGAAPGGWSQVTSRL
RRMJ_XANC5      MPSRSKSSQRWLKEHFADPYVKKAQAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAPGGWSQQVRKS
RRMJ_XANAC      MPSRSKSSQRWLKEHFADPYVKKAQAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAPGGWSQQVRKS
RRMJ_HAEI8      --KRSASSSRWLNEHFSDQFVQKAHKQKLRSRAYFKIDEIQQTDKLFKQGMTVVDLGAAPGGWSQYVVSQ
RRMJ_PSEPW      MVQRSKSSANWLREHFNDPFVKQAQKDGYRSRASYKLLEIQEKDRLIRPGMSVIDLGAAPGGWSQVTSRL
RRMJ_HAEPS      --KRSASSSRWLAEHFKDQFVQKAHKQKLRSRAYFKLDEIQQTDRLFKHGMTVVDLGAAPGGWSQYVVTQ
RRMJ_PSEFS      MARSKT-SLKWLQEHFNDPYVKKAQKDGYRSRASYKLLEIQDKDKLIRPGMSVIDLGAAPGGWSQVTSRL
RRMJ_METFK      --KRRPTSKAWLQEHVNDEFVKRAQRDGYRARAAYKLLEIDDKDQLIKPGMTIVDLGSAPGSWSQVAVQR
RRMJ_HAEIN      --KRSASSSRWLNEHFSDQFVQKAHKQKLRSRAYFKIDEIQQTDKLFKQGMTVVDLGAAPGGWSQYVVSQ
RRMJ_PSEPK      MVQRSKSSANWLREHFNDPFVKQAQKDGYRSRASYKLLEIQEKDRLIRPGMSVIDLGAAPGGWSQVTSRL
RRMJ_PSEPG      MVQRSKSSANWLREHFNDPFVKQAQKDGYRSRASYKLLEIQEKDRLIRPGMSVIDLGAAPGGWSQVTSRL
RRMJ_PSEP1      MVQRSKSSANWLREHFNDPFVKQAQKDGYRSRASYKLLEIQEKDRLIRPGMSVIDLGAAPGGWSQVTSRL
RRMJ_XANCP      MPSRSKSSQRWLKEHFADPFVKKAQAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAPGGWSQQVRKS
RRMJ_XANCB      MPSRSKSSQRWLKEHFADPFVKKAQAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAPGGWSQQVRKS
RRMJ_XANC8      MPSRSKSSQRWLKEHFADPFVKKAQAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAPGGWSQQVRKS
RRMJ_NITMU      --KRTKTSKAWMKEHVNDFFVRQAKKEGYRSRAAYKLMEIAERDHLFKPGMTVVDLGAAPGGWSQVAAEK
RRMJ_MARAV      MARSKS-SNRWLEEHVNDPFVKQAQQDGYRSRASYKLLEINNKDRLIKPTDLVVDLGSAPGGWSQVAAKL
RRMJ_DICNV      MARSKS-SGRWLKEHHSDVFVLKAREEGFRSRAVYKLKEIQEKDRIIRPNMTVVELGAAPGGWSQYVAGI
RRMJ_HAHCH      ---RSKSSSRWLNEHHSDVYVKKSKEDGFRSRASYKLIELDRQDKLLRPGMTVIDLGAAPGGWSQVVADV
RRMJ_XYLFM      MSHSKS-SQRWLKEHFSDPFVKKAQAEGMRSRAAYKLEEILKRDRILRPNMVVIDLGAAPGGWSQQIRKQ
RRMJ_XYLFA      MSHSKS-SQRWLKEHFSDPFVKKAQAEGMRSRAAYKLEEILKRDRILRPNMVVIDLGAAPGGWSQQIRKQ
RRMJ_ALCBS      -SSRSKTSKAWLKEHFNDPWVAKAQEQGYRSRASFKLLEMNEKDRLFRPGMAVLDLGAAPGGWSQVAGQL
RRMJ_ACIBY      --KLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYKLIKPGMTVVDLGAAPGSWSQIAGKL
RRMJ_ACIBT      --KLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYKLIKPGMTVVDLGAAPGSWSQIAGKL
RRMJ_ACIBS      --KLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYKLIKPGMTVVDLGAAPGSWSQIAGKL
RRMJ_ACIBC      --KLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYKLIKPGMTVVDLGAAPGSWSQIAGKL
RRMJ_ACIB5      --KLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYKLIKPGMTVVDLGAAPGSWSQIAGKL
RRMJ_ACIB3      --KLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYKLIKPGMTVVDLGAAPGSWSQIAGKL
RRMJ_ACIAD      --KLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYRLIKPGMTVVDLGAAPGSWSQIAGKL
RRMJ_SHEB9      --KRTASSNRWMLEHFDDHYVKLAQKMGLRSRAAFKLEEIQQKDQLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_SHEB8      --KRTASSNRWMLEHFDDHYVKLAQKMGLRSRAAFKLEEIQQKDQLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_SHEB5      --KRTASSNRWMLEHFDDHYVKLAQKMGLRSRAAFKLEEIQQKDQLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_SHEB2      --KRTASSNRWMLEHFDDHYVKLAQKMGLRSRAAFKLEEIQQKDQLIRPGMTVVDLGAAPGGWSQVAVKL
RRMJ_IDILO      --KRSVSSQRWLKEHFDDQFVQKAQKKGLRSRAVFKLEEIQKRDKLIKKGQTVVDLGAAPGGWSQYVADY
RRMJ_HAMD5      ----------WLQEHFNDKYVIEAQKKKLRSRAWFKLDEIDNTDKIFKRGMFVLDLGAAPGGWSQYVVNK
RRMJ_CHRVO      MARSKS-SNNWLQEHVNDQYVHMAQKDGYRARAAYKLLEINDKDKLIRPGTVLADLGSTPGSWSQVAARI
RRMJ_SACD2      ---RSKSSGRWLQEHFNDQYVKDSQKDGYRSRASYKLIELNDKDKLIKSGQTVVDLGAAPGGWSQVAAQI
RRMJ_COLP3      --KHKASSQRWLDEHFDDEYVKKAQRLGLRSRAVFKLEEINIKDRLIKPGMKVVDLGAAPGGWSEYAVKV
RRMJ_XYLFT      MSHSKS-SQRWLKEHFSDPFVKKAQAEGMRSRAAYKLEEILKRDRILRPNMVVIDLGAAPGGWSQQIRKQ
RRMJ_XYLF2      MSHSKS-SQRWLKEHFSDPFVKKAQAEGMRSRAAYKLEEILKRDRILRPNMVVIDLGAAPGGWSQQIRKQ
RRMJ_THISH      ---RSKSSHRWLKEHFDDEYVKRAQQEGYRSRAVYKLQEIQERDRLLRQGMTVVDLGAAPGGWTQYAAGL
RRMJ_CHRSD      ----------WLKEHFDDRYVQRSWQDGYRSRASYXXXXXXXXXXXXXPGMTVIDLGAAPGGWSQIAADK
RRMJ_ACTPJ      --KRSASSSRWLAEHFKDQFVQKAHKQKLRSRAYFKLDEIQQTDRLFKPGMTVVDLGAAPGGWSQYAVTQ
RRMJ_ACTP7      --KRSASSSRWLAEHFKDQFVQKAHKQKLRSRAYFKLDEIQQTDRLFKPGMTVVDLGAAPGGWSQYAVTQ
RRMJ_ACTP2      --KRSASSSRWLAEHFKDQFVQKAHKQKLRSRAYFKLDEIQQTDRLFKPGMTVVDLGAAPGGWSQYAVTQ
RRMJ_THIDA      --KRTKSGSAWMHEHVTDAYVKKAQQDGFRSRAAYKLLEIDSRDHLLHPGMTVVDLGAAPGSWCQVAVQK
RRMJ_ALHEH      ----------WLDEHHSDHWVQQAQKAGYRSRAAFKLLEIQEKDRLIRPGMTVVDLGAAPGGWCQVAAEL
RRMJ_PSEPF      MARSKT-SLGWLKRHVNDPYVKQAQKDGYRSRASYKLLEIQEKYKLIRPGMNVVDLGAAPGGWSQVTSRL
RRMJ_VESOH      ---KKDSSRRWMREHINDKFVKNAKKAGYRSRAVYKLIEVINKEKFIKPGNKVIDLGAAPGSWSQMAIKA
RRMJ_NITEC      -------SRAWIKAHINDNFVRKANHEGYRSRAAYKLQEIAERDALFSPGMTVVDLGASPGSWSQVALES
RRMJ_NEIMF      MAVRSKSSKAWLHEHVNDHYVHMAQKDGYRARAAYKLLEINEKDKLIKPGTVLADLGSAPGSWSQVAAKL
RRMJ_NEIMB      MAVRSKSSKAWLHEHVNDHYVHMAQKDGYRARAAYKLLEINEKDKLIKPGTVLADLGSAPGSWSQVAAKL
RRMJ_NEIMA      MAVRSKSSKAWLHEHVNDHYVHMAQKDGYRARAAYKLLEINEKDKLIKPGTVLADLGSAPGSWSQVAAKL
RRMJ_NEIM0      MAVRSKSSKAWLHEHVNDHYVHMAQKDGYRARAAYKLLEINEKDKLIKPGTVLADLGSAPGSWSQVAAKL
RRMJ_NEIG1      MAVRSKSSKAWLHEHINDQYVHMAQKDGYRARAAYKLLEINEKDKIIKPGTVLADLGSAPGSWSQVAAKL
RRMJ_NEIG2      MAVRSKSSKAWLHEHINDHYVHMAQKDGYRARAAYKLLEINEKDKIIKPGTVLADLGSAPGSWSQVAAKL
RRMJ_BUCAI      --KKKHRSNRWLLEHFQDQYVKAAKKNNIRSRAWFKLEQLDKNNKIFKIGMNVIDLGAAPGSWSQYASNR
RRMJ_PSEU5      --KRSKSSRRWLDEHVNDPFVKRAQKDGLRSRSSYKLIELNEKDKLIRPGMLVMDLGSAPGGWSQVAGGI
RRMJ_PSYIN      -------SKRWMYEHVNDFYVKEATKKGLRSRAVFKLEEINKKDKLIRSGMTVVDLGAAPGSWSQWAVDT
RRMJ_NITEU      -------SRAWIKAHINDNFVRKANHEGYRSRAAYKLREIAEHDALFVPGMTVVDLGAVPGSWSQVALES
RRMJ_STRM5      MATRSKSSQRWLKEHFSDPFVKKAQAEGMRSRAAYKXXXXXXXXXXXKPHMVVVDLGAAPGGWSQQVRRQ
RRMJ_BURCM      MAKNRFNQ-NWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGATPGSWSQYARNK
RRMJ_BURA4      MAKNRFNQ-HWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGATPGSWSQYARNK
RRMJ_STRMK      MATRSKSSQRWLKEHFSDPFVKKAQAEGMRSRAAYKXXXXXXXXXXXKPHMVVVDLGAAPGGWSQQVRRQ
RRMJ_BURVG      MAKNRFNQ-HWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURP8      MAKNKFNTS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYVRNK
RRMJ_BURCJ      MAKNRFNQ-HWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGATPGSWSQYARNK
RRMJ_BURCH      MAKNRFNQ-HWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGATPGSWSQYARNK
RRMJ_BURCC      MAKNRFNQ-HWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGATPGSWSQYARNK
RRMJ_BURCA      MAKNRFNQ-HWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGATPGSWSQYARNK
RRMJ_DECAR      --KRTRTSKAWMREHINDTYVQLARKEGWRSRAAFKLMEMDDKDKLLKHGEVVVDLGATPGGWSQVAVKR
RRMJ_BURS3      MAKNRFNQ-HWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGATPGSWSQYARNK
RRMJ_BURPS      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURP6      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURP1      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURP0      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURMS      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURMA      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURM9      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURM7      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_HALHL      --RRGCNSQARRSRHESDPFVRRARAEGWRSRAALKLEAIDQRDGLFRPGQVVVDLGAAPGGWSQLVAPK
RRMJ_BURM1      MAKNRFNQ-HWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_BURTA      MAKNRFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_ACIF5      MARSKS-SEKWLKEHFKDPFVQRAMKEGYRSRASYKLLEIQQKDHLIRPGMRVLDVGAAPGGWTQVAAPL
RRMJ_ACIF2      MARSKS-SEKWLKEHFKDPFVQRAMKEGYRSRASYKLLEIQQKDHLIRPGMRVLDVGAAPGGWTQVAAPL
RRMJ_PSYCK      --KLSKSSSAWMKEHIDDHYVQKAQKDGYRARAAYKLLEINEKTNLIKKGMTVVDLGSAPGSWSQVAGHL
RRMJ_PSYA2      --KLSKSSSAWMKEHIDDHYVQKAQKDGYRARAAYKLLEINEKTNLIKKGMTVVDLGSAPGSWSQVAGQL
RRMJ_FRATN      -----SSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQNKYQLFKPNMFVVDLGAAPGGWSEQVIKY
RRMJ_CUPTR      MAKNKNHS--WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_FRATW      -----SSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQDKYQLFKPNMFVVDLGAAPGGWSEQVIKY
RRMJ_FRATT      -----SSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQDKYQLFKPNMFVVDLGAAPGGWSEQVIKY
RRMJ_FRATM      -----SSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQDKYQLFKPNMFVVDLGAAPGGWSEQVIKY
RRMJ_FRAT1      -----SSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQDKYQLFKPNMFVVDLGAAPGGWSEQVIKY
RRMJ_RALME      MAKNKFNQS-WLHDHINDPYVKMAQREGYRARAAYKLKEIDDQDKLIQPGQVIVDLGAAPGSWSQYARNK
RRMJ_RALEH      MAKNKNHS--WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRPGQVIVDLGAAPGSWSQYARNK
RRMJ_FRATO      -----SSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQDKYQLFKPNMFVVDLGASPGGWSEQVIKY
RRMJ_FRATH      -----SSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQDKYQLFKPNMFVVDLGASPGGWSEQVIKY
RRMJ_FRATF      -----SSTKKWLHEHTSDYYVIQANKLGYRSRASFKILEIQDKYQLFKPNMFVVDLGASPGGWSEQVIKY
RRMJ_COXBR      -----THSKRWLEEHAKDPYVKRAKKEGYPSRAAYKLLEIHQKYKLFKPSMNVIDLGAAPGGWSQVAKDL
RRMJ_COXBU      -----THSKRWLEEHEKDPYVKRAKKEGYPSRAAYKLLEIHQKYKLFKPSMNVIDLGAAPGGWSQVAKDL
RRMJ_COXBN      -----THSKRWLEEHEKDPYVKRAKKEGYPSRAAYKLLEIHQKYKLFKPSMNVIDLGAAPGGWSQVAKDL
RRMJ_COXB2      -----THSKRWLEEHEKDPYVKRAKKEGYPSRAAYKLLEIHQKYKLFKPSMNVIDLGAAPGGWSQVAKDL
RRMJ_BURPP      MAKNKFNTA-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDRLIRPGQVIVDLGSVPGSWSQYAAQR
RRMJ_BURXL      MAKNKFNTA-WLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIRAGQVIVDLGSTPGSWSQYAAQR
RRMJ_RUTMC      ---KKGSSGRWMSEHINDEFVKKAQKSGYRSRSVYKLIEVINKDKFIKLGDKVLDLGAAPGGWSQVAIKI
RRMJ_RALEJ      MAKGKSKNKSWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKLIQPGQVIVDLGAAPGSWSQYARNK
RRMJ_COXB1      -----THSKRWLEEHEKDPYVKRAKKEGYPSRAAYKLLEIHQKYKLFKPSMNVIDLGAAPGGWSQVAKDL
RRMJ_BORPD      MAKKK-FSKDWIHQHINDPYVKMAQQKGYRARAAFKLIEILDTEKLMRRGDIVVDLGSAPGSWSQVARER
RRMJ_ACIAC      --KSKKVNKAWLHDHVNDTYVKLAQKEGYRARAAYKLKEIDETLGLIRPGQVVVDLGSAPGAWSQYLRRR
RRMJ_BORPE      MAKNK-FSKDWIHQHINDPYVKLAQQKGYRARAAFKLLEILDAEKLMRRGDVVVDLGSAPGSWSQVARER
RRMJ_RALPJ      MAKNKFNQS-WLHDHINDPYVKLAQREGYRARAAYKLKEIDEQDKLIKPGQVIVDLGAAPGSWSQYVRNK
RRMJ_BORPA      MAKNK-FSKDWIHQHINDPYVKLAQQKGYRARAAFKLLEILDAEKLMRRGDIVVDLGSAPGSWSQVARER
RRMJ_BORBR      MAKNK-FSKDWIHQHINDPYVKLAQQKGYRARAAFKLLEILDAEKLMRRGDIVVDLGSAPGSWSQVARER
RRMJ_AZOSE      --KRTKTSKAWMQEHVNDPYVQRAKSEGYRSRAAFKLIELDDRDRLMRSGMVVVDLGAAPGSWSQVALRR
RRMJ_RALSO      MAKNKFNQS-WLHDHINDPYVKLAQREGYRARAAYKLKEIDEQDKLIKPGQVIVDLGAAPGSWSQYVRNK
RRMJ_VEREI      --RSKKVNKAWLDQHVNDPYVQRARKEGYRARAAYKLREIDEQLGLIRPGYTVVDLGATPGAWSQYLRRR
RRMJ_VARPS      -AKSKKVNKAWLHDHINDPYVKLATREGYRARAAYKLKEIDESLGLVKPGQLVVDLGSTPGAWSQYLRRR
RRMJ_BUCAP      ISKKKSNSSRWLSEHFQDQYVKEAKKQKIRSRSWFKLEEIDKNNRLFKPGMNVLDLGSSPGGWSQYAAKK
RRMJ_HERAR      MAKKKLNK-NWLHDHINDPYVKLAQKEGYRARAVYKLKEIDESEKLIKPGQIIVDLGCTPGSWSQYVRNK
RRMJ_ACISJ      --KSKKVNKAWLHDHVNDTYVKLAQKEGYRARAAYKLKEIDEQLGLIKPGHVVVDLGSSPGAWSQYVRRR
RRMJ_FRAP2      -----STTKKWIQDHTSDYYVLQANKLGYRSRASFKIIEIQDKYNLFKQNMFIIDLGAAPGGWSEQVVKF
RRMJ_POLSJ      -ARGKKVNKAWLHDHINDPYVKLAQKEGYRARAAYKLKEIDETLGLIKPGDCVVDLGSTPGAWSQYVRRK
RRMJ_LEPCP      --KSKKVNKAWFNDHIHDTYVKLAHKEGYRSRAAYKIKEIDETCGLIRPGQVVVDLGAVPGAWSQYVRRR
RRMJ_BAUCH      --KRSASSNRWLQESLKDKYVVQAQKKGLRSRAWFKLDQIQKSDRLFQPYMTIIDLGAAPGSWSQYVTTQ
RRMJ_POLNA      ----------WLHDHINDPYVKQARKEGYRARAAFKLKEMDETLGLIKPGDCVVDLGSTPGAWSQYVRRK
RRMJ_JANMA      MAKNKLNK-NWLHDHINDPYVKLAQKEGYRARAVYKLKEIDETEKLIKPGQIIVDLGATPGSWSQYVRNK
RRMJ_RHOFD      ----------WLNDHVNDTYVKLAKLEGYRARAAYKLKEIDETLGLIKPGQLVVDLGSTPGAWSQYVRRK
RRMJ_MAGSM      MAKQRPSSKRWLREHHNDPYVQQARREGYRSRAAYKLMELDGKSLLLIPGANVVELGAAPGGWTQVAVKL
RRMJ_DELAS      --KSKKVNKAWLNSHVNDPYVKAAQKDGYRARAAYKLKEIDEQLKLIRPGATVVDLGSTPGAWSQYVRRC
RRMJ_BRASB      --KRKLSSKLWLERQLNDPYVAQAKRDGYRSRATYKLIEIDDKYHLLKPGMTVVDLGAAPGGWSQIAARR
RRMJ_METPP      ----------WLNDHINDPYVKLAQKEGYRARAAYKLKEIDEALGLIKPGQVVVDLGAAPGAWSQYLRRR
RRMJ_BRASO      --KRKLSSKLWLERQLNDPYVAQAKRDGYRSRATYKLIEIDDKYHMLKPGMTVVDLGAAPGGWSQIAARR
RRMJ_BRAJA      --KRKLSSKLWLERQLNDPYVAKAKAAGYRSRAAFKLLEIDDKFRLLKHGMAVVDLGAAPGGWSQIAAKR
RRMJ_BLOPB      -------SSGWLQKHFKDQYVKAAQRQKLRSRSWFKLDAINRIDALFSTGMTVIDLGSAPGGWALYVKSK
RRMJ_BORA1      MAKKK-FSKDWIHQHINDPYVKLAQQKGYRARAAFXXXXXXXXXXXXXXGDVVVDLGSAPGSWSQVVRER
RRMJ_PSYWF      -------SKAWMKEHLDDHYVQLAQKEGYRARAAYKLLEINEKTNLIKKGMTVVDLGSAPGSWSQVAGRL
RRMJ_RHOPT      --RMKLSSKLWLERQLNDPYVAQAKRDGYRSRAAYKLTEIDDKFRLLKSGMAVVDLGAAPGGWSQVAAKK
RRMJ_RHOPA      --RMKLSSKLWLERQLNDPYVAQAKRDGYRSRAAYKLTEIDDKFRLLKSGMAVVDLGAAPGGWSQVAAKK
RRMJ_BUCBP      --KRSSSSNRWLNEHFKDKYVKQVNKSDIRSRAWFKLDDIQSSNNFLKVGMTVVDLGSSPGSWSGYAVKR
RRMJ_OLICO      ----------WLERQLNDPYVAQAKRDGFRSRAAYKLREMDDKYHFLKQGQAVVDLGAAPGGWSQIAAKR
RRMJ_NITWN      --KRKLSSKLWLERQLNDPYVAQAKRDGWRSRASFKLIEMDDKHRFLKPGMTVVDLGAAPGGWSQVAAKR
RRMJ_RHOP2      --RMKLSSKLWLDRQLNDPYVAQAKRDGYRSRAAYKLTEIDDKYHFLKSGQAVVDLGAAPGGWSQVAAKR
RRMJ_MAGSA      --RRKLSSTLWLQRQLNDPYVHEAKRLGYRSRAAFKMIQLDERFHILKPGLRVVDLGAAPGGWTQVAVEK
RRMJ_RHOPS      --RMKLSSKLWLERQLNDPYVAQAKRDGYRSRAAYKLLEIDDKYHFLKSGLAVADLGAAPGGWSQIAAKR
RRMJ_ACICJ      -------SQKWLLRQLNDPYVAAAKERGFRSRAAFKLIELDEKFGLIGKGARVVDLGAAPGGWTQVALER
RRMJ_XANP2      ---RTTSSQKWLQRQLNDPYVARAKREGWRSRAAFKLIEMDEKARLLKRGMRIVDLGAAPGGWSQVAAKK
RRMJ_AZOC5      ---RSSSSQKWLQRQLNDPYVARAKREGWRSRAAFKLIEMDEKLHVLKRGMRIVDLGAAPGGWSQVAAKK
RRMJ_RHORT      ---RKASSTRWLQRQLNDPYVLEAKRQGLRSRAAFKLIELDERFTLLKPGMRVVDLGAAPGGWTQIAVER
RRMJ_GRABC      --KRSVASQRWLTRQLNDPYVAAAKAQGWRSRAAFKLIELDDKFGLISKGSRVIDLGAAPGGWTQVAMKR
RRMJ_RHOP5      --RMKLSSKLWLERQLNDPYVAQAKRDGYRSRAAYKLLEIDDKHHFLKPGASVVDLGAAPGGWSQIAAKR
RRMJ_BRUSU      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_BRUSI      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_BRUO2      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_BRUME      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_BRUMB      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_BRUC2      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_BRUAB      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_BRUA2      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_BRUA1      ----KESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARI
RRMJ_PARL1      --KRSNSSTRWLQRQLNDPYVHAAKREGYRSRAAFKLAEIDDKYRFLKPGGRVVDLGCAPGGWCQVAVAR
RRMJ_OCHA4      ----KESSRRWLQRHLNDPYVHKSRQDGYRSRAAYKLIEINDRYDLLKKGQKIIDLGAAPGGWSQIAAKI
RRMJ_RHILO      ----KESSRRWLQRHINDPYVQRSKADGYRSRAAYKLIEIDDKHHLLKPGMKVIDLGAAPGGWCQVAAAR
RRMJ_BARBK      ----KASSRRWLERHLNDPYVHQSKADGYRSRAAYKLIEINERYKILKKGQKIIDLGAAPGGWCQVAARL
RRMJ_RHOPB      ----KLSSKLWLERQLNDPYVAQAKRDGLRSRAAYKLIEIDDKYHFLKPGIAVVDLGAAPGGWSQVAAKR
RRMJ_POLSQ      MAKNKFNKS-WLQDHLTDPYVKMAQKEGYRARAVYKLSEIDEQDHLIKAGMTIVDLGSAPGSWSQYVRNR
RRMJ_RHILW      --KMKASSRQWLQRHINDPYVQRAQLEGYRARAAFKLLEIDEKHHILRGAKRIIDLGAAPGSWSQIAAKV
RRMJ_HALMA      ----------------KDDYYNRAKQEGYRARSAYKLQQLDDTAGLLGEGRTVVDLGAAPGGWMQVAAER
RRMJ_RHIE6      --KMKASSRQWLQRHINDPYVQRAQLEGYRARAAFKLLEIDEKYHILRGARRIIDLGAAPGSWSQIAAKV
RRMJ_BART1      ----KASSRRWLERHLNDPYVHQSKVDGYRSRAAYKLIEINERYKFLKKGQKVIDLGAAPGGWCQVAERI
RRMJ_BUCCC      LKKRSKSSKNWLKRNFNDPYIKERNKKKLRSRSWFKLKEIDESEKIFKKGMNVIDLGSNPGGWSEYTLKK
RRMJ_BARQU      ----KASSRRWLERHLNDPYVHQSKVDGYRSRAAYKLIEMNERYKFLKKGQKIIDLGAAPGGWCQVAQRI
RRMJ_RHIEC      --KMKASSRQWLQRHINDPYVQRAQLEGYRARAAFKLLEIDEKYHILRGAKRIIDLGAAPGSWSQIAAKV
RRMJ_AGRVS      -------SRRWLERHINDPYVQRAKLEGYRARAAFKLLEIDEKHNILKGARRIIDLGAAPGSWSQIAANV
RRMJ_RHISN      -------SRRWLERHINDPYVQRAQLEGYRARAAFKLLEIDEKHKILAGARRIIDLGAAPGSWSQIAAKV
RRMJ_RHIL3      --KMKASSRQWLERHINDPYVQRAQLEGYRARAAFKLLEIDEKHHILRGARRIIDLGAAPGSWSQIAAKV
RRMJ_GLUOX      ----------WLNRQLNDPYVAAARKQGWRSRAAFKLIEIDDRFKLIGEGTRIIDLGAAPGGWTQVAVKR
RRMJ_BARHE      -------SRRWLERHLNDPYVHQSKVDGYRSRAAYKLIEINQRYKFLKKGQKIIDLGAAPGGWCQVSGCI
RRMJ_SINMW      -------SRRWIERHINDPYVQRAQLEGYRARAAFKLLEIDEKHKILAGARRIIDLGAAPGSWSQIAAKV
RRMJ_RICAH      --KRTVSSGNWLRRQLNDPYVAKARIEGFRSRAAYKLLEIHEKFKLFTPNMKIVDLGAAPGGWSQVASKL
RRMJ_MARMM      ---RKSSSTRWLQRQLNDPYVKKAQMEGYRSRAAYKLLQLDERFKLLKPGMRVVDLGSAPGGWVQVALK-
RRMJ_SYNFM      ----------------RDHYFHKAKKEHYLARAVYKLQEIQDRYKILKPGNRVLDLGAAPGSWMQFAREI
RRMJ_WOLTR      ---RKLSSTRWLHRHLNDQYVQKTNKDSYRSRSAYKLIEIDNKFKLLQAGQKIVDLGASPGGWSQVASQK
RRMJ_HYPNA      ---RTESSKRWIERQLQDPYVRKAKDEGYRSRAAYKLLEIDAAAKILRKGMRVVDLGCAPGGWIQVSLQQ
RRMJ_RHIME      -------SRRWIERHINDPYVQRAQLEGYRARAAFKLLEIDEKHKILAGAKRIIDLGAAPGSWSQIAAKV
RRMJ_METAC      ----------------RDYYYHQAKEEGYRSRASFKLKQINEKHNVIKRGDSVVDLGAAPGGWLQVAKQL
RRMJ_HALSA      ----------------KDHYYNKSKQEGYRSRAAYKLQQLDDRFDVLFGGASVVDLGAAPGGWLQVAAER
RRMJ_HALS3      ----------------KDHYYNKSKQEGYRSRAAYKLQQLDDRFDVLFGGASVVDLGAAPGGWLQVAAER
RRMJ_METBF      ----------------------QAKEEGYRSRASFKLKQINERHHIINRGDSVVDLGAAPGGWLQVAKEL
RRMJ_RICCK      --KRTVSSNNWLRRQLNDPYVAKARTQGFRSRAAYKLLEIHEKFKLFTPNMKIVDLGAAPGGWSQIASKL
RRMJ_AGRRK      -------SREWLHRHINDPYVQRAQLEGYRARAAFKLLEIDEKHQILKGARRIIDLGAAPGSWSQIAAKV
RRMJ_RICPR      --KRPISSSNWLRRQLNDPYVAKARLEGFRSRAAYKLLEIHYKFRLFTPNMKIVDLGAAPGGWSQVASKL
RRMJ_BLOFL      -------------KYFIDQYALQAQNQKLRSRSWFKLQSIDRLDKLLKQGMTVIDLGSTPGGWSSYVIKQ
RRMJ_RICTY      --KRPISSSNWLRRQLNDPYVAKARLEGFRSRAAYKLLEIHDKFRLFTPNMKIVDLGAAPGGWSQVASKL
RRMJ_AGRT5      --KLKASSRRWLERHINDPYVQRAKLEGYRARAAFKLLEINDKHQILKGATRIIDLGAAPGSWSQIASDS
RRMJ_METJA      ---------RWVLQRKRDFYYKLAKKLKYRSRASFKLMQLNEKFNVIKPGKIVLDLGCAPGGWMQVAREI
RRMJ_ZYMMO      ----------WLERQLNDPYVQKAQAEGYRSRAAFKLIELDERFSLLKNARRIIDLGIAPGGWSQ-VARK
RRMJ_RICBR      ----------WLRRQLNDPYVAKARIEGFRSRAAYKLLEIHEKFKIFTPNMKVVDLGAAPGGWSQVASKL
RRMJ_RICB8      ----------WLRRQLNDPYVAKARIEGFRSRAAYKLLEIHEKFKIFTPNMKVVDLGAAPGGWSQVASKL
RRMJ_NATPD      ----------------KDDYYNRAKQQGYRSRAAYKLKQLDEAADLINEGDTVVDLGAAPGGWLQVANEL
RRMJ_SILPO      ---RKLSSTRWLQRQLNDPYVKRAQAEGYRGRAAFKILELDEKYRFLVPGARVVDLGCAPGGWCQVAVKR
RRMJ_RICRS      ----------WLRRQLNDPYVAKARIDGFRSRAAYKLLEIHEKFKLFTPNMKVVDLGAAPGGWSQVASKL
RRMJ_RICRO      ----------WLRRQLNDPYVAKARIDGFRSRAAYKLLEIHEKFKLFTPNMKVVDLGAAPGGWSQVASKL
RRMJ_METMA      ----------------RDYYYHQAKEEGYRSRASFKLKQINEKHNVIKRGDSVVDLGAAPGGWLQVAKQL
RRMJ_RICFE      ----------WLRRQLNDPYVAKARLEGFRSRAAYKLLEIHGKFKLFNPNMKIVDLGAAPGGWSQVASKL
RRMJ_RICCN      ----------WLRRQLNDPYVAKARIDGFRSRAAYKLLEIHEKFKLFTPNMKIVDLGAAPGGWSQVASKL
RRMJ_MESSB      ----------WLERHLNDPYVRRANSEGMRSRAAYKLIEIDDKHHILAPGMKVIDLGAAPGGWCQVAAAS
RRMJ_DESAA      ---------------WRDHYTDKAQKAGFPARSVFKLEEMQKRWKILRPGQKVLDLGCAPGSWLKYASQI
RRMJ_BDEBA      ----------------RDHYFRKAKQENFAARSVFKLEEIDQKFKMFKPGQVVLDLGASPGSWSQYASKM
RRMJ_RICPU      ----------WLRRQLNDPYVAKARIDGFRSRAAYKLLEIHEKFKLFIPNMKIVDLGAAPGGWSQVASKL
RRMJ_RICAE      ----------WLRRQLNDPYVAKARMDGFRSRAAYKLLEIHEKFKLFTPNMKIVDLGAAPGGWSQVASKL
RRMJ_ROSDO      ---RKLSSTRWLQRQLNDPYVKRARSEGYRGRAAYKILELDDRFRFLVPGARVVDLGCAPGGWCQVAVKR
RRMJ_ERYLH      --KRSASSTRWLERQLNDPYVKQAKADGYRSRAAYKLIELDGKFGILKGASRVVDLGIAPGGWAQ-VVRK
RRMJ_NITHX      --KRKLSSKLWLERQLNDPYVAQAKRDGWRSRAAYKLIEMDDKYHFLKPGLAVVDLGAAPGGWSQVAARR
RRMJ_NEOSM      -------SSRWLYRHVNDPFVKKAKAEQYRSRAAYKLLEIDEKFNLIRKGFVVLELGSAPGGWSQVIADI
RRMJ_SILST      ---RRLSSTRWLQRQLNDPYVKRAQAEGYRGRAAFKIMELDDKYRFLVPGARVVDLGCAPGGWAQVAVPR
RRMJ_EHRCR      -------STRWLHRQLNDPYVSLAKKQGYRSRATFKLIEMDSKFSIFKKGQYVLDLGSSPGGWSQFAAQR
RRMJ_SPHWW      ---RSASSIKWIQRQLNDPYVRKAQAEGYRSRAAYKLIELDERFHFLRGAKRVIDLGIAPGGWTQ-VVRR
RRMJ_ANAPZ      ---RKISSTNWIRRQVNDQYVSLAKKEGYRSRSAYKLIEINDKFKILQRGRFVLDLGSSPGGWAQVASKN
RRMJ_PARDP      ---RKLSSTLWLERQLNDPYVARAKREGYRGRAAYKILELDDKYRFLVPGARVVDLGCAPGGWCQVAVAR
RRMJ_METTP      ----------------KDHYYRKAKEEGYRARSAYKLKQINDKFHIIRRGSRVVDLGAAPGGWLQVAREL
RRMJ_SORC5      -----------------DAFTKAAKAQGYPARSVFKLEEIDRRVRLLRPGQRVLDLGAAPGSWSMYAAQR
RRMJ_HALLT      ----------------KDEYYNKSKQQGYRARSAYKLKQIDEEANLFERGDTVVDLGAAPGGWLQXXXXX
RRMJ_METHJ      ----------------KDKAYLKAKQSGYRSRAAMKLKEIIQKNPVIRPDDNILDLGAAPGSWLQVLREM
RRMJ_METTH      ---------RWQAERKRDHYYRSAKKENYRSRASXXXXXXXXXXXXXXXGDRVLDLGAAPGGWSQVALDK
RRMJ_METBU      ----------------RDTYYWRAKDEGYRSRAAYKLFQINEKHEVIKEDDTIVDLGAAPGGWLEVAKKI
RRMJ2_HUMAN     ----------WLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQK
RRMJ_ANAMM      -----------------------AKKHGYRSRSAYKLIDIDCKFKLLQRGRYVLDLGSCPGGWAQVAAER
RRMJ_ANAMF      -----------------------AKKHGYRSRSAYKLIDIDCKFKLLQRGRYVLDLGSCPGGWAQVAAER
RRMJ_METST      --------SRWKAKHDKEHYYKLAKKQNYRSRASYKLKQLDKKYSLLKPDYNVVDLGAAPGGWSQVVAET
RRMJ_DESVV      ---------------YRDHYFLKAKQENYPARSVYKLKEIDNRFKIFRQGMKVLDLGAAPGSWSLGAAEK
RRMJ_DESVH      ---------------YRDHYFLKAKQENYPARSVYKLKEIDNRFKIFRQGMKVLDLGAAPGSWSLGAAEK
RRMJ_CAUSK      ----------WLERQINDPFSAKARALGYRSRAAFKISEIDDKYRFFKKGAKVIDLGCAPGGWLQMATER
RRMJ_HALWD      ----------------RDEYYNRAKQEGYRTRSAYKLQQIDADAGVFGPGNTVIDLGAAPGGWLQVAAEA
RRMJ_WOLPM      -----------------DQYVQKTSKDGYRSRSAYKLVEMDNKFKLFQEGQKIIDLGASPGGWSQVASQK
RRMJ_NOVAD      --KRTASSARWLSRQLNDPYVKKAKAEGWRSRAAFKLIELDEKFGLLKGAKRVVDLGIAPGGWSQ-VVRK
RRMJ_NITMS      ----------------KDHYRKLAHEQGFRSRAAYKLKELNQSYRIIGPGFYVLDLGCAPGGWTQMAIKL
RRMJ_ARCFU      ----------------QDYYYWKAKKEGYRSRAAYKLLQMNRTFKLIREGDLVLDLGATPGGWSQXXXXX
RRMJ_DESVM      ---------------YRDHYFLKAKQENYPARSIYKLKEIDNRFKLFRQGMKVLDLGAAPGSWSLGAAER
RRMJ_UNCMA      ----------------RDHYYNKAKQMGYRSRASFKLQFINKKHHIIKKGDTVVDLGAAPGGWLQVAKEL
RRMJ_DESDG      ---------------YRDHYFLKAKRENYPARSVYKLKEIDKRFGILKQGMRVLDLGAAPGSWSLGAAEK
RRMJ_METB6      ----------------RDKVYLRAKHEGFRSRASYKLIEIQEKFAVIRRDDNIIDLGAAPGSWLQ--VLR
RRMJ_DESAD      -------------KQYRDHYFKRAKKENYPARSVYKLQELDKRFKVFAKGQNVMDLGAAPGSWTLFAAKK
RRMJ_MYXXD      ----------------KDHYFQKAKQEGLRARSAFKVDELIKRFPMVKKGHVVLDLGAAPGGFLQILADA
RRMJ_CAUCR      ----------WLERQINDPFSAKARALGYRSRAAFKISEIDDKFHFFSKGAKVIDLGCAPGGWLQIAVER
RRMJ_ANADF      ----------------KDFYYRKAKKEGLRARSAFKIDEILRRHRLLRKGQAVLDLGAAPGGFLQILADE
RRMJ_METMJ      ----------------KDSVYRKAMKAGYRARAAYKLLEIQQRNGIIRPDDNVVDLGAAPGSWLQVLRDL
RRMJ_META3      ---------RWVMQRKNDFYYKLAKQNHYRSRASYKLLQLNEKFEIIYEGDNVVDLGCAPGGWLQASYDL
RRMJ_LAWIP      ---------------YRDYYFLKAKHEKYPARSIYKLKEIDNRFCLFQKGMSVLDLGASPGSWSLGAAEK
RRMJ_SPHAL      -AKRRSSSTRWLQRQLNDPYVRRAQAEGYRSRAAYKLIELDEKFGLLKKSRAVVDLGIAPGGWSQ-VVRK
RRMJ_METM7      ---------RWVLQRKNDHYYNLAKKRNYRSRATYKLFQLNEKFNLIKERNVVVDLGCAPGGWLQAARDI
RRMJ_JANSC      ---RKLSSTRWLERQLNDPYVXXXXXXXXXXXXXXKIIDLDDKYRFLVPGARVVDLGCAPGGWCQVAVKR
RRMJ_METM5      ---------RWVLQRKNDHYYNLAKKRNYRSRATYKLFQLNEKFNLIKERNVVVDLGCAPGGWLQAARDI
RRMJL_DICDI     ----------WMKRQMTDPYVAMAQKNDLISRAAYKIINIDEQIQLFKPGQIVVDLGAAPGGWSKYIQER
RRMJ_METM6      ---------RWVLQRKNDHYYNLAKKRNYRSRATYKLFQLNEKFNLIKERNVVVDLGCAPGGWLQAARDI
RRMJ_METVS      ---------RWVLQRKKDPYYNLAKRKNYRSRATYKLFQLNEKFNIIKEKNVVVDLGCAPGGWLQAARDM
RRMJ_METMP      ---------RWVLQRKNDHYYNLAKRRNYRSRATYKLFQLNEKFNLIKERNVVVDLGCAPGGWLQAARDI
RRMJ_CENSY      ----------------KDHYRKMAREQGYRSRAAYKLKELNKAYRIIGAGFTVLDLGCAPGSWMQVAASA
RRMJ_METPE      ----------------KDKVYRRAMNEGFRSRAAYKLQEIQERFSIIREDDNIVDLGAAPGSWLQ--VER
RRMJ1_DROME     ---RSKSSQEWLTRQLADPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVER
RRMJ_METS3      --------SRWQMEXXXXXXXXXXXXEDYRSRASYKIKQLDKKFKLIKEGDTVVDLGAAPGGWSQVALEK
RRMJ3_PONAB     ----------------RDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQVAAKF
RRMJ3_HUMAN     ----------------RDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQVAAKF
YBOF_SCHPO      ----------WAAKRSKDFYRKKSKIDNFRSRAAYKLIELNSKYRFINKEDVVIDVGFAPGSWSQVAKKL
RRMJ_PELUB      --KKNRISKNWINKQKRDIYVRQSQVDGYRARSAYKLIEIDEKFKIFKNGISVIDLGASPGSWSQYISRT
RRMJ_METLZ      ----------------KDNVYRKAMRDGYRARSAYKLIDINERFNVIRQTDNVVDLGAAPGSWLQ--VLK
RRMJ3_RAT       ----------------RDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQVAAKF
RRMJ3_MOUSE     ----------------RDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQVAAKF
RRMJ1_HUMAN     ----------------RDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQK
RRMJ_RHOS1      ---RKLSSTLWLERQLNDPYVIRAKKEGYRGRAAYKILELDDKFGFLKPGGRVVDLGCAPGGWCQVAVER
RRMJ_RHOS4      ---RKLSSTLWLERQLNDPYVIRAKKEGYRGRAAYKILELDDKFGFLKPGGRVVDLGCAPGGWCQVAVER
SPB1_SCHPO      -----------------DKWYKLAKEQGYRSRAAFKLVQLNQKYSFLEKAKVIIDLCAAPGGWLQVASKT
RRMJ_DESAH      ------------KNQWADHYTQKARDENYPARSVYKLMEIQKRFQVIKKGASVLDLGCAPGSWLIHAAEL
RRMJ_TREDE      -----------------DYWSKKAFAENYPARSVYKLEEMNKKFNLFSPNDKVLDLGAAPGSWTVYVLRF
SPB1_KLULA      -----------------DKYYYLAKEKGYRARSSFKIIQINEKYHFLEKSKVVIDLCAAPGSWCQVASNL
RRMJ3_CHICK     ----------------RDKFYHLAKETGFRSRSAFKLLQLNRKFQFLQKARALLDLCAAPGGWLQVASKF
SPB1_NEUCR      MAIQKKHGKGRL-----DKWYKLAKEKGYRARAAFKLIQLNKKYGFLEKSKVALDLCAAPGSWCQVCAET
RRMJ_WIGBR      ----------WLSEHYSDKFVKESKKCKYRSRAWFKIDEIQKKNNIIKPGMVVLDIGSSPGGWSKYSSQK
RRMJ_THEVO      ----------------RDEYYWKAKKEQLRSRAAFKLEFLLDRYRVVRKGDAVIEIGSSPGGWTQVLNSL
RRMJ_DESOH      -----------------DHYARKAKTEHYPARSVYKLQEIQKKHNVLKPGNAVLDLGCFPGSWMMFAAET
SPB1_CANGA      -----------------DRYYYLAKEKGYRARSSFKIIQINEKGHFLEKSKVVIDLCAAPGSWCQVASKL
SPB1_MAGGR      MAIQKKHGKGRL-----DKWYKLAKEKGYRARAAFKLIQLNKKYGFLEKSKVLLDLCAAPGSWCQVAAEV
RRMJ3_DICDI     -------------------FYYMAKEQGYRSRAAFKLIQLNKKYNFLGTAKACLDLCAAPGGWMQVASKY
RRMJ_THEAC      ----------------RDQYYWRAKRDQFRSRAAYKLEFLIERYGIIKDGQAVLEIGSSPGGWTQ---VL
SPB1_ASPFU      MAIQKKHGKGRLDKWYR-----LAKEKGYRARAAFKLIQLNKKYGFLEKSKVLLDLCAAPGSWCQVAAEC
SPB1_ASHGO      -----------------DRYYYLAKEKGYRARSSFKIIQINEKGHFLEKSKVVIDLCAAPGSWCQVASNL
SPB1_YEAST      -----------------DRYYYLAKEKGYRARSSFKIIQINEKYHFLEKSKVVIDLCAAPGSWCQVASKL
SPB1_EMENI      MAIQKKHGKGRLDKWYR-----LAKEKGYRARAAFKLVQLNKKYGFLEKSKVLLDLCAAPGSWCQVAAEC
SPB1_YARLI      -----------------DHYYRLAKEKGYRARSSFKIIQINQKYKFLEKSKVVIDLCAAPGSWCQVASQL
SPB1_DEBHA      -----------------DRYYYLAKEKGYRARSSFKIIQINEKYHFLEKSKVVIDLCAAPGSWCQVASQL
SPB1_CANAL      --QQKKHSKGRL-----DRYYYLAKEKGYRARSSFKIIQINEKYHFLEKSKVVIDLCAAPGSWCQVASQL
RRMJ1_DICDI     ----------------RDIYYRKAKEEGWRARSAFKLIQIDEEYQIFEGVKRVVDLCAAPGSWSQVLSRR
RRMJ_BRAHW      ----------------QDFYFKKAKEENYKARSVFKLEEAQNKFKFIKASDNVLDVGCSPGSFSQYMLNK
RRMJ1_CAEEL     ----------------RDIYYRLAKENKWRARSAFKLMQIDDEFQILKGVRRAVDLCAAPGSWSQVLSKR
YEK3_SCHPO      ----------------RDAYYRLAKEQGWRARSAFKLLQLNEQFNLFEGAKRVVDLCAAPGSWSQVLSRE
RRMJ_ANADE      ----------------KDFYYRKAKKQGLRARSAFKIEEILHRHRLLGRGDAVLDLGAAPGGFLQILXXX
SPB1_CRYNE      -----------------DKFYRLAKEQGYRARSAFKLVHLNRKYDLLSKARCCIDLCAAPGGWLQVAEKY
RRMJ_EHRCJ      ---------------------------------------MDNKFSIFKKGQYVLDLGSFPGGWSQFAAQK
TRM7_YEAST      ----------------RDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLVVDLCAAPGSWSQVLSRK
SPB1_USTMA      -----------------DKFYWLAKEQGYRSRAAFKLVQLNKKFNFLEKARCCIDLCAAPGGWLQVASKF
RRMJ_TREPR      -------TSEWYARHVGDSFVRTSKAWGYRARAACKLKRLDAKYGLMSRQCDVLELGSSPGVWSQYISRR
RRMJ2_CAEEL     --KSQGNLHKYIQRQSTDEFAVKAREHNYRARSAFKLIEINEKFKFLKPESTVIDIGCAPGSWLQVVVQK
RRMJ_DESPS      ------------------------------ARSIYKLEEAQKKYDIISRGDSILDLGCFPGSWSIYASEL
RMJ1B_DROME     ----------------RDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKX
RMJ1A_DROME     ----------------RDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGSWSQVLSRK
RRMJ_TREPS      --------------------------------SVYKLAALDKKYSLLSRASRVLDLGAAPGSWTQYVLGX
RRMJ_TREPA      --------------------------------SVYKLAALDKKYSLLSRASRVLDLGAAPGSWTQYVLGX
RRMJ_BORAP      -----------------DEYSQKAKREGYLARSVYKLIEINEKFSLFSYGNV-LDIGASPGSFSQYAYKK
RRMJ_PICTO      ----------------KDKYYIRAKRENYRSRASXXXXXXXXXXXXVSRGDNVLEFGSSPGGWTQ-VIEN
MRM2_YEAST      ---------RWLNRQLKDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTILDLGYAPGAWSQVARQR
RRMJ_BORGA      --------------HLGDEYSQKAKREGYLARSVYKLIEINEKFSLFSSGN-VLDIGASPGSFSQYAYKK
RRMJ_BORRA      -----------------DEYSQKAKNEGYLARSVYKLIEIDKKFSLFSSGNI-LDIGASPGSFSQYAANL
RRMJ_BORDL      -----------------DEYSQKAKNEGYLARSVYKLIEIDKKFSLFSSGNI-LDIGASPGSFSQYAANL
RRMJ_EHRRW      ----------------------------------------------------------------------
RRMJ_EHRRG      ----------------------------------------------------------------------
RRMJ_BORBZ      -----------------DEYSKKAKREGYLARSVYKLIEINEKFSLFSSGN-VLDIGASPGSFSQYAYKK
RRMJ_BORBU      -----------------DEYSKKAKREGYLARSVYKLIEINEKFSLFSSGN-VLDIGASPGSFSQYAYKK
YIKA_SCHPO      ------------------------------------IEKINKEHQLFKPGQIVVDLGCAPGIWSTIAARH
RRMT_XYLFM      ------------------------------SRSALKLEEANEREAKLRPGMQATDLGAAPGGWT-WVLIR
RRMT_XYLFT      ------------------------------SRSALKLEEANEREAKLRPGMCATDLGAAPGGWT-WVL--
RRMT_METCA      ------------------------------SRSTLKLEEVDRPETMLRPGMSAVDLGAAPGGWT------
RRMT_PSEMY      ------------------------------SRSTLKLEEAEQWDQRLAPGMTAVDLGAAPGGWT-W--QL
RRMT_XYLFA      ------------------------------SRSALKLEEANEREAKLRPGMRATDLGAAPGGWT-WVLIR
RRMT_AZOSB      ------------------------------AEAIMTLLSDEERDSLLRAGMRAVDLGAAPGGWT-W---Q
RRMT_ALHEH      ------------------------------------------REAALRPGMSAVDLGAAPGGWT-WVLRQ
RRMT_PSEAE      ------------------------------SRSTLKLEEASEWDKRLAPDMLAVDLGAAPGGWT-W--QL
RRMT_PSEAB      ------------------------------SRSTLKLEEASEWDKRLAPDMLAVDLGAAPGGWT-W--QL
RRMT_PSEA8      ------------------------------SRSTLKLEEASEWDKRLAPDMLAVDLGAAPGGWT-W--QL
RRMT_PSEA7      ------------------------------SRSTLKLEEAQEWDKRLAPDMLAVDLGAAPGGWT-W--QL
RRMT_AZOVD      ------------------------------SRSTLKLEEAEAWDLRLAPGMSAVDLGAAPGGWT-W--QL
RRMT_AZOSE      ------------------------------AEAIFTLLSETERNASLRAGLRAVDLGAAPGGWT-W---Q
RRMT_MARAV      ------------------------------SRSALKLEEADRYLDYLGGGRKAVDLGAAPGGWT-W--QL
RRMT_HALHL      ------------------------------SRSVLKLEEVPENERPY-PGEHAVDLGAAPGGWT-WL---
RRMT_CELJU      ------------------------------SRATLKLEEAWHHDRRLAPGMRAVDLGAAPGGWTWQLVQR
FTSJ1_MOUSE     ----------------------------------------------------------------------
FTSJ1_HUMAN     ----------------------------------------------------------------------
RRMT_SODGM      ------------------------------SRSMLKLEEADEWDERLGSGMYAVDLGACPGGWTYQLVKR
RRMT_MARMS      ------------------------------SRSTLKLEEAQTLEADLTEGMTAVDLGAAPGGWTY---QF
Y1111_HALSA     ----------------------------------------------------------------------
UBIE_THICR      ------------------------------------------------PGNVVLDLAGGTGDLTKAFAKR
RRMT_PECCP      ------------------------------SRSTLKLEEADEWDERLGSGMYAVDLGACPGGWTYQLVKR
RRMT_ERWCT      ------------------------------SRSTLKLEEADEWDERLGSGMYAVDLGACPGGWTYQLVKR


                         .         .         *         .         .         .         .:140
query           VGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIY
RRMJ_NITOC      VGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIY
RRMJ_VIBF1      VGDEGQVIACDILPMDSIAGVSFLQGDFREEAVLDALLERIQPDMVDVVMSDMAPNMSGNLAVDQPRAMY
RRMJ_VIBFM      VGDEGQVIACDILPMDSIAGVSFLQGDFREEAVLDALLERIQPDMVDVVMSDMAPNMSGNLAVDQPRAMY
RRMJ_AZOSB      VGSDGRVLALDILPMDPVPGVDFLQGDFTEDAVLAELESRLAGAAVDLVLSDMAPNLSGVATVDQARSIY
RRMJ_PHOPR      VGDEGQVIACDILSMDSLPGVSFLQGDFREEAVLSALLERIQPDMVDVVLSDMAPNMSGNLASDQPRAMY
RRMJ_VIBCM      VGEGGRVIACDLLPMESIAGVSFLQGDFREEAVLNALLDRIQPDMVDVVMSDMAPNMAGNLSVDQPRAMY
RRMJ_VIBCH      VGEGGRVIACDLLPMESIAGVSFLQGDFREEAVLNALLDRIQPDMVDVVMSDMAPNMAGNLSVDQPRAMY
RRMJ_VIBC3      VGEGGRVIACDLLPMESIAGVSFLQGDFREEAVLNALLDRIQPDMVDVVMSDMAPNMAGNLSVDQPRAMY
RRMJ_VIBVY      VGDSGRVIACDILPMDSIAGVSFLQGDFREDAVLEALLERIQPDMVDVVMSDMAPNIAGNNSVDQPRAMY
RRMJ_VIBVU      VGDSGRVIACDILPMDSIAGVSFLQGDFREDAVLEALLERIQPDMVDVVMSDMAPNIAGNNSVDQPRAMY
RRMJ_LEGPC      MKGSGRLVALDILPMDALPNVEFILGDFREDNVLQELINLIPQRTLDLLLSDMAPNMSGSSAIDIPRAMY
RRMJ_LEGPH      MRGSGRLVALDILPMDALPNVEFILGDFREDNVLQELINLIPQRTLDLLLSDMAPNMSGSSAIDIPRAMY
RRMJ_LEGPA      MRGSGRLVALDILPMDALPNVEFILGDFREDNVLQELINLIPQRTLDLLLSDMAPNMSGSSAIDIPRAMY
RRMJ_METCA      VGASGRVLALDMLPMEPLPGVTVVQGDFLDDAVFHAMLEAIGGRRVDVVLSDMAPNMSGNRNVDQPRSMY
RRMJ_LEGPL      MKGSGRLVALDILPMDALPNVEFILGDFREDNVLQELINLIPQRTLDLLLSDMAPNMSGSSAIDIPRAMY
RRMJ_VIBPA      VGDSGQIIACDLLPMDPIAGVSFLQGDFRDDAVLEALLDRIQPLMVDVVMSDMAPNIAGNNSVDQPRAMY
RRMJ_AERS4      VGDNGRVIACDILPMDPIAGVDFLQGDFREETVLGALLDRVGPDKVDVVMSDMAPNMSGTQQVDQARAMY
RRMJ_PSEHT      VGDKGQVIACDILPMDSLAGVDFLQGDFREEAVLSALLKRIDGKNVDVVLSDMAPNMSGNNSVDQAGSMY
RRMJ_ERWT9      IGSKGRVIACDILPMDPIVGVDFLQGDFREELVLKALLERVGETKVQVVMSDMAPNMTGTPAVDIPRSMY
RRMJ_PHOLL      ISDNGRVIACDLLPMDPIVGVDFLQGDFRDELVLKTLLERVGDNKVQVVMSDMAPNMSGTPAVDIPRSMY
RRMJ_ERWCT      IGGKGRIIACDILPMDPIVGVDFLQGDFRDELVLKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPKSMY
RRMJ_EDWI9      IGDKGRVIACDLLPMDPIVGVDFLQGDFRDELVLAALMERVGDAKVQVVMSDMAPNMSGTPSVDIPRAMY
RRMJ_VIBHB      IGEEGQIIACDLLPMDPIAGVSFLQGDFRDEAVLDALLERIQPSMVDVVMSDMAPNIAGNNSVDQPRAMY
RRMJ_TOLAT      VGPHGRVIACDILPMDPIAGVDFLQGDFREEAVLSALLGRVGEQKVDIILSDMAPNMSGTPAVDQPRSMY
RRMJ_VIBSL      IGDNGQIIACDLLPMDPIAGVSFLQGDFREEAVLDALLERIQPNMVDVVMSDMAPNIAGNNSVDQPRAMY
RRMJ_PROMH      LGNKGRIIACDLLPMDPIVGVDFLQGDFRDELVLKALLDRVGDNKVQVVMSDMAPNMSGTPAVDIPRSMY
RRMJ_AERHH      VGDKGRVIACDILPMDSIAGVDFLQGDFREETVLGALLERVGPDKVDVVMSDMAPNMSGTQQVDQARSMY
RRMJ_THICR      TGDEGRVFALDILPVEPFAGVTFIQGDFQEDDVYQSLLDALDGREVDLVMSDMAPNMTGNKGVDIPRAMY
RRMJ_ACTSZ      IGSKGRIIACDILEMDPIVGVDFLQGDFRDENVLAALLERVGESKVDVVMSDMAPNFSGMPSVDIPRAMY
RRMJ_SHEAM      VGDRGKVIACDILPMDPIVGVDFLQGDFREDAVLNALLERVGDEKVDVVLSDMAPNMSGSDGVDQPRAMY
RRMJ_PECCP      IGGNGRIIACDILPMDPIVGVDFLQGDFRDELVLKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPKSMY
RRMJ_SALAR      IGGRGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SERP5      IGGSGRIIACDILPMDPIVGVDFLQGDFRDELVLKALLERVGESKVQVVMSDMAPNMSGTPAVDIPRSMY
RRMJ_AZOVD      IGDRGRLIASDILPMDSIPDVTFIQGDFTDDAVFALLLEAIGEQPVDLVISDMAPNMSGVKAADQPRAMY
RRMJ_SALPK      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALPA      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_MANSM      IGDKGRIIACDILDMDPIVGVDFLQGDFRDENVLAALLDRVGEDQVDVVMSDMAPNFSGMPSVDIPRAMY
RRMJ_YERE8      IGGKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_SHISS      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SHIFL      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SHIF8      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SHIBS      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SHIB3      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SHELP      AGETGKVIACDILPMDPIVGVDFLQGDFREEKVLNALLERVGDAKVDVVLSDMAPNMSGTGGVDQPRAMY
RRMJ_SALTY      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALSV      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALPB      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALNS      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALHS      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALG2      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALEP      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALDC      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALA4      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ESCF3      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOUT      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOSM      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOSE      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOLU      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOLI      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOLC      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOL6      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOL5      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOK1      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOHS      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECODH      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECOBW      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO8A      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO81      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO7I      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO5E      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO57      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO55      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO45      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO27      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_ECO24      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_CITK8      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SHEPW      AGDKGKVIACDILPMDPIVGVDFLQGDFREEKVLDALLTRVGDAKVDVVLSDMAPNMSGTGGVDQPRAMY
RRMJ_SALTI      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALPC      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SALCH      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_KLEP7      IGNSGRIIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDSKVQVVMSDMAPNMCGTPAVDIPRAMY
RRMJ_ENT38      IGGQGRIIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDSKVQVVMSDMAPNMCGTPAVDIPRSMY
RRMJ_ALISL      VGDSGQVIACDILAMDSIAGVSFLQGDFREEAVLDALLERIQPDMVDVVMSDMAPNMSGNPSVDQPRSMY
RRMJ_YERPY      IGSKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_YERPS      IGSKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_YERPP      IGSKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_YERPN      IGSKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_YERPE      IGSKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_YERPB      IGSKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_YERPA      IGSKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_YERP3      IGSKGRVIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMY
RRMJ_SODGM      IGGKGRIIACDILPMDPMVGVDFLQGDFREPLVLQALLERVGEQKVQVVVSDMAPNMSGTPAVDIPKSMY
RRMJ_KLEP3      IGNSGRIIACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDSKVQVVMSDMAPNMCGTPAVDIPRAMY
RRMJ_SHESW      VGDRGKVIACDILPMDPIVGVDFLQGDFREEKVLEALLTRVGADKVDVVLSDMAPNMSGSDGVDQPRAMY
RRMJ_SHEPC      VGDRGKVIACDILPMDPIVGVDFLQGDFREEKVLEALLTRVGADKVDVVLSDMAPNMSGSDGVDQPRAMY
RRMJ_SHEPA      AGDKGKVIACDILPMDPIVGVDFLQGDFREEKVLDALLTRVGDAKVDVVLSDMAPNMSGTGGVDQPRAMY
RRMJ_PSEAE      IGDRGRLIASDILEMDSIPDVTFIQGDFTEDAVFARILEAIGDHPVDLVISDMAPNMSGVRAADQPRAMY
RRMJ_PSEAB      IGDRGRLIASDILEMDSIPDVTFIQGDFTEDAVFARILEAIGDHPVDLVISDMAPNMSGVRAADQPRAMY
RRMJ_PSEA8      IGDRGRLIASDILEMDSIPDVTFIQGDFTEDAVFARILEAIGDHPVDLVISDMAPNMSGVRAADQPRAMY
RRMJ_HAEDU      IGNQGRIIACDILDMNPIVGVDFLQGDFREVSVLNALLARVGDEMVDVVMSDMAPNFSGMPSVDIPRAMY
RRMJ_SHESH      AGDNGKVIACDILPMDPIVGVDFLQGDFREEKVLDALLTRVGDAKVDVVLSDMAPNMSGTGGVDQPRAMY
RRMJ_PSEA7      IGDRGRLIASDILEMDSIPDVTFIQGDFTEDAVFARILEAIGEHPVDLVISDMAPNMSGVRAADQPRAMY
RRMJ_CELJU      VGTHGRVVASDILPMDTLEGVEFIQGDFTDDSVFNQILLAIGDTPVDLVISDMAPNMSGINAVDQPQAMY
RRMJ_SHEHH      AGDKGKVIACDILPMDPIVGVDFLQGDFREEKVLDALLTRVGDAKVDVVLSDMAPNMSGTGGVDQPRAMY
RRMJ_SHEFN      TGDKGKVIACDILPMDPIVGVDFLQGDFREDKVLQALLERVGQDKVDVVLSDMAPNMSGSGAVDQPRAMY
RRMJ_PSEMY      IGDKGRLIASDILEMDSIPDVTFIQGDFTDDAVFARILEAIGENPVDLVISDMAPNMSGVRAADQPRAMY
RRMJ_PSEF5      IGGQGRLIASDILEMDSIPDVTFIQGDFTEDAVLAQILEAVGNSEVDLVISDMAPNMSGLAAVDMPRAMF
RRMJ_ENTS8      IGGAGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SHEWM      AGDNGKVIACDILPMDPIVGVDFLQGDFREEKVLDALLTRVGDAKVDVVLSDMAPNMSGTGGVDQPRAMY
RRMJ_SHEON      VGDKGKVIACDILPMDPIVGVDFLQGDFREEKVLEALLTRVGADKVDVVLSDMAPNMSGSDGVDQPRAMY
RRMJ_PASMU      IGGAGRIIACDILEMDPIVGVDFLQGDFRDEKVLAALLARVGEGKVDVVMSDMAPNFSGMPSVDIPRAMY
RRMJ_SHESM      TGDKGKVIACDILPMDPIVGVDFLQGDFREEKVLEALLTRVGADKVDVVLSDMAPNMSGSDGVDQPRAMY
RRMJ_SHESA      TGDKGKVIACDILPMDPIVGVDFLQGDFREEKVLEALLTRVGADKVDVVLSDMAPNMSGSDGVDQPRAMY
RRMJ_SHEDO      AGDNGKVIACDILPMDPIVGVDFLQGDFREENVLNALLDRVGEDKVDVVLSDMAPNMSGSDGVDQPRAMY
RRMJ_PSE14      IGGQGRLIASDILEMDSIPDVTFIQGDFTEDKILEQILEAVGNTQVDLVISDMAPNMSGLSAVDMPRAMF
RRMJ_PSEU2      IGGQGRLIASDILEMDSIPDVTFIQGDFTEDAILEQILEAVGNTQVDLVISDMAPNMSGLSAVDMPRAMF
RRMJ_HAES1      IGDLGRVIACDILEMDPIVGVDFLQGDFRDENVLQALLERVGEKKVDVVMSDMAPNFSGMPAVDIPRAMY
RRMJ_SHIDS      IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
RRMJ_SHESR      AGDKGKVIACDILPMDPIVGVDFLQGDFREEKVLEALLTRVGADKVDVVLSDMAPNMSGSDGVDQPRAMY
RRMJ_PSEA6      VGDNGHVIACDILSMDPLPGVDFLMGDFREEAVLDALLNKIGGKNVDVVMSDMAPNMTGNDTADQAKSMY
RRMJ_PSEE4      IGGQGRLIASDILEMDSIPDVTFIQGDFTQDEVLQQILQAVGDSHVDLVISDMAPNMSGTPAVDMPRAMF
RRMJ_XANOR      MGDSGRVVALDILDMPALAGVEFLHGDFREQAVLSQFEAMLGDVPVDLVLSDMAPNKSGMDAVDQPRMMH
RRMJ_XANOP      MGDSGRVVALDILDMPALAGVEFLHGDFREQAVLSQFEAMLGDVPVDLVLSDMAPNKSGMDAVDQPRMMH
RRMJ_XANOM      MGDSGRVVALDILDMPALAGVEFLHGDFREQAVLSQFEAMLGDVPVDLVLSDMAPNKSGMDAVDQPRMMH
RRMJ_PSESM      IGGQGRLIASDILEMDSIPDVTFIQGDFTEDAILEQILEAVGNTQVDLVISDMAPNMSGLSAVDMPRAMF
RRMJ_XANC5      MGDSGRVVALDILDMPALAGVEFLHGDFREQAVLSQFEAMLGDVPVDLVLSDMAPNKSGMDAVDQPRMMH
RRMJ_XANAC      MGDSGRVVALDILDMPALAGVEFLHGDFREQAVLSQFEAMLGDVPVDLVLSDMAPNKSGMDAVDQPRMMH
RRMJ_HAEI8      IGGKGRVIACDILEMDPIVGVDFLQGDFRDENVLNALLERVGEAKVDVVMSDMAPNFSGMPSVDIPRAMY
RRMJ_PSEPW      IGGQGRLIASDILEMDSIPDVTFIQGDFTQDEVLQQILDAVGDSHVDLVISDMAPNMSGTPEVDMPRAMF
RRMJ_HAEPS      IGDKGRVIACDILDMNPIVGVDFLQGDFCEESVLNALLERVGEGKVDVVMSDMAPNFSGMSSVDIPRAMY
RRMJ_PSEFS      IGGQGRLIASDILEMDSIPDVTFVHGDFTQDTVLAQILEAVGNSQVDLVISDMAPNMSGLPAVDMPRAMF
RRMJ_METFK      LAGQGRVIALDILEMPPIPGVEFIQGDFREEEILLVLEKSLNGKPVDLVIADMAPNISGISDVDQARAAY
RRMJ_HAEIN      IGGKGRVIACDILEMDPIVGVDFLQGDFRDENVLNALLARVGEDKVDVVMSDMAPNFSGMPSVDIPRAMY
RRMJ_PSEPK      IGGQGRLIASDILEMDSIADVTFIQGDFTHDEVLQRILEAVGDSHVDLVISDMAPNMSGTPAVDIPRAMF
RRMJ_PSEPG      IGGQGRLIASDILEMDSIADVTFIQGDFTHDEVLQRILEAVGDSHVDLVISDMAPNMSGTPAVDIPRAMF
RRMJ_PSEP1      IGGQGRLIASDILEMDSIADVTFIQGDFTHDEVLQRILEAVGDSHVDLVISDMAPNMSGTPAVDIPRAMF
RRMJ_XANCP      MGASGRVVALDILEMPPLAGVEFLHGDFREQAVLSEFEAMLGDVPVDLVLSDMAPNKSGMDAVDQPRMMH
RRMJ_XANCB      MGASGRVVALDILEMPPLAGVEFLHGDFREQAVLSEFEAMLGDVPVDLVLSDMAPNKSGMDAVDQPRMMH
RRMJ_XANC8      MGASGRVVALDILEMPPLAGVEFLHGDFREQAVLSEFEAMLGDVPVDLVLSDMAPNKSGMDAVDQPRMMH
RRMJ_NITMU      LKGKGRAVALDILEMAPISGVTFIQGDFREASVLAELKEQLKDLPVDLVICDMSPNITGIRVIDQTRGMH
RRMJ_MARAV      VGHKGRVVASDILPMDPIAGVEFIQGDFTEQEVFDQIMAILDGARADVVISDMAPNISGVNAADQAASMY
RRMJ_DICNV      LNGRGRMIALDILPMDALPDVHFIQGDFREETVLNALYDIIGGNYVDLVISDMAPNTSGIKSVDQARSMH
RRMJ_HAHCH      VGDQGKVVACDLLSMDSIAGVTFFQGDFTEDEMLDAILNEVNSRPVDLVISDMAPNMSGMKSVDIPKAMY
RRMJ_XYLFM      MGDRGRVIALDIVKMAPLVGIEFLQGDFRDKAVLSQLEIMLKGQPVDLVLSDMAPNKSGMDAMDQPRMMY
RRMJ_XYLFA      MGDRGRVIALDIVKMAPLVGIEFLQGDFRDKAVLSQLEIMLKGQPVDLVLSDMAPNKSGMDAMDQPRMMY
RRMJ_ALCBS      IGGRGTVIASDILAMDALPDVTFIEGDFREEVIYEQILMALGDQRADLVMSDMAPNMSGNSAVDQPRAMY
RRMJ_ACIBY      VGSKGLVIASDILPMDALPDVTFLQGDFREEAVFEKLLNILNGRQVDIVISDMAPNTSGNRAVDQPRQIY
RRMJ_ACIBT      VGSKGLVIASDILPMDALPDVTFLQGDFREEAVFEKLLNILNGRQVDIVISDMAPNTSGNRAVDQPRQIY
RRMJ_ACIBS      VGSKGLVIASDILPMDALPDVTFLQGDFREEAVFEKLLNILNGRQVDIVISDMAPNTSGNRAVDQPRQIY
RRMJ_ACIBC      VGSKGLVIASDILPMDALPDVTFLQGDFREEAVFEKLLNILNGRQVDIVISDMAPNTSGNRAVDQPRQIY
RRMJ_ACIB5      VGSKGLVIASDILPMDALPDVTFLQGDFREEAVFEKLLNILNGRQVDIVISDMAPNTSGNRAVDQPRQIY
RRMJ_ACIB3      VGSKGLVIASDILPMDALPDVTFLQGDFREEAVFEKLLNILNGRQVDIVISDMAPNTSGNRAVDQPRQIY
RRMJ_ACIAD      VGSKGLVIASDILAMDTLPDVTFLQGDFREEEVFEKLLNILNGRTVDIVISDMAPNTSGNRAVDQPRQIY
RRMJ_SHEB9      AGDRGKVIACDILPMDPIVGVDFLQGDFREDKVLQALLTRVGDAKVDVVLSDMAPNMSGSDSVDQPRAMY
RRMJ_SHEB8      AGDRGKVIACDILPMDPIVGVDFLQGDFREDKVLQALLTRVGDAKVDVVLSDMAPNMSGSDSVDQPRAMY
RRMJ_SHEB5      AGDRGKVIACDILPMDPIVGVDFLQGDFREDKVLQALLTRVGDAKVDVVLSDMAPNMSGSDSVDQPRAMY
RRMJ_SHEB2      AGDRGKVIACDILPMDPIVGVDFLQGDFREDKVLQALLTRVGDAKVDVVLSDMAPNMSGSDSVDQPRAMY
RRMJ_IDILO      FNGDGQIIACDILAMDPIAGVDFLQGDFREESVLEALLERIGGKNVDVVLSDMAPNMSGNGTVDQARSMY
RRMJ_HAMD5      VGLKGKVIALDLLPMDSILGVEFLQGDFREKSILKRLLNCIGDKKIDVVISDMAPNMTGISSVDIPKSMH
RRMJ_CHRVO      VGEKGKVFALDILDMDPVPGVDFIQGDFREEAVLREFEQLLDGRALDLVISDMAPNMSGMSAIDQARSFL
RRMJ_SACD2      VGDGGRVVASDILPMDSLAGVDFVQGDFTXXXXXXXXXXXXXXAKADLVISDMAPNMSGIADVDQPKSMY
RRMJ_COLP3      VGDKGQVVACDILPMDAIVGVDFLEGDFREEEVLDALLTRINGKNIDVVMSDMAANMTGNESADSARSMY
RRMJ_XYLFT      MGDSGRVIALDIVKMAPLVGIEFLQGDFRDKAVLSQLEIMLKGQPVDLVLSDMAPNKSGIDVMDQPRMMY
RRMJ_XYLF2      MGDSGRVIALDIVKMAPLVGIEFLQGDFRDKAVLSQLEIMLKGQPVDLVLSDMAPNKSGIDVMDQPRMMY
RRMJ_THISH      VGKHGRVVASDILPMDPLPGVTIVEGDFXXXXXXXXXXXXXXXXXXDLVMSDMAPNMSGMDAVDQPRAMY
RRMJ_CHRSD      VGDKGCVIASDILEMDALAGVTFVQGDFTEMEVLEQILVALEGRRVDLVMSDMAPNMSGMAAIDQPQAMY
RRMJ_ACTPJ      IGSKGRIIACDILDMNPIVGVDFLQGDFREESVLNALLERXXXXXXXXXXXXXAPNFSGMPSVDIPRAMY
RRMJ_ACTP7      IGSKGRIIACDILDMNPIVGVDFLQGDFREESVLNALLERXXXXXXXXXXXXXAPNFSGMPSVDIPRAMY
RRMJ_ACTP2      IGSKGRIIACDILDMNPIVGVDFLQGDFREESVLNALLERXXXXXXXXXXXXXAPNFSGMPSVDIPRAMY
RRMJ_THIDA      MKRQGRVLAIDLLPVAPLPGVEALQGDFTAPDTLAWLENTLQAARVDLVLSDMAPNMSGVMLRDQARHYE
RRMJ_ALHEH      VGDRGAVFALDILPMEALPGVHVIQGDFTXXXXXXXXXXXXXGRPVDLVLSDMAPNLSGVRVVDQPRAMY
RRMJ_PSEPF      IGGQGRLIASDILEMDSIPDVTFIQGDFTEDAVLAQILEAVGNSQVDLVISDMAPNMSGTPEVDMPKAMF
RRMJ_VESOH      VGKSGQVIANDILNIKPIDGIDFLQGDFTENSVYEALLNLTMNQKVNVVLSDIAPNISGQPSVDIPKSMY
RRMJ_NITEC      VGPTGKVFALDMLDMQSLPGATFIQGDFRENGVLAALEKVLDGKRADLVISDMSPNLTGIRVSDQAHGMY
RRMJ_NEIMF      TGTSGAVFALDILPMEAIGGVSFIQGDFRENDVLAQFEGLLNNRPLDLVICDMAPNMSGNAVSDQARSFY
RRMJ_NEIMB      TGTSGAVFALDILPMEAIGGVSFIQGDFRENDVLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFY
RRMJ_NEIMA      TGTSGAVFALDILPMEAIGGVSFIQGDFRENDVLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFY
RRMJ_NEIM0      TGTSGAVFALDILPMEAIGGVSFIQGDFRENDVLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFY
RRMJ_NEIG1      TGTSGAVFALDILPMEAIGGVSFIQGDFRENDVLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFY
RRMJ_NEIG2      TGTSGTVFALDILPMEAIGGVSFIQGDFRENDVLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFY
RRMJ_BUCAI      IGKKGRIIACDILPIRPITGVDIFQGDFRNKKTLNLMLNTFSNITFHLVMSDMAPNITGNFSIDMPRIIE
RRMJ_PSEU5      VGEKGRVLATDILPMGGLDNVDFVQGDFTEDAVFQQILDMLDGRQPDLIVSDIAPNISGVAAADQAASMY
RRMJ_PSYIN      VGLKGKVIACDILPMDSIAGVDFLQGDFREDAVVNALLARIAGHKVDVVLSDMSPNMTGTVGIDQPKSMY
RRMJ_NITEU      VGPTGKVFALDMLDMQPLPGMTFIQGDFRENEVLAMLEAALGGKRADLVISDMSPNLTGIRVSDQAQGMY
RRMJ_STRM5      IGDTGRVLALDILDMPPLAGVEFLHGDFREETVLSQFEAMLGDQPVDLVLSDMAPNKSGVGAVDQPRMMH
RRMJ_BURCM      LGIDGTIIALDLLPMEPIADVHFIQGDFREDDVLRQLEDVLEGRAVDLVISDMAPNLSGVASADAARIEH
RRMJ_BURA4      LGIDGTIIALDLLPMEPIADVHFIQGDFREDDVLRQLEDVLEGRAVDLVISDMAPNLSGVASADAARIEH
RRMJ_STRMK      IGDTGRVLALDILDMPPLAGVEFLHGDFREEAVLSQFEAMLGDQPVDLVLSDMAPNKSGVGAVDQPRMMH
RRMJ_BURVG      LGIDGTIIALDLLPMEPIADVHFLQGDFREDDVLHQLEGVLEGRPVDLVISDMAPNLSGVASADAARIEH
RRMJ_BURP8      LGIDGTIIALDLLPMEPIADVHFIQGDFREDNVLAQLEEVVGDRDVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURCJ      LGIDGTIVALDILPMEPIADVHFLQGDFREDDVLHQLEEVLEGRAVDLVISDMAPNLSGVASADAARIEH
RRMJ_BURCH      LGIDGTIVALDILPMEPIADVHFLQGDFREDDVLHQLEEVLEGRAVDLVISDMAPNLSGVASADAARIEH
RRMJ_BURCC      LGIDGTIVALDILPMEPIADVHFLQGDFREDDVLHQLEEVLEGRAVDLVISDMAPNLSGVASADAARIEH
RRMJ_BURCA      LGIDGTIVALDILPMEPIADVHFLQGDFREDDVLHQLEEVLEGRAVDLVISDMAPNLSGVASADAARIEH
RRMJ_DECAR      VGDGGLVFALDLLEMEPIHGVHFIQGDFXXXXXXXXXXXXXXXXXVGLVMSDMAPNMSGVPLVDQARIMH
RRMJ_BURS3      LGIDGTIVALDILPMEPIADVHFLQGDFREDEVLHQLEEVLEGRDVDLVISDMAPNLSGVASADAARIEH
RRMJ_BURPS      LGIDGTIIALDMLPMEPVADVHFIQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURP6      LGIDGTIIALDMLPMEPVADVHFIQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURP1      LGIDGTIIALDMLPMEPVADVHFIQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURP0      LGIDGTIIALDMLPMEPVADVHFIQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURMS      LGIDGTIIALDMLPMEPVADVHFIQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURMA      LGIDGTIIALDMLPMEPVADVHFIQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURM9      LGIDGTIIALDMLPMEPVADVHFIQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURM7      LGIDGTIIALDMLPMEPVADVHFIQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEH
RRMJ_HALHL      VGSAGRVVAIDLLEMDPLPGVTFLHADFSTDEGLRAVERALEGRPVDIVLSDMAPNLTGHNAVDQPAAMG
RRMJ_BURM1      LGIDGTIVALDMLPMEPIADVHFIQGDFREDEVLHQLEAVLEGRTVDLVISDMAPNLSGVASADAARIEH
RRMJ_BURTA      LGIDGTIIALDMLPMEPIADVHFIQGDFREETVLHQLEEVLAGRSVDLVISDMAPNLSGVAVADAARIEH
RRMJ_ACIF5      IGRKGRLVAVDRLAMDPVADATVICGDVYDDAILAACQEALPG-GADLIMSDMAPNMSGIASVDQARAID
RRMJ_ACIF2      IGRKGRLVAVDRLAMDPVADATVICGDVYDDAILAACQEALPG-GADLIMSDMAPNMSGIASVDQARAID
RRMJ_PSYCK      VGEKGILIASDILPMDTLPDVTFIQGDFREPEVFDRIMAEVGDRQVDVVLSDMAPNTAGNSAIDQPRMMY
RRMJ_PSYA2      VGEKGILIASDILPMDTLPDVTFIQGDFREPEVFDHIMAEVGDRQVDVVLSDMAPNTAGNSAIDQPRMMY
RRMJ_FRATN      IGKNGKLIALDLLEMAPIAGVEFIQGDFSSDETYQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIY
RRMJ_CUPTR      LADSGAVVAIDLLPMEPVADVTFIQGDFREESVFRELESVVGGNKIDLVLSDMAPNLSGVASADAARIEY
RRMJ_FRATW      IGKNGKLIALDLLEMAPIAGVEFIQGDFSSDETYQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIY
RRMJ_FRATT      IGKNGKLIALDLLEMAPIAGVEFIQGDFSSDETYQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIY
RRMJ_FRATM      IGKNGKLIALDLLEMAPIAGVEFIQGDFSSDETYQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIY
RRMJ_FRAT1      IGKNGKLIALDLLEMAPIAGVEFIQGDFSSDETYQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIY
RRMJ_RALME      LAASGAVVAIDILPMEPVADVTFIQGDFREEEVFRQLEQVVGGSRIDLVISDMAPNLSGVASADAARIEY
RRMJ_RALEH      LADSGAVVAIDLLPMEPVADVTFIQGDFREESVFRELESVVGGNKIDLVLSDMAPNLSGVAFADAARIEY
RRMJ_FRATO      IGKNGKLIALDLLEMAPIAGVEFIQGDFSSDETYQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIY
RRMJ_FRATH      IGKNGKLIALDLLEMAPIAGVEFIQGDFSSDETYQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIY
RRMJ_FRATF      IGKNGKLIALDLLEMAPIAGVEFIQGDFSSDETYQKLNTLVNNQKIDCVISDMAPNLSGNKTSDQAKSIY
RRMJ_COXBR      VGPKGVVIAIDLLPMQSMLDVIFIQGDFNEPEIFNQLEKTLTG-QVDLVISDMAPNISGIKNVDQSRSLH
RRMJ_COXBU      VGPKGVVIAIDLLPMQSMLDVIFIQGDFNEPEIFNQLEKTLTG-QVDLVISDMAPNISGIKNVDQSRSLH
RRMJ_COXBN      VGPKGVVIAIDLLPMQSMLDVIFIQGDFNEPEIFNQLEKTLTG-QVDLVISDMAPNISGIKNVDQSRSLH
RRMJ_COXB2      VGPKGVVIAIDLLPMQSMLDVIFIQGDFNEPEIFNQLEKTLTG-QVDLVISDMAPNISGIKNVDQSRSLH
RRMJ_BURPP      DAERGTIIALDILPMEPIADVTFIQGDFREDTVLGQLEELVGERQVDLVISDMAPNLSGVAVADAARIEH
RRMJ_BURXL      DAERGTIIALDLLPMEPIADVHFIQGDFREDSVIAQLEELVGERQVDLVISDMAPNLSGVAVADAARIEH
RRMJ_RUTMC      VGKSGQVIASDILDIKPIDGVDFLRGDFTKDSVYETLLDITMSKKVDVVLSDMAPNMSGQSSIDIPKSMY
RRMJ_RALEJ      LAASGAVVAIDILPMEPVADVTFIQGDFREEDVFRQLEEVVGGAKIDLVLSDMAPNLSGVASADSARIEY
RRMJ_COXB1      VGPKGVVIAIDLLPIQSMLDVIFIQGDFNEPEIFNQLEKTLTG-QVDLVISDMAPNISGIKNVDQSRSLH
RRMJ_BORPD      LAGPGRIIALDLLPMEPVAGVEFIQGDFRDEAVLQQLQEMVGGQPVSLVISDMAPNLSGVGVADSARIQH
RRMJ_ACIAC      MXXNGTLIALDILPMEPIEGVTFLQGDFREEDVLARLQEAVQARPVDVVVSDMAPNLSGVESVDAVRIAH
RRMJ_BORPE      LAGPGRIIALDLLPMEPVAGVEFIQGDFREEEVLEQLARMVDGQPVDLVISDMAPNLSGVGVADSARIQH
RRMJ_RALPJ      LAASGAIVAIDILPMEAIADVTFIQGDFREDEVFRQLEEIVGGGKVDLVLSDMAPNLSGVASADAARMEH
RRMJ_BORPA      LAGPGRIIALDLLPMEPVAGVEFIQGDFREEAVLEQLARMVEGQPVDLVISDMAPNLSGVGVADSARIQH
RRMJ_BORBR      LAGPGRIIALDLLPMEPVAGVEFIQGDFREEAVLEQLARMVEGQPVDLVISDMAPNLSGVGVADSARIQH
RRMJ_AZOSE      VGREGRVFAXXXXXXXXXXXVEFIQGDFQEEPVLAELESRLGGLPVDVVLSDMAPNMSGIDTTDQARSIY
RRMJ_RALSO      LAASGAIVAIDILPMEPVADVTFIQGDFREESVFQQLETIVGGGKVDLVLSDMAPNLSGVASADAARMEH
RRMJ_VEREI      MAAEGAIIALDILPMEPLEGVTCLHGDFRAPDVQQRLEQALAGRVVDVVVSDMAPNLSGIACADAARMAD
RRMJ_VARPS      MGENGTIIALDILPMEPIEGVTFLQGDFREAELLEQVLGVLAGRKADLVVSDMAPNLSGIHSADAARVAH
RRMJ_BUCAP      IGKKGYILACDILPMKKIKGVDFFQGDFCXXXXXXXXXXXXXXXXXXXXMSDMAPNITGCSSIDMPRIIE
RRMJ_HERAR      LSXXXXXXXLDMLEMEPIADVHYIQGDFREQNVLEQLEVVLAGRKVDLVLSDMAPNLSGIAVADAARMMD
RRMJ_ACISJ      VGQNGVIIALDILPMEPIEGVTFLQGDFREEEVLAGLQEAVQARPVDVVVSDMAPNLSGVESVDAVRIAH
RRMJ_FRAP2      IGNNGKLIALDLLEMAPIAGVEFIQGNFSSDETYERLNQLINDKKIDCVISDMAPNLSGNKTSDQARSIH
RRMJ_POLSJ      LGENGRIIGLDMLPMEPIEGVAFIQGDFREPEVLQKLEQALAGQVVDLVISDMAPNLSGIESADAARIVH
RRMJ_LEPCP      FAPRGRIIALDLLPFEPLEGVAFLQGDFCEEAVLAQLVGLLDGRAVDVVLSDMAPNLSGVEVTDAARIAN
RRMJ_BAUCH      IGKNGHVIACDLRYMSPLSGVDFIQGDFCNKQVLQAILQRLENKKAQVILSDMSPNFSGKPEIDIPKSMY
RRMJ_POLNA      LSPNGRIIGLDLLPMEPIEGVVFIQGDFREPEVLAKLEQALSGPVVDLVISDMAPNLSGIESADAARIAH
RRMJ_JANMA      LGINGTIIGLDMLPMEPIADVHFIQGDFRXXXXXXXXXXXXXGRKVDLVISDMAPNLSGIAVADAARMID
RRMJ_RHOFD      MSPKGTIIALDILPMEPVEGVVFLQGDFRESDVLLQLEAEMKGRQADLVLSDMAPNLSGIDSADAARIEN
RRMJ_MAGSM      AGVEGSVVGIDLLAMDPVPGAEILVGDFLDDAMLAQLQGLLHEGRVDVVLSDMAPNMCGVKSADQLRGEA
RRMJ_DELAS      LSPEGRIISLDLLPMEPIEGVQFILGDFREEPVLAQLQEALGGGKADVVVSDMAPNLSGNGTTDAARIAL
RRMJ_BRASB      VGAKGKVIAIDLLEMGEVPGVTFTQMDFHAQDAPEKLRAMLGG-RADVVMSDMAANTTGHRKTDQLRIVG
RRMJ_METPP      FAPKXRIIALDLLDFEPIEGVQFIQGDFHDEAVLAELSAAIGGRGVDVVVSDMAPNLSGIASSDSARIAL
RRMJ_BRASO      VGAKGKVVAIDLLEMGEIPGVTFAQLDFHAQDAPEKLR-TMIGGRADVVMSDMAANTTGHRKTDQLRIVG
RRMJ_BRAJA      VGSKGKVVAIDLLEMPEIAGVEFAQLDFMDNDAPAKLTAMLGG-GADVVMSDMAANTTGHRKTDQLRIVG
RRMJ_BLOPB      IGKTGRIVACDILSMRNISGVNFLKGDCSNPNISKILYKWVGQKQVNVVLSDMAPNTTGISIIDVSRSIH
RRMJ_BORA1      LAGPGRIIALDLLPMEPIAGVEFFQGDFRDDEVLHELERRVGNHAVDLVISDMAPNLSGVGVADSARIQH
RRMJ_PSYWF      VGDEGILIASDILPMDALENVTFIQGDFREEAVFDRLMSEVGDRQVDVVLSDMAPNTSGHTAVDQPRMIY
RRMJ_RHOPT      VGARGKVVAIDLLEMGEVPGVTFAQLDFLDPSAPERLREMLGG-GADIVMSDMAANTTGHRKTDQLRIVG
RRMJ_RHOPA      VGARGKVVAIDLLEMGEVPGVTFAQLDFLDPSAPERLREMLGG-GADIVMSDMAANTTGHRKTDQLRIVG
RRMJ_BUCBP      VGKKGRVIACDMRPMLPIKDVVFFQGNIKNKCFFNFIETYLCHKKVHVIISDMAPNMTGHYFIDHIQAIL
RRMJ_OLICO      VGARGKVIAIDLLEMGEIPGVTFAQLDFLSDDAPEKLRAMLGG-GADIVMSDMAANTTGHRKTDQLRIVG
RRMJ_NITWN      VGAKGRVIAIDLLEMPEIVGVTFARLDFLDDSAPDKLLAMMDG-AADVVLSDMAANTTGHRKTDQLRIVG
RRMJ_RHOP2      IGSRGKLIAIDLLEMGEIPGVTFAQLDFLDSAAPDKLREMLGGDGADVVMSDMAGNTTGHRKTDQLRIVG
RRMJ_MAGSA      VGAGGKVVGMDILEWDPLPGAITLQGDFLADDAPDRLKEALGG-PADVVLSDMAAPTTGHPSTDHLRIIG
RRMJ_RHOPS      VGARGKVIAIDLLEMGEIPGVTFAQLDFLDDAAPDRLREMLGG-GADVVMSDMAANTTGHRKTDQLRIVG
RRMJ_ACICJ      GASR--VVGIDLLDIDPIAGATLIKGDFQDESMETALAEILGG-PADVVMSDMAPNTTGHTATDHLRIMG
RRMJ_XANP2      IGLEGKIVAIDLLEIEPIPGVAFAQMDFLAPDAPERLIAMLGG-QADLVMSDMAANATGHKKTDHLRIVG
RRMJ_AZOC5      IGAQGKIVAIDLLEMDAVTGVMFAQMDFLDPTAPERLFAMLDG-KADLVMSDMAANTTGHKKTDHLKIIA
RRMJ_RHORT      TPNGGKVVGMDILEWEGVAGATCLTHDFMDDAAPLMLKGAMDG-AVDLVLSDMAAPTTGHRQTDHLRVMG
RRMJ_GRABC      XXXXXXXXXXXXXXXXXXXTL--IQGDFNDDDMPARLSSLMGG-KADLVMSDMAPNTTGHAATDHMRIIA
RRMJ_RHOP5      VGAKGKVVAIDLLEMPEIVGVTFAQLDFLSPAAPEKLLAMIGG-RVDVVMSDMAANTTGHRKTDQLRIVG
RRMJ_BRUSU      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_BRUSI      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_BRUO2      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_BRUME      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_BRUMB      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_BRUC2      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_BRUAB      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_BRUA2      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_BRUA1      VGENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_PARL1      VGRHGRVIGLDYLEMDPVPGATILQLDFLSEGADDQVKELLAG-EADVVLSDMAAPTTGHKQTDHMRIMS
RRMJ_OCHA4      VGENPHVVGIDYLHVDPLPGVVLLEMDFLDDEAPQKLMDAL-GDKPDLVISDMAAPTTGHRRTDHLRTVH
RRMJ_RHILO      TAENPHVVGIDYLEMDAVPGAPVLLMDFLDPDAPQKLAEALGG-NPDVVLSDMAAPTTGHKRTDHIRTMH
RRMJ_BARBK      VESKDSVVGIDYLHMEPLPGVAILEMDFFHEDAPQELISTL-GSKPDVVLSDMAAPTTGHRQTDHLRTIA
RRMJ_RHOPB      VGARGKVVAIDLLEMPEIVGVDFAQLDFLHAEAPAKLLSMIGG-KVDVVLSDMAANTTGHRKTDQLRIVG
RRMJ_POLSQ      LTELGKIIAIDILPMEDIADVSFIQGDFRXXXXXXXXXXXXAEGKVDLVLSDMAPNLSGVGVADSARMAF
RRMJ_RHILW      TGEDIRVAAIDFLEMAQLPGVKILQLDFLDPTAPEKLLEAVGG-TPDLVISDMAAPTTGHHRTDHLRTMH
RRMJ_HALMA      IGERGTLVGVDRQTIDDLPTVEYVRGDMTEDSTKDEIREIVSGGPVDVVISDMAPNMTGQYDLDHARSVH
RRMJ_RHIE6      TGEDIRVAAIDFLEMAQLPGVKILQLDFLDPSAPEKLMEAVGG-TPDLVISDMAAPTTGHHRTDHLRTMH
RRMJ_BART1      VGEKPSVVGIDYLHVDPLPRVAMLEMDFLHADAPQKLIETL-GTKPDVVLSDMAAPTTGHRQTDHLRTIY
RRMJ_BUCCC      IGKSGKIFACDILPMRFLKDIVFFCGDISNSDFLKKIFLFLDKYSWNVVMSDISPNICGYSVIDNSNMFK
RRMJ_BARQU      VGEKPSVVGIDYLPVVPLPGVIMLEMDFLHTDAPQKLIDAL-GTKPDVVLSDMAAPTTGHRQTDYLRTTY
RRMJ_RHIEC      TGEDIRVAAIDFLEMAQLPGVWILQLDFLDPSAPGKLMEAVGG-TPDLVISDMAAPTTGHHRTDHLRTMH
RRMJ_AGRVS      TGSTDRVAAIDFLEMTQLPGVKILQLDFLDPQAPALLMEAVGG-VPDVVISDMAAPTTGHQKTDHIRTMH
RRMJ_RHISN      TNSTDRVAAIDFLEMDPIPGVRFLQLDFLDPEAPEKLKEAIGG-TPDLVLSDMAAPTTGHRQTDHLRTMH
RRMJ_RHIL3      TGSTDRVAAIDFLEMTQLPGVKILQLDFLDPSAPEKLLEAVGG-TPDLVISDMAAPTTGHHRTDHLRTMH
RRMJ_GLUOX      GAKHXXXXXXXXXXXXA--GAEIIEGDFTDPEMPDRLKDMLGG-PADLVMSDMAPNTTGHAATDHMRIMG
RRMJ_BARHE      VGEKPSVVGIDYLHVDPLPGVVMLEMDFLHSDAPQKLIDAL-GTKPDVVLSDMAAPTTGHRQTDHLRTIY
RRMJ_SINMW      TNSTDRVAAIDFLEMDAIPGVSFLQMDFLDPQAPEKLKEAIGG-APDIVLSDMAAPTTGHRQTDHIRTMH
RRMJ_RICAH      ISLNNKIISIDLLEIEPIIGVEFLQKDFFEENTEELIIQVLDG-KADIVMSDMASNTTGHKATDHIRTLL
RRMJ_MARMM      -SGASEVVGIDLLEMEAIAGATLLEKDFTDADAPSLVKAEMGG-AADAVVSDLAPWTTGHKTTDHLRIVA
RRMJ_SYNFM      VGPSGLVVGVDLVEHRFPEGVVVLQGDVTDPELARSL--SVEHGPFDVVLSDMAPSTSGIRVADSARSAL
RRMJ_WOLTR      ---GVKVVAIDIKPVNTISGVKYIQYDINE---LETLRERFKDQKFDVILSDMAPESCGLKSLDHIRIML
RRMJ_HYPNA      GA--AEVVGIDLLPLDPIEGATIIEGDVNNPDDVARMMAGLSG-TPDLILSDMAANTTGHKQTDHLRTVA
RRMJ_RHIME      TNSTDRVAAIDFLEMDPIPGVRFLQMDFLDPEAPENLKQAIGG-APDIVLSDMAAPTTGHRQTDHIRTMH
RRMJ_METAC      SG--GKVLGVDLQRIAPIEGVETIQGDINADSTIKKIIRAVGEKGADVVLCDAAPNLSGNWSYDHARSIE
RRMJ_HALSA      AGARGKVVGVDITQFETDAGLETVRGDMTEDETRQRVRDAANGS-ADVVVSDMAPDMTGEYDLDHARSVH
RRMJ_HALS3      AGARGKVVGVDITQFETDAGLETVRGDMTEDETRQRVRDAANGS-ADVVVSDMAPDMTGEYDLDHARSVH
RRMJ_METBF      SG--GKVLGVDLQRIVPIEGVETIQGNINADSTIQKIIKTVGAKGADVVLCDAAPNLSGNWSYDHARSIE
RRMJ_RICCK      ISLNNKIISIDLLEIRPIVGVEFFQKDFFEEDTEKLIIQALDG-KANIVMSDMASNTIGHKATDHIRTLL
RRMJ_AGRRK      TGSTERVAAIDFLEMAHLPGVTILQLDFLDPDAPQRLVDAVGG-EPDLVMSDMAAPTTGHHRTDHLRTMH
RRMJ_RICPR      INLNNKIISIDLLEIEPIVGVEFLQKDFFEKDTEELIIHNLEG-KADIVMSDMASNTIGHKATDHMRTLL
RRMJ_BLOFL      ISNLGTIVSCDILPMKKIAGVKFLQGDCSNINFLNEIDLKIKHKRAQVVLSDMSPNTTGISTVDVCKSIY
RRMJ_RICTY      INLNNKIISIDLLKIEPIVGVEFLQKDFFEKDTEELIIHGLDG-KADLVMSDMASNTIGHKATDHIRTLL
RRMJ_AGRT5      TEDDIRVAAIDFLEIDPIPGVKILQLDFLDPTAPDQLMEAVGG-TPDLVLSDMAAPTTGHQKTDHIRTMH
RRMJ_METJA      VGDKGFVIGIDLQPVFEYDNVVAIKGDFTLEENLNKIRELIPNKKVDVVISDASPNISGYWDIDHARSID
RRMJ_ZYMMO      KAPQAKIVGIDLLEAAPIEGVTIFQNDFTDPEAQKKLIEALGG-AADLVLSDMAANTIGHAQTDHLRTMA
RRMJ_RICBR      IKAKNKIISVDLLEIEPIPGVESFQKDFFEKDTEELIIQALKG-KADIVLSDMASNTIGHKATDHIRTLL
RRMJ_RICB8      IKAKNKIISVDLLEIEPIPGVESFQKDFFEKDTEELIIQALKG-KADIVLSDMASNTIGHKATDHIRTLL
RRMJ_NATPD      AGEAGTVVGVDLQRIDPIEGVETVRGDMTED-ATREKVRALVG-EADVVISDMAPNMTGEYSLDHARSVH
RRMJ_SILPO      VGERGRVLGIDLQEVEPIAGAEIHQLDFLDDGADDRIKEWLGG-KADVVMSDMAASSSGHKQTDHMRIIA
RRMJ_RICRS      INLNNKIISIDVLEIEHVAGVEFVQKDFFEADTEELIIQALDG-RADIVMSDMASNTIGHKATDHIRTLL
RRMJ_RICRO      INLNNKIISIDVLEIEHVAGVEFVQKDFFEADTEELIIQALDG-RADIVMSDMASNTIGHKATDHIRTLL
RRMJ_METMA      SG--GKVLGVDLQRIDPIEGVETIQGDINAESTXXXXXXXVGEKGADVVLCDAAPNLSGNWSYDHARSIE
RRMJ_RICFE      ISLNNKIISIDLLEIEPIAEVEFFQKDFFEENTEELIIQALDG-KADIVMSDMASNTIGHKATDHIRTLL
RRMJ_RICCN      IKANNKIISIDVLEIEHVAGVEFVQKDFFEADTEELIIQALDGRA-DIVMSDMASNTIGHKATDHIRTLL
RRMJ_MESSB      VKSKPSVVGIDYLEMDPVPGAAVLQMDFLDDAAPDRLIEVLGGS-PDVVLSDMAAPTTGHRRTDHLRTMQ
RRMJ_DESAA      VGDSGRVIGLDLKPMPDKPNAQFIQGDAFEQEFLDEI-----GRDFDVVLSDMAPNTTGIKNVDXXXXXX
RRMJ_BDEBA      AGEKGRVLGVDLSPVVKLKNAVFIQADLRDLNLEDIFKEHGFVPPFDIVMSDMAPKTTGIRMTDQARSME
RRMJ_RICPU      IKANNKIISIDVLEIEHVAGVEFVQKDFFEADTEELIIQALDGRA-DIVMSDMASNTIGHKATDHIRTLL
RRMJ_RICAE      INLNNKIISIDVLEIEHVAGVEFVQKDFFEADTEELIIQALDG-RADIVMSDMASNTIGHKATDHIRTLL
RRMJ_ROSDO      VGERGSVLGVDLQEMEPIAGATLYQLDFMADDADEQVRVWLGG-KADVVMSDMAASSSGHKQTDHLRIIA
RRMJ_ERYLH      VRPKAGIVGIDLLETEPIEGVTILQMDFMADEAPAGLEAALDG-PPDLVMSDMAANTVGHKQTDHLRTMG
RRMJ_NITHX      XXXXXXXXXIDLLEMPEIVGVTFARLDFLDADAPEKLIAMMEG-GADIVLSDMAANTTGHRKTDQLRIIG
RRMJ_NEOSM      LNGTGRLIAVDLADMDPISGVEVVKLDIELQR--KELYEYISGVELDVIVSDLAPSASGSRVTDSISSIR
RRMJ_SILST      IGEKGRFIGIDLQEVEPLAGAEFHQLDFMDEGADDQVKEWLGG-QADVVMSDMAASSSGHKQTDHLRIMS
RRMJ_EHRCR      VSHNNNVFAVDIQNMDAIPNVIFIQCDIINDIEL--LSDKFHNKKFDVILSDMAPKACGNKQVDHANIIN
RRMJ_SPHWW      VCPQAAIVGIDLLPTDPIDGAIILQMDFMSDEAPAQLAEALGG-PADIVLSDMAANTVGHQQTDHLRTMA
RRMJ_ANAPZ      TSTEPTVVAVDIQSMKDIHNVSFVQCDIDSDHDL--LNEKLSGRKFDVVLSDMAPKSCGHRQVDHANIIN
RRMJ_PARDP      VGDKGRVLGVDLQEVDPIPGAEIHQLDFLSEGADEQVKAWLGG-RADVVMSDMAAASSGHKGTDHLRIVA
RRMJ_METTP      SG--GIVVGVDLERIEPLEGIVTIQGDITKEETLEQIAAALGG-QADVVISDAAPNLSGIWDVDHARSID
RRMJ_SORC5      IGAGGKLLAVDLSPITAAFGPQVVQGD-----ALSLTNEALAQAPYDVVLSDMAPATSGSKIADQARSYE
RRMJ_HALLT      XXXXXXXXXXXXXXXXXXXXVETIRGDMTEERTRHYLREAIGERGADVVISDMAPNMTGEYALDHARSVH
RRMJ_METHJ      TN--GVIVGVDLNPILPIEGVRTIIGDFSDPVVIAQIRELMPE--VNGIVCDASPKLSGQRSFDQARAIE
RRMJ_METTH      VGEEGLVVAVDLQRIKGFPAENFIRGDFTDPEVKDKIIRELGGRA-DVVISDAAPSLSGIRDIDHLRSVD
RRMJ_METBU      SG--GKIVGVDLRRIKEIEGVETIKGDITSDETIKKIIELVGEGGADVVICDAAPNLSGNWSLDHARSID
RRMJ2_HUMAN     VNAAGTVLGVDLLHIFPLEGATFLPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLIS
RRMJ_ANAMM      VAEGGKVVAVDMAPMERIPNVDFVQCDVEHSPEL--LRAALQDRKFDVVLSDMAPKSCGHRQVDHANIIN
RRMJ_ANAMF      VAEGGKVVAVDMAPMERIPNVDFVQCDVEHSPEL--LRAALQDRKFDVVLSDMAPKSCGHRQVDHANIIN
RRMJ_METST      IGEKGQIISVDLIKPIDHEAYTGVKGDFETQDIIIELIDGKA----DVVLSDAAPKLTGIKDIDNFRAYD
RRMJ_DESVV      VGPRGRVLACDLTDTVFPDNVTFMQENFERSEAFENLLDEIA--PFDVVISDMAPRTTGTRFTDQARSLE
RRMJ_DESVH      VGPRGRVLACDLTDTVFPDNVTFMQENFERSEAFENLLDEIA--PFDVVISDMAPRTTGTRFTDQARSLE
RRMJ_CAUSK      GVTD--IVGVDLLPVDPVAPAHILEMDFTDPACPPKMLELLGGAP-DLVMSDMAPNTVGHRETDHLRIVG
RRMJ_HALWD      VGPSGTVIGVDFIRDLESDIVDTIRGDMTDESTKNALRKRXXXXXXXXXXXDMAPNMTGEYSVDHARSVH
RRMJ_WOLPM      ---GANVVALDIKPMNAINGVEFIQCDII--NEFEILREKFKDQKFDVILSDMAPESCGLKSLDHIRIML
RRMJ_NOVAD      KAPAAKIVGIDLLPTEPIEGVTIFEMDFMADEAPEALQSALDG-PPDLVLSDMAANTVGHKQTDHLRTMG
RRMJ_NITMS      AGNQGKVMGIDLSYVEEIPGAEILRGDIEDENVVDDVMNYFER-KVNAVICDLSPKVSGNWSVDHAKQIS
RRMJ_ARCFU      XXXXXXX---DINPMKPLENVTFIRGDITLPETLEKIREISPD--YDVVMSDASPKISGKWTIDHLRSID
RRMJ_DESVM      VGPKGRVLACDLTDTQFPPNVTFMQEDV--FNRSEAFEDALAAMPFHVVISDMAPRTTGTRFTDQARSLE
RRMJ_UNCMA      NGG-GKVIGVDLQRIEPIEGVETIKGDMTSPETQARIFEIVDE--VDTVICDAAPNLSGNWALDHARSID
RRMJ_DESDG      IGPSGRVLAADITETVFPPNVTFMQEDVFERS--AEFEQALSETPFDVVISDMAPKTTGHKFTDQARSSN
RRMJ_METB6      TLTDGRVLGIDLNPIADIEGIETLEGDLTDPVVQKQAKEMLG--TVCIVVCDAAPKLSGHKSYDQARAIA
RRMJ_DESAD      VGDTGRVLAVDIQSTDTADNATFLQADVFEDSLLAAMDKQLP---YDLIISDMAPKTTGVKFADQANSLE
RRMJ_MYXXD      VGPKGRVIGVDIVAIFSQPFVQTXXXXXXXXXXXXKLTELHAG-PFDAVISDMAPKTSGIKATDEARSLR
RRMJ_CAUCR      GVTT--LAGIDLLPVDPVAPAHLLEMDFTADGA-PEKXXXXXXXXPDLVMSDMAPNTVGHRETDHLRIVG
RRMJ_ANADF      VGETGVAVGVDLEPVLGKPWVKTAIVDLLSPGALDQIRTLHAG-PFQLVTSDMAPKTIGVKITDEARSLE
RRMJ_METMJ      TD--GRVIGVDLNPIAPMEGVTTIVGDFTDPLVQERIREE-AXXXXXXXXXDASPKLSGQKSYDQARAIG
RRMJ_META3      VGEDGFVIGVDLQKVLREENIVAIQGDMTKKETINKIIDLMPS-KADVVICDASPNISGVWEVDHSRSIE
RRMJ_LAWIP      VGKTGRVVSCDIIPLPS--NVSFFQEDIRSDNIL------IKEGPFHVIMSDMAPQTTGVKITDHSRSLE
RRMJ_SPHAL      ANPRARVAGIDLLPCEPIEGVAILEMDFM-XXXXXXXXXXXXXXXXXXVISDMAANTVGHPQTDHLRTIG
RRMJ_METM7      VGEKGFIVGIDLQTVKPLPNVIAIKGDMTKEEILKQAKDLLPE-KPDVIICDASPNISGVWDVDHARSLE
RRMJ_JANSC      VGEKGRIIGLDLQEMEPIAGCELHQLDFMEDDADLKVKDWLGG-RADVVMSDMAASASGHKQTDHMRIMA
RRMJ_METM5      VGDKGFIVGIDLQTVKPLPNVIAIKGDMTKEEILKQARDLLPE-KPDVIICDASPNISGVWDVDHARSLE
RRMJL_DICDI     VTNRGLVISVDTSSNFQLDKDCFIHGDFETQNKIFELQNLISACYVDVVVSDMAPSYSGLQQVDHSRLID
RRMJ_METM6      VGDKGFIVGIDLQTVKPLPNVIAIKGDMTKEEILKQARDLLPE-KPDVIICDASPNISGVWDVDHARSLE
RRMJ_METVS      TGEEGFIVGIDLQQIKPLPNVIAVKGDMTDEETLKKIQDILPE-KPDVIICDASPNISGVWDVDHTRSLE
RRMJ_METMP      VGEDGFIVGIDLQTVKPLPNIIAIKGDMTKEEILKQAKDLLPE-KPDVIICDASPNISGVWDVDHVRSLE
RRMJ_CENSY      AGNRGTVLGVDLEYAEELNHAESMRGDV-EDESLAETVAERLG-RADAVICDLSPQVSGNWSVDHARQIS
RRMJ_METPE      TLTKGKVLGVDLNPIPSIDGVMTVVGDLTTSEV--QQQXXXXXXXXXXXLCDASPKLSGHKCYDQARAIG
RRMJ1_DROME     TNANGKVFSIDLLHFHAVPGATIFGGDFTSSLAQKRLREALQDRKVNCVLSDMAPNATGVRMLDQESITN
RRMJ_METS3      VGEEGLVIGVDLNRIKPFPEENFIRGDFTTTEVQEKVMNLIGG-KAKVVISDASPSLCGIKNIDQLRSID
RRMJ3_PONAB     MPVSSLIVGVDLVPIKPLPNVVTLQEDITTERCRQALRKELKTWKVDVVLNDGAPNVGASWVHDAYSQAH
RRMJ3_HUMAN     MPVSSLIVGVDLVPIKPLPNVVTLQEDITTERCRQALRKELKTWKVDVVLNDGAPNVGASWVHDAYSQAH
YBOF_SCHPO      VGNKGKVIGIDIQHIAPPEGVLPIYGDIRDPNTLTKLTNDSIDCVVDAVISDMLHKATGIRIRDHALSME
RRMJ_PELUB      V-KSGRLVSIDLKGMEEIENTIQIKGDF-TDLESQEKIKALFKSKVDVVVSDMAVNTTGIKDID---AIY
RRMJ_METLZ      TMTEGQLCGVDLNPIIPLENVITITGDFTDPAIQAKIREAMP--LVNVVVCDASPHLSGAKAYDQARVMG
RRMJ3_RAT       MPVSSLIVGVDLVPIKPLPNVVTLQEDITTERCRQALRKELKTWKVDVVLNDGAPNVGASWVHDAYSQAH
RRMJ3_MOUSE     MPVSSLIVGVDLVPIKPLPNVVTLQEDITTERCRQALRKELKTWKVDVVLNDGAPNVGASWVHDAYSQAH
RRMJ1_HUMAN     IGGQGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMXXX
RRMJ_RHOS1      VGQRGTVLGVDLQEVEPISGAEIHQLDFLSDDADEKVKGWLGG-RXXXXXXXXXXXXXGHKGTDHLRIIA
RRMJ_RHOS4      VNPEGTVLGVDLQEVEPISGAEIHQLDFLSDDADEKVKGWLGG-RXXXXXXXXXXXXXGHKGTDHLRIIA
SPB1_SCHPO      CKPGSLIVGVDLAPIKPIPNCHTFVEDITSDKCRSQLRGYLKTWKADVVLHDGAPNVGSAWLQDAYGQAQ
RRMJ_DESAH      TGPSGRAVGIDLKPVDAAPNAIAHTGD------IFEMESTLGEAVYDAVISDMAPATTGRKDIDAARSFA
RRMJ_TREDE      LNKEGRVTAVDLKPLDSSERLNFFQGDMFDKGIIKSVKELGP---YDAVICDAAPATTGNKTVDTARSSG
SPB1_KLULA      CPVNSLIIGVDIVPMKTMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDGAPNVGLSWAQDAFTQSH
RRMJ3_CHICK     MPVSSLVIGVDLVPIKPIPNVVTLQEDITTEKCRQALRKELQTWKVDVVLNDGAPNVGASWVHDAYSQAN
SPB1_NEUCR      MPTNSIIIGVDLAPIKPIPKVITFQSDITTEKCRATIRSHLKTWKADVVLHDGAPNVGTAWVQDSYNQAE
RRMJ_WIGBR      VGMSGKVIACDIDLMNPIPNVSFILGNIFEXXXXXXXXXXXXXXXXXL--CDISPNITGLSIIDHSRWIS
RRMJ_THEVO      AR---KIISIDLQEMEEIAGVRFIRCDIFKETIFDDIDRALREEKVDDVVSDAMAKVSGIPSRDHAVSYQ
RRMJ_DESOH      VGRGGKVTGIDLKKVATHMPAQSLQEDIYEID-----REALAGTLLDVVLSDMAPDTMGNKFTDXXXXXX
SPB1_CANGA      CPVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSRLRGYMKTWKADTVLHDGAPNVGLGWAQDAFTQSH
SPB1_MAGGR      MPVSSLIVGVDLAPIKPIPKVITFQSDITTEKCRATIRQHLKTWKADTVLHDGAPNVGTAWVQDSFNQAE
RRMJ3_DICDI     MPVQSLIVGVDLVPIRQVRNCIGLTEDITTQKCRTEIKKALKTWKVDVCLHDGAPNMGTSWVQDAYQQAE
RRMJ_THEAC      VDHGCRVVAVDIQPMDEIPGVIFLKLNILREDAAERIREEMARSLVDVVLSDAMAKTSGIRSSDHAASVM
SPB1_ASPFU      MPTQSIIIGVDLAPIKPIPRVITFQSDITTEKCRATIRQHLKHWKADTVLHDGAPNVGTAWVQDAFSQAE
SPB1_ASHGO      CPVNSLIIGVDIVPMQPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDGAPNVGLNWVQDAFTQSH
SPB1_YEAST      CPVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDGAPNVGLGWVQDAFTQSQ
SPB1_EMENI      MPAQSLIVGVDLAPIKPIPRVITFQQDITTEKCRATIRSHLKHWKADTVLHDGAPNVGTAWVQDAFSQAE
SPB1_YARLI      CPVNSLIIGCDIVPIKPLPNVITFQSDITTDHCRQQLRQYMKTWKADTVMHDGAPNVGMAWAQDAFTQSE
SPB1_DEBHA      CPINSLIIGVDIVPIKALPNCITFQSDITTEDCRSQLRGHMKTWKADTVLHDGAPNVGLGWVQDAFTQSH
SPB1_CANAL      CPINSLIIGVDIVPIKPLPNVITFQSDITTEDCRSRLRGHMKTWKADTVLHDGAPNVGLGWVQDAFTQSQ
RRMJ1_DICDI     IYGDGKIVAVDLQEMAPLKGVVQIKGDITKYETSKQIISHFDGSLADLIISDGAPDVTGLHDIDFYGQSQ
RRMJ_BRAHW      ILKSGSVVGVDILPSFAHQRFTFILGDIKDMDV-----TTFNNTLFDVVVSDAMPNTTSDRETNHFRSIS
RRMJ1_CAEEL     LYEEAKIVAIDLQPMAPIPGVIQLQGDITSVDTANQVIKHFSGEKSDIVICDGAPDVTGIHSLDEFMQAE
YEK3_SCHPO      LDEKPMIVAVDLQPMAPIDGVCTLQLDITHPNTLSIILSHFGNEPADLVVSDGAPDVTGLHDLDEYIQAQ
RRMJ_ANADE      XXXXXXXXXXDLEPIRNL-GKRWVRTDLLAPDALDKIRLLHDGRF-RLVTSDMAPKTIGIKVTDEARSLE
SPB1_CRYNE      MPKGSLIIGVDLNAIKPLPHVTTFVADITTPHCRQTLRQHMHDWKADLVLHDGAPNVGSAWVQDAFTQNE
RRMJ_EHRCJ      VGNNNLVFSVDIQNMDAIPNVIFIKCDI--SNEIEILNDKFHNKKFDVILSDMAPKACGNKQVDHANIIN
TRM7_YEAST      LFDESKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQ
SPB1_USTMA      MPANSLIVGVDLVPIKPIPRTITFAEDINSYKCRDQLRQILKDWKADIVIHDGAPNVGTAWVQDAYAQSE
RRMJ_TREPR      VGMAWRTVSVDTRAMVRVRGVSFIHGDITEAETMAEVSSRLPS-GVGLILSDICPHPSCERYLDSIATAK
RRMJ2_CAEEL     C-PNGYASGVDLQNVLPIRGADILSSDITDPAVKLKIREKLAHRQVDVVLSDMAPNPTGDNATDHLRLIE
RRMJ_DESPS      AGPKGIVVGVDLQQAVGAAPIHWICEDIREPAMLEAVRRIRPSFRV--LISDMAPKTTGNRWTDAQQSLN
RMJ1B_DROME     XXXKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGMHDFD---SYV
RMJ1A_DROME     LYDAVKIIAVDLQAMAPIRGILQLQGDITKQSTAEAIIGHFGGNKAQLVVCDGAPDVTGVHEMDEYMQHQ
RRMJ_TREPS      XXXXXXXXXXDVQPIASDARLQRVQGDLCAADTRARVA---CNAPFDLILSDAAPRTTGNRTVDTSASAC
RRMJ_TREPA      XXXXXXXXXXDVQPIASDARLQRVQGDLCAADTRARVA---CNAPFDLILSDAAPRTTGNRTVDTSASAC
RRMJ_BORAP      L-KRGILVAVDIIGLRHVDNFYFVKGDIFSDDTVFKI-NTLGP--YSLVISDAAPRTTGNRLVDTSNSFN
RRMJ_PICTO      I-TQSVIIAVDINRMDPVKNTVFIKMNIFDDDIFKSIDHAMAENNIDSILSDAMSRTSGIEDRDHYNSYK
MRM2_YEAST      SSPNSMILGVDILPCEPPHGVNSIQA-----NILAKRTHDL--------------NTSGVSIRDHYQSID
RRMJ_BORGA      L-KRGVLVSVDIISLRYVNNFYFIKGDIFSDDTASKINKF---GPYSLVISDVAPKTTGNRLVDTSNSFN
RRMJ_BORRA      KXXXXXXXXXXXXXXXFTSNFYFIKGNIYLDEVYQKIK---IFSPYSLIVSDAAPSTTGNRLVDTSNSFN
RRMJ_BORDL      KXXXXXXXXXXXXXXXFTSNFYFIKGNIYLDEVYQKIK---IFSPYSLIVSDAAPSTTGNRLVDTSNSFN
RRMJ_EHRRW      --------------MSSIPNVIFILCDIA--NKIELLNSTFDKKKFDVVLSDMAPKACGNKQVDHANIIN
RRMJ_EHRRG      --------------MSSIPNVIFILCDIA--NNIELLNSTFDKKKFDVVLSDMAPKACGNKQVDHANIIN
RRMJ_BORBZ      L-KRGILVSVDIIGLRYDDNFYFIKGDIFLDDTVFKI-NTFK--PYSLVISDVAPKTTGNRLVDTSNSFN
RRMJ_BORBU      L-KRGILVSVDIIGLRYDDNFYFIKGDIFLDDTVFKI-NTFK--PYSLVISDVAPKTTGNRLVDTSNSFN
YIKA_SCHPO      VGLFGRVIACDIIPCRLPENSSMIQGNFRNQSVFEEERDTIEDLSADVIMSDLGPTNEHLAVKDELDSLY
RRMT_XYLFM      --QHLRVTSIDNAPLLNHPLVQHVRAD-------------------------------------------
RRMT_XYLFT      ICQHLRVTSIDNAPLLNHPLVQHVRAD-------------------------------------------
RRMT_METCA      ----------------------------------------------------------------------
RRMT_PSEMY      VNREIRVTAVDNGPM-------------------------------------------------------
RRMT_XYLFA      QHLRVTSIDNAVLSLLNHPLVQHVRAD-------------------------------------------
RRMT_AZOSB      LAQRGRVTAIDNGPL-------------------------------------------------------
RRMT_ALHEH      AGL--HVTAVDNGPLAESLRADRAVRHLREDGFRYRPPHRVDWLVCDMV---------------------
RRMT_PSEAE      VNREMRVTAVDNGPM-------------------------------------------------------
RRMT_PSEAB      VNREMRVTAVDNGPM-------------------------------------------------------
RRMT_PSEA8      VNREMRVTAVDNGPM-------------------------------------------------------
RRMT_PSEA7      VNREMRVTAVDNGPM-------------------------------------------------------
RRMT_AZOVD      VNRHMKVTAVDNGPM-------------------------------------------------------
RRMT_AZOSE      LAHRGRVTAVDNGPMAPSVMATEMVEHVRADGFTWRPQRPVEWMVCDMV---------------------
RRMT_MARAV      VQQGMMVTAVDNGPM-------------------------------------------------------
RRMT_HALHL      LRERGTVTAIDNGPLAPAPGVEHQRTD-------------------------------------------
RRMT_CELJU      ----------------------------------------------------------------------
FTSJ1_MOUSE     -------------------------GDIMTLKYLTGLQDFLSGMSIHLVTADGSFDCQGNPGEQEALVSS
FTSJ1_HUMAN     -------------------------GDIMTLKFLTGLQNFISSATVHLVTADGSFDCQGNPGEQEALVSS
RRMT_SODGM      ----------------------------------------------------------------------
RRMT_MARMS      VKKGINVIAIDNGPM-------------------------------------------------------
Y1111_HALSA     --------------------------------------------LIDGVMDNRVPSLVTVNKVDLIEPSY
UBIE_THICR      VGKTGRVVLADI----------------------------------------------------------
RRMT_PECCP      ----------------------------------------------------------------------
RRMT_ERWCT      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVARRSRKDNG
RRMJ_NITOC      LGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVARRSRKDNG
RRMJ_VIBF1      LVELALDMCRQVLAPNGSFTVKVFQGEGFDQYLQEVRNMFKVVKIRKPDSSRARSREVYIVA--------
RRMJ_VIBFM      LVELALDMCRQVLAPNGSFTVKVFQGEGFDQYLQEVRNMFKVVKIRKPDSSRARSREVYIVA--------
RRMJ_AZOSB      LCELALDFARRHLKPGGQFLVKVFQGEGFMGFRKAMDEVFLSVQVRKPKASRDRSAEVYLL---------
RRMJ_PHOPR      LVELALEMCKQVLAPNGSFAVKVFQGEGFDQYLAEIRNMFKVVKIRKPDSSRDRSREVYIVA--------
RRMJ_VIBCM      LVELALDMCRQVLAPNGSFVVKVFQGEGFDDYVKAVRDLFKVVKIRKPDSSRSRSREVFIVA--------
RRMJ_VIBCH      LVELALDMCRQVLAPNGSFVVKVFQGEGFDDYVKAVRDLFKVVKIRKPDSSRSRSREVFIVA--------
RRMJ_VIBC3      LVELALDMCRQVLAPNGSFVVKVFQGEGFDDYVKAVRDLFKVVKIRKPDSSRSRSREVFIVA--------
RRMJ_VIBVY      LVELALDMCRQVLAPNGSFVVKVFQGEGFDEYVKEVRNMFKVVKIRKPDSSRARSREVFVVA--------
RRMJ_VIBVU      LVELALDMCRQVLAPNGSFVVKVFQGEGFDEYVKEVRNMFKVVKIRKPDSSRARSREVFVVA--------
RRMJ_LEGPC      LVELAFDFAEKMLKPGGNMLVKIFHGSGFDELVKQARASFEKVVIRKPSASRSRSKETYLLAK-------
RRMJ_LEGPH      LVELAFDFAEKMLKPGGNMLVKIFHGSGFDELVKQARASFEKVVIRKPSASRSRSKETYLLAK-------
RRMJ_LEGPA      LVELAFDFAEKMLKPGGNMLVKIFHGSGFDELVKQARASFEKVVIRKPSASRSRSKETYLLAK-------
RRMJ_METCA      LAELAFDLAERVLGPKGSFVVKLFQGEGFQEYVARARKAFGSVGMRKPKASRARSAEIYLVGKGYR----
RRMJ_LEGPL      LVELAFDFAEKMLKPGGNMLVKIFHGSGFDELVKQARASFEKVVIRKPSASRSRSKETYLLAK-------
RRMJ_VIBPA      LVELALDMCRQVLAPNGSFVVKVFQGEGFDQYVKEVRDMFKVVKIRKPDSSRARSREVFVVA--------
RRMJ_AERS4      LIELALDMCNQVLRTNGSFVVKVFQGEGFDAYLNEIRKLFSAVKIRKPDSSRARSREVYIVA--------
RRMJ_PSEHT      LVELALDMCNQVLKKNGAFIVKVFQGEGFDQFLQDVRNSFKTVKIRKPDASRARSREVYIVA--------
RRMJ_ERWT9      LCELALAMCRDVLAPGGSFLVKVFQGDGFEEYLREIRSLFTKVKIRKPDASRSRSREVYIVA--------
RRMJ_PHOLL      LVELALDMCRDVLAPEGSFIVKVFQGEGFDEYLREIRSLFTNVKIRKPDASRARSREVYIVA--------
RRMJ_ERWCT      LVELALGMCRDVLAPGGSFLVKVFQGEGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_EDWI9      LVELAFEMAKDVLAPGGSFVVKVFQGEGFDEYLGQIRSLFTKVKIRKPEASRARSREVYIVA--------
RRMJ_VIBHB      LVELALDMCRQVLAPNGSFVVKVFQGEGFDQFVKEVRDMFKVVKIRKPDSSRARSREVFVVA--------
RRMJ_TOLAT      LVELALEMCKQVLAAKGSFVVKVFQGAGFEEYLKEVRSLFSVVKIRKPDSSRSRSREVYIVA--------
RRMJ_VIBSL      LVELALDMCRQVLATNGSFVVKVFQGEGFDQYVKDVREMFKTVKVRKPDSSRARSREVFIVA--------
RRMJ_PROMH      LVELALDMCRDVLAPGGSFIVKVFQGEGFDEYLGQIRSLFTKVKVRKPDASRSRSREVYIVA--------
RRMJ_AERHH      LVELALDMCNQVLRANGSFVVKVFQGEGFDIYLNEIRKLFTAVKIRKPDSSRARSREVYIVA--------
RRMJ_THICR      LVELCVDLADQVLKPNGDLLMKVFQGEGYDQLLKSLREKYQKVLTRKPKASRPRSKEIYLLAR-------
RRMJ_ACTSZ      LVELALDMCKQVLTANGSFVVKVFQGEGFDEYLREIRSLFKVVKVRKPEASRGRSREVYIVA--------
RRMJ_SHEAM      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVREAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_PECCP      LVELALGMCRDVLAPGGSFLVKVFQGEGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_SALAR      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SERP5      LVELALGMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_AZOVD      LCELALDLAGRVLRPGGDFLIKIFQGEGFDQYLRQVREGFDKVQMRKPLSSRDRSREQYLLARGFR----
RRMJ_SALPK      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKIRKPDSSRARSREVYIVA--------
RRMJ_SALPA      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKIRKPDSSRARSREVYIVA--------
RRMJ_MANSM      LVELALDMCKQVLAKKGSFVVKVFQGEGFDEYLREIRSLFTTVKVRKPEASRDRSREVYIVA--------
RRMJ_YERE8      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_SHISS      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHIFL      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHIF8      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHIBS      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHIB3      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHELP      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVREAFTTVKTRKPDSSRPRSREVYLVA--------
RRMJ_SALTY      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALSV      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALPB      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALNS      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALHS      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALG2      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALEP      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALDC      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALA4      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ESCF3      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOUT      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOSM      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOSE      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOLU      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOLI      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOLC      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOL6      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOL5      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOK1      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOHS      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECODH      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECOBW      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO8A      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO81      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO7I      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO5E      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO57      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO55      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO45      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO27      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ECO24      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_CITK8      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHEPW      LVELALDMCHQVLAPNGCFAVKVFQGEGFDEYMKAVKEAFKTVKTRKPDSSRPRSREVYLVA--------
RRMJ_SALTI      LVELALDMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALPC      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SALCH      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_KLEP7      LVELALEMSRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_ENT38      LVELALEMSRDVLAPGGSFVVKVFQGEGFEEYLKEIRSLFAKVKVRKPDSSRARSREVYIVA--------
RRMJ_ALISL      LVELALDMCRQVLAPNGSFTVKVFQGESFDAYLQEXXXXXXXXXXXXPDSSRARSREVYIVA--------
RRMJ_YERPY      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_YERPS      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_YERPP      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_YERPN      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_YERPE      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_YERPB      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_YERPA      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_YERP3      LVELALDMCRDVLAPGGSFLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_SODGM      LVELALDMCRDVLAPGGNFLVKVFQGEGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVA--------
RRMJ_KLEP3      LVELALEMSRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHESW      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVKEAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_SHEPC      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVKEAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_SHEPA      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVKEAFKTVKTRKPDSSRPRSREVYLVA--------
RRMJ_PSEAE      LCELALDLAGRVLRPGGDFLIKIFQGEGFDQYHKQAREMFDKVQMRKPLSSRDRSREQYLLARGFR----
RRMJ_PSEAB      LCELALDLAGRVLRPGGDFLIKIFQGEGFDQYHKQAREMFDKVQMRKPLSSRDRSREQYLLARGFR----
RRMJ_PSEA8      LCELALDLAGRVLRPGGDFLIKIFQGEGFDQYHKQAREMFDKVQMRKPLSSRDRSREQYLLARGFR----
RRMJ_HAEDU      LVELALDMCRQVLAPKGSFVVKVFQGEGFDDYLRDIRSMFTTVKVRKPEASRDRSREVYIVA--------
RRMJ_SHESH      LVELALDMCHQVLAPNGCFAVKVFQGEGFEEYMKSVREAFKTVKTRKPDSSRARSREVYLVA--------
RRMJ_PSEA7      LCELALDLAGRVLRPGGDFLIKIFQGEGFDQYHKQAREMFDKVQMRKPLSSRDRSREQYLLARGFR----
RRMJ_CELJU      LVELALDMAKRVLKPQGNFVAKVFHGEGYDQYLKDLKGCFEKVVIRKPDASRSRSREVYVVGK-------
RRMJ_SHEHH      LVELALDMCHQVLAPNGCFAVKVFQGEGFDEYMKAVKEAFKTVKTRKPDSSRPRSREVYLVA--------
RRMJ_SHEFN      LVELALDMCHQVLTPNGCFAVKVFQGEGFDDYIKTVKQAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_PSEMY      LCELALDLAGRVLRPGGDFLIKIFQGEGFDTYHRQVRDSFDKVQMRKPLSSRDRSREQYLLARGFR----
RRMJ_PSEF5      LCELALDLAGRVLRPGGDFLIKIFQGEGFDEYHKSVRQMFEKVQMRKPSSSRDRSREQYLLGRGFR----
RRMJ_ENTS8      LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHEWM      LVELALDMCHQVLAPNGCFAVKVFQGEGFEEYMKSVREAFKTVKTRKPDSSRPRSREVYLVA--------
RRMJ_SHEON      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVKEAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_PASMU      LVELALDMCKQVLATKGSFVVKVFQGEGFDEYLREIRSLFSVVKVRKPEASRGRSREVYIVA--------
RRMJ_SHESM      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVKDAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_SHESA      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVKDAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_SHEDO      LVELALEMCHQVLAPNGCFAVKVFQGEGFDEYIKSVKQAFKTVKTRKPDSSRARSREVYLVA--------
RRMJ_PSE14      LCELALDLAGRVLRPGGDFLIKVFQGEGFDVYHKDIRKLFDKVQMRKPSSSRDRSREQYLLARGFRGIDG
RRMJ_PSEU2      LCELALDLAGRVLRPGGDFLIKVFQGEGFDVYHKDIRKLFDKVQMRKPSSSRDRSREQYLLARGFRGIDG
RRMJ_HAES1      LVELALDMCKQVLATNGCFVVKVFQGEGFDDYLKEIRSLFNTVKVRKPEASRGRSREVYIVA--------
RRMJ_SHIDS      LVELALEMCRDVLALGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
RRMJ_SHESR      LVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVKEAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_PSEA6      LVELSLDMCRQVLKKNGSYTVKVFMGEGFDQFFNEVKNAFKVVKTRKPDSSRARSREVYLVA--------
RRMJ_PSEE4      LCELALDLATRVLKPGGDFLIKIFQGEGFDMYLKDVRSKFDKVQMRKPSSSRDRSREQYLLGK-------
RRMJ_XANOR      LAELAMEFADAHLKPGGAFLIKLFQGVGSDDYIRELRRRYEKVTIRKPAASRKRSPEVYALGQGKR----
RRMJ_XANOP      LAELAMEFADAHLKPGGAFLIKLFQGVGSDDYIRELRRRYEKVTIRKPAASRKRSPEVYALGQGKR----
RRMJ_XANOM      LAELAMEFADAHLKPGGAFLIKLFQGVGSDDYIRELRRRYEKVTIRKPAASRKRSPEVYALGQGKR----
RRMJ_PSESM      LCELALDLAGRVLRPGGDFLIKVFQGEGFDIYHKDIRKLFDKVQMRKPSSSRDRSREQYLLARGFRGIDG
RRMJ_XANC5      LAELAMEFADTHLKPGGAFLIKLFQGVGSDDYIRELRRRYEKVTIRKPAASRKRSPEVYALGQGKR----
RRMJ_XANAC      LAELAMEFADTHLKPGGAFLIKLFQGVGSDDYIRELRRRYEKVTIRKPAASRKRSPEVYALGQGKR----
RRMJ_HAEI8      LVELALDMCKQVLASKGSFVVKVFQGEGFDEYLREIRSLFNVVKVRKPEASRGRSREVYIVA--------
RRMJ_PSEPW      LCELALDLATRVLKPGGDFLIKIFQGEGFDMYLKDVRTKFDKVQMRKPSSSRDRSREQYLLGK-------
RRMJ_HAEPS      LVELALDMCRQVLAPKGSFVVKVFQGEGFDDYLREIRSLFNVVKVRKPEASRDRSREVYIVA--------
RRMJ_PSEFS      LCELALDLAGRVLRPGGDFLVKVFQGEGFDEYHKNIRKLFDKVQTRKPDSSRDRSREQYLLCRGFRGVEG
RRMJ_METFK      LVELALEFSREWLKPGGNFLVKVFVGSGFDEIVMAMRDSFEKVVTRKPKASRDRSSEVYLLGLKRR----
RRMJ_HAEIN      LVELALDMCKQVLASKGSFVVKVFQGEGFDEYLREIRSLFDVVKVRKPEASRGRSREVYIVA--------
RRMJ_PSEPK      LCELALDLATRVLKPGGDFLIKIFQGEGFDVYLKDVRSKFDKVQMRKPSSSRDRSREQYLLGR-------
RRMJ_PSEPG      LCELALDLATRVLKPGGDFLIKIFQGEGFDVYLKDVRSKFDKVQMRKPSSSRDRSREQYLLGR-------
RRMJ_PSEP1      LCELALDLATRVLKPGGDFLIKIFQGEGFDVYLKDVRSKFDKVQMRKPSSSRDRSREQYLLGR-------
RRMJ_XANCP      LAELAMEFADTHLKVGGAFLIKLFQGVGSDDYIRELRRRYEKVTIRKPAASRKRSAEVYVLGQGKR----
RRMJ_XANCB      LAELAMEFADTHLKVGGAFLIKLFQGVGSDDYIRELRRRYEKVTIRKPAASRKRSAEVYVLGQGKR----
RRMJ_XANC8      LAELAMEFADTHLKVGGAFLIKLFQGVGSDDYIRELRRRYEKVTIRKPAASRKRSAEVYVLGQGKR----
RRMJ_NITMU      LAELALEFCTEQLNSGGNFLVKVFQGSGFDEFFRAMRATFHRVVTRKPLASRGRSSEIYLLGLGKR----
RRMJ_MARAV      LVELALDMACQVLKPKGSFVAKVFHGEGYDEYVKTVRESFDKVVIRKPDSSRARSREVYLVAKGFR----
RRMJ_DICNV      LVELAADFAQERLVAGGDFLCKVFHGAGFDALFQHLKTQFSTVLTRKPQASRARSQETYLLAR-------
RRMJ_HAHCH      LVELALDLACRVLKKNGCFVAKVFQGEGFDQILQESRGRFSSVNIRKPDASRARSREIYLVAKGFR----
RRMJ_XYLFM      LAELAMDFADIHVKPGGSFLIKLFHGVGSDDYIRQLRHRYKKVAIRKPLASRKRSPEVYIL---------
RRMJ_XYLFA      LAELAMDFADIHVKPGGSFLIKLFHGVGSDDYIRQLRHRYKKVAIRKPLASRKRSPEVYIL---------
RRMJ_ALCBS      LAELALDMAERVLEPDGVFLVKVFQGEGFEDYRKALQSRFKRVVSRKPAASRARSTEVY-----------
RRMJ_ACIBY      LCELALDFAQKVLGPNGQFVVKVFQGAGFDEFRKQVVDSFDVLKTAKPAASRARSKEVFLVGQGRKK---
RRMJ_ACIBT      LCELALDFAQKVLGPNGQFVVKVFQGAGFDEFRKQVVDSFDVLKTAKPAASRARSKEVFLVGQGRKK---
RRMJ_ACIBS      LCELALDFAQKVLGPNGQFVVKVFQGAGFDEFRKQVVDSFDVLKTAKPAASRARSKEVFLVGQGRKK---
RRMJ_ACIBC      LCELALDFAQKVLGPNGQFVVKVFQGA