[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA59139.1

[Show Plain Result]


## Summary of Sequence Search
    1::372
  157::359     1e-15  30%  402 aa  YDCM_ECOLI RecName: Full=Uncharacterized protein ydcM;
  128::242     6e-12  35%  278 aa  Y751_METJA RecName: Full=Uncharacterized protein MJ0751;
    1::372

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YDCM_ECOLI      ----------------------------------------------------------------------
Y751_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YDCM_ECOLI      ----------------------------------------------------------------------
Y751_METJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxGAFFLLVVIDTPEAPPIDPSGFIGIDLGITKVATDSDGGSFCGSTVEXXXXXXXXXXXXLQSKGT
YDCM_ECOLI      -----GKWYISIQTESEVSTPVHPSAMVGLDAGVAKLATLSDGNSFQKNQKKLARLQRQLSRKVKFSNNW
Y751_METJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RSAKRHLKKIRRKEAQFRRSQNHIISKRLVEKAKDTGRGIALEELKHIRSRTTVRKSDRAKHSGWSFFQL
YDCM_ECOLI      QKQKRKIQRLHSCIANIRRSKNHVIEDLKVSNMSKSAAGTVSQPGRNVRAKSGLNRS--ILDQGW--YEM
Y751_METJA      ---KTLMEKYSGREKRKVEDYLHKISKFLISEALKYNVKILMEDLTNIREAVNKKKNFRRRLNRWNFSKL


                         .         *         .         .         .         .         +:350
query           QSFIEYKAKLAGVFVQYIDPWYTSRTCSACGHADKANRKTQSHFQCVSCGYTxxxxxxxxxxxxxxxxxx
YDCM_ECOLI      RRQLAYKQLWRGGQVLAVPPAYTSQRCAYCGHTAKENRLSQSKFRCQVCGYT------------------
Y751_METJA      QFFIEYKAKWDGLDVEYVNPSRTSKLCPICG--CKLDPNGQRLLKCNNC---------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxx
YDCM_ECOLI      ----------------------
Y751_METJA      ----------------------