[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA59308.1

[Show Plain Result]


## Summary of Sequence Search
    1::384
  114::387     5e-62  49%  399 aa  FTSW_BUCAI RecName: Full=Cell division protein ftsW;
   60::405     3e-61  40%  414 aa  FTSW_ECOLI RecName: Full=Cell division protein ftsW;
   60::405     3e-61  40%  414 aa  FTSW_ECOL6 RecName: Full=Cell division protein ftsW;
   60::405     3e-61  40%  414 aa  FTSW_ECO57 RecName: Full=Cell division protein ftsW;
   69::351     1e-57  42%  353 aa  FTSW_BUCAP RecName: Full=Cell division protein ftsW;
   61::382     6e-57  41%  394 aa  FTSW_HAEIN RecName: Full=Cell division protein ftsW;
   26::366     7e-48  36%  366 aa  SP5E_BACSU RecName: Full=Stage V sporulation protein E;
   95::326     1e-42  50%  380 aa  FTSW_BUCBP RecName: Full=Cell division protein ftsW;
  126::393     3e-37  37%  415 aa  FTSW_MESVI RecName: Full=Cell division protein ftsW homolog;
   93::360     1e-33  32%  371 aa  RODA_HAEIN RecName: Full=Rod shape-determining protein rodA;
  110::351     2e-32  36%  393 aa  FTSW_SYNY3 RecName: Full=Probable cell division protein ftsW;
   96::405     5e-31  39%  524 aa  FTWH_MYCTU RecName: Full=Uncharacterized ftsW-like protein
   96::405     5e-31  39%  524 aa  FTWH_MYCBO RecName: Full=Uncharacterized ftsW-like protein Mb2178c;
   80::394     9e-30  30%  397 aa  FTSW_CYAPA RecName: Full=Cell division protein ftsW homolog;
  168::426     3e-25  35%  469 aa  FTSW_MYCTU RecName: Full=Probable cell division protein ftsW;
  168::426     3e-25  35%  469 aa  FTSW_MYCBO RecName: Full=Probable cell division protein ftsW;
   35::130     1e-22  31%  397 aa  FTSW_ENTHR RecName: Full=Probable cell division protein ftsW;
  106::372     3e-21  29%  420 aa  FTSW_LACLA RecName: Full=Probable cell division protein ftsW;
   97::351     3e-20  28%  403 aa  YLAO_BACSU RecName: Full=Uncharacterized membrane protein ylaO;
   91::176     9e-19  30%  433 aa  RODA_TREPA RecName: Full=Rod shape-determining protein rodA;
   96::357     1e-17  23%  364 aa  FTSW_BORBU RecName: Full=Cell division protein ftsW;
  154::348     6e-15  29%  381 aa  RODA_HELPJ RecName: Full=Rod shape-determining protein rodA;
   93::359     2e-14  27%  370 aa  RODA_SHIFL RecName: Full=Rod shape-determining protein rodA;
  154::348     2e-14  28%  381 aa  RODA_HELPY RecName: Full=Rod shape-determining protein rodA;
   93::359     2e-14  27%  370 aa  RODA_ECOLI RecName: Full=Rod shape-determining protein rodA;
   93::359     2e-14  27%  370 aa  RODA_ECO57 RecName: Full=Rod shape-determining protein rodA;
  281::387     5e-14  38%  388 aa  FTSW_HELPY RecName: Full=Probable cell division protein ftsW;
  281::387     5e-14  37%  388 aa  FTSW_HELPJ RecName: Full=Probable cell division protein ftsW;
  101::382     7e-11  23%  393 aa  YWCF_BACSU RecName: Full=Uncharacterized membrane protein ywcF;
  239::447     7e-11  23%  465 aa  FTSW_MYCLE RecName: Full=Probable cell division protein ftsW;
    1::384

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWVMVGSASLAIADGPRFLWRQGIFLLMGLAAAFVVW
FTSW_BUCAI      ----------------------------------------------------------------------
FTSW_ECOLI      ----------------------------------FIMVTSASMPIGDPFFFAKRDGVYXXXXXXXXXXXX
FTSW_ECOL6      ----------------------------------FIMVTSASMPIGDPFFFAKRDGVYXXXXXXXXXXXX
FTSW_ECO57      ----------------------------------FIMVTSASMPIGDPFFFAKRDGVYXXXXXXXXXXXX
FTSW_BUCAP      ----------------------------------------------------------------------
FTSW_HAEIN      --------------------------------------------------FAKRDAIYVLLSLLTCYISL
SP5E_BACSU      ------------------------------------MVYSASAVWADYKFFAKRQLLFAGIGVIAMFFIM
FTSW_BUCBP      ----------------------------------------------------------------------
FTSW_MESVI      ----------------------------------------------------------------------
RODA_HAEIN      ----------------------------------------------------------------------
FTSW_SYNY3      ----------------------------------------------------------------------
FTWH_MYCTU      -----------------------------------------------------KQVLWTLVGLIGGYVCL
FTWH_MYCBO      -----------------------------------------------------KQVLWTLVGLIGGYVCL
FTSW_CYAPA      -----------------------------------------------------RQFVFCLIGIVISNILM
FTSW_MYCTU      ----------------------------------------------------------------------
FTSW_MYCBO      ----------------------------------------------------------------------
FTSW_ENTHR      ------------------------------------------LVAGSDPKSLFRQFLFIILSWGVIVLTY
FTSW_LACLA      ----------------------------------------------------------------------
YLAO_BACSU      ----------------------------------------------------------------------
RODA_TREPA      ----------------------------------------------------------------------
FTSW_BORBU      ----------------------------------------------------------------------
RODA_HELPJ      ----------------------------------------------------------------------
RODA_SHIFL      ----------------------------------------------------------------------
RODA_HELPY      ----------------------------------------------------------------------
RODA_ECOLI      ----------------------------------------------------------------------
RODA_ECO57      ----------------------------------------------------------------------
FTSW_HELPY      ----------------------------------------------------------------------
FTSW_HELPJ      ----------------------------------------------------------------------
YWCF_BACSU      ----------------------------------------------------------------------
FTSW_MYCLE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RIRLIFWERXXXXXXXXXXXXXXXXXXXXIGVEANGSRRWLAIGPISLQPSELVKLFMVVYFSGYLVRRS
FTSW_BUCAI      ------------------------------GHSIHGSFRWINIGFLHIQPSEICKISSFCYLASYLSRKS
FTSW_ECOLI      XXPMEFWQRYSATMLLGSIILLMIVLV--VGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANYLVRKG
FTSW_ECOL6      XXPMEFWQRYSATMLLGSIILLMIVLV--VGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANYLVRKG
FTSW_ECO57      XXPMEFWQRYSATMLLGSIILLMIVLV--VGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANYLVRKG
FTSW_BUCAP      ------------------------------GKSVHGSYRWINIGILHIQPAEICKISSFFYISNYLSRKT
FTSW_HAEIN      QISSSQWEKWHAKXXXXXXXXXXXXXXX--GTSVNGAKRWISLGILNFQPAEFAKLALTCFLASYFTRRY
SP5E_BACSU      NVDYWTWRTWSKXXXXXXXXXXXXXXXPGVGMVRNGSRSWIGVGAFSIQPSEFMKLAMIAFLAKFLSEKQ
FTSW_BUCBP      ------------------------------GNSIHGSLRWITISYVSMQPSELSKLAMFCYLSNYLSQKN
FTSW_MESVI      -----------------------------MGISVNGASRWIAIGPILLQPSEIIKPFLILQ-SSYIFSQW
RODA_HAEIN      -----------------------------IGTTSKGAQRWLDLGFIRFQPSEIVKLAVPLMVAVYLGNRP
FTSW_SYNY3      -----------------------------LGVEVNGARRWISLGPILIQPSEFMKPCLVLQAANLFGNWH
FTWH_MYCTU      RMSVRFMRRIAFSGFAITIVMLVLVLVPGIGKEANGSRGWFVVAGFSMQPSELAKMAFAIWGAHLLAARR
FTWH_MYCBO      RMSVRFMRRIAFSGFAITIVMLVLVLVPGIGKEANGSRGWFVVAGFSMQPSELAKMAFAIWGAHLLAARR
FTSW_CYAPA      HFPLTLLLKYSNIPXXXXXXXXXXXXMPNIGISINGARRWIAVYGFLVQPSELIKPFWVLQISKIFGQWE
FTSW_MYCTU      --------------------------------EQNGAKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKR
FTSW_MYCBO      --------------------------------EQNGAKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKR
FTSW_ENTHR      SIRLLLKPRIIKAGLIVSGLLLAMMKLGIFAVTVNGAQRWVSIAGIQFQPSEIATIFLILYLSRF-----
FTSW_LACLA      ----------------------------------NGARGWIHIPGITVQPAEFAKVFIIWYLASVFSTKQ
YLAO_BACSU      ------------------------------GHVAGNAQSWFKIGGMSIQPGEFVKLVVILYLAAVYAKKQ
RODA_TREPA      ------------------------------GRYVNGAKSWIGVGEFGIQISEFAKIAYILYLAHYLVYSQ
FTSW_BORBU      ----------------------------------SGAKRWIFFQGVSIQPSEIFKISFTIYLSAYLSKFD
RODA_HELPJ      ----------------------------------------------------------------------
RODA_SHIFL      ------------------------------GAISKGAQRWLDLGIVRFQPSEIAKIAVPLMVARFINRDV
RODA_HELPY      ----------------------------------------------------------------------
RODA_ECOLI      ------------------------------GAISKGAQRWLDLGIVRFQPSEIAKIAVPLMVARFINRDV
RODA_ECO57      ------------------------------GAISKGAQRWLDLGIVRFQPSEIAKIAVPLMVARFINRDV
FTSW_HELPY      ----------------------------------------------------------------------
FTSW_HELPJ      ----------------------------------------------------------------------
YWCF_BACSU      -----------------------------------GAKSWFRIGRITIQPSEFMKVGLIMMLASVIGKAN
FTSW_MYCLE      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YEVRTTVRXXXXXXXXXXXXXXXXXXEPDFGAVVILFATMLGMLFLGGARLWYFVXXXXXXXXXXXXXXX
FTSW_BUCAI      NEVRNNFWGFFKPMSVIITQSMLLLAEPDLGTVVVLFFTTISVLFLSGAKIGQFFXXXXXXXXXXXXXXX
FTSW_ECOLI      DEVRNNLRGFLKPMGVIXXXXXXXXXQPDLGXXXXXXXXXXXXXXXXGAKLWQFIAIIGMGISAVVLLIL
FTSW_ECOL6      DEVRNNLRGFLKPMGVIXXXXXXXXXQPDLGXXXXXXXXXXXXXXXXGAKLWQFIAIIGMGISAVVLLIL
FTSW_ECO57      DEVRNNLRGFLKPMGVIXXXXXXXXXQPDLGXXXXXXXXXXXXXXXXGAKLWQFIAIIGMGISAVVLLIL
FTSW_BUCAP      NEVRNNFWGFLKPITIIIIQSVLLLAEPDLGTVIXXXXXXXXXXXXXGVXXXXXXXXXXXVTLIITALVL
FTSW_HAEIN      DEVRSRHVSIFKPFIVMLVLGCFLLLQPDLGSTVVLFIIMSGMLFIVGAKILQFVGLIALGGILFVWLVL
SP5E_BACSU      KNITSFRRGFVPALGIVFSAFLIIMCQPDLGTGTVMVGTCIVMIFVAGARIAHFVFLGLIGLSGFVGLVL
FTSW_BUCBP      SEIVNNFGGXXXXXXXXXXXXXXXXVEPDXXXXXXXXXXXXXXXXXXXXKIQKFIPXXXXXXXXXXXXXX
FTSW_MESVI      DNISYSKKIFWVXXXXXXXXXXXX--QPNLSTASLCGAIIWLVALTAGIHWFYLNSILSIGAVTALISLG
RODA_HAEIN      LPPKLS--ETFIAIAMILLPTLLVAIQPDLGTSILVSASGLFVVFLAGMSWWLILAAVIGLAGFIPIMWL
FTSW_SYNY3      ---RFPWRSRLIWLGIFALTLGSILLQPNLSTTALCGMGLWLIALASGLPWIYLISTALLGITTAVTSIS
FTWH_MYCTU      MERASLREMXXXXXXXXXXXXXXXXXQPDLGQTVSMXXXXXXXXWYAGLPLRVFXXXXXXXXXXXXXXXX
FTWH_MYCBO      MERASLREMXXXXXXXXXXXXXXXXXQPDLGQTVSMXXXXXXXXWYAGLPLRVFXXXXXXXXXXXXXXXX
FTSW_CYAPA      F---LTTRTKIFWLIIFLIQIVAVLIQPNLSTASLLGITLWLMGLCANFPWKYLLGTVFVGLSMAITSIS
FTSW_MYCTU      GLFTSAGKHLLGMTXXXXXXXXXXXXEKDLGASLLLYTSFLVVVYLATQRFSWVVIGLTLFAAGTLVAYF
FTSW_MYCBO      GLFTSAGKHLLGMTXXXXXXXXXXXXEKDLGASLLLYTSFLVVVYLATQRFSWVVIGLTLFAAGTLVAYF
FTSW_ENTHR      ----------------------------------------------------------------------
FTSW_LACLA      EEIEKRQKLFGGWRLPVVAILLVDLIMPDLGNTLIIAAVALIMIGASGISWWYFLGFLFIVGGNIIPSFL
YLAO_BACSU      SYIDHLLTGVAPPVVMTLIICGLIAMQPDFGTAMIIGLTLVRLVILGG-----IVFILVSPIIYLNQDKI
RODA_TREPA      SE--PMLKRFAKAGVITLLPMALILSQPDLGTASVYLPIFLVMCFIAG----------------------
FTSW_BORBU      PRKNNGISYWIKPMLIFAIFWVLIILQNDYSTAIYFAILFFIVLFVSNMAFSYVFAIVVTFLPVSAIFLM
RODA_HELPJ      --------------------------QPDLGTALIVLIMGFGILLIVGTRVWLPLLIALIVASPIAYHFL
RODA_SHIFL      CP--PSLKNTGIALVLIFMPTLLVAAQPDLGTSIIGVAVVLVAAFI--PILWFFLMHD------------
RODA_HELPY      --------------------------QPDLGTALIVLIMGFGILLIVGTRVWLPLFIALLVASPIAYHFL
RODA_ECOLI      CP--PSLKNTGIALVLIFMPTLLVAAQPDLGTSIIGVAVVLVAAFI--PILWFFLMHD------------
RODA_ECO57      CP--PSLKNTGIALVLIFMPTLLVAAQPDLGTSIIGVAVVLVAAFI--PILWFFLMHD------------
FTSW_HELPY      ----------------------------------------------------------------------
FTSW_HELPJ      ----------------------------------------------------------------------
YWCF_BACSU      PKGVRTLRDDIHLLLKIAGVAVIPVGMQDAGTAGICMFIVLVMVFMSGIN-WXXXXXVMINFPDVAKSVG
FTSW_MYCLE      --------------------------EKDLGTSLLLYASFLVVVYLATQRLSWVIIGLVLFTAGSTIAYF


                         .         .         .         +         .         .         .:280
query           XSPYRMERLTSFLDPWSDPLDSGYQLTQALIAFGRGEWFGVGLGNSIQKLFYLPEAHTDFLYAVLAEELG
FTSW_BUCAI      XEPYRIKRVLSFWNPWEDPFGNGYQLTQSLIALGRGNFLGQGLGNSIQKLDYLPDAHSDFIFSIIGEELG
FTSW_ECOLI      AEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELG
FTSW_ECOL6      AEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELG
FTSW_ECO57      AEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELG
FTSW_BUCAP      FEPYRIKRILSFWNPWKDPFGNGYQLTQSLIALGRGHFFGQGLGNSIQKLNYLPEAHSDFIFSIIGEELG
FTSW_HAEIN      TASYRLKRFIGFLEPFKEPYGTGFQLTNSLIAFGRGEITGEGLGNSIQKLDYLPEAHTDFIMAXXXXXXX
SP5E_BACSU      SAPYRIKRITSYLNPWEDPLGSGFQIIQSLYAVXXXXXXXXXXXQSRQKFFYLPEPQTDFIFAILSEEXX
FTSW_BUCBP      KSPYRFERIMSFWNPWNDPFGKGYQLTQSLMALGRGNIFGMGLGHSIQKLEYLPEAHTDFIFAIIGEELG
FTSW_MESVI      SQEYQRQRIISFLNPWANPTSIGYQLVQSLLAVGSGRLTGSGISCSYQKLFYLPIQYTDFIFSVFSEEFG
RODA_HAEIN      YHDYQRTRVLTLLDPEKDPLGAGYHILQSKIAIGSGGLSGKGWMQGTQQLEFLPEPHTDFIFAVMGEEHG
FTSW_SYNY3      IRDYQRARVTSFLDPFADPRGDGYQLVQSLYAIASGGVLGRGFGMSQQKLFYLPIQTTDFIFAVFAEEFG
FTWH_MYCTU      XXGYRSDRVRSWLNPENDPQDSGYQARQAKFALAQXXXXXXXXXXXVAKWNYLPNAHNDFIFAIIXXXXX
FTWH_MYCBO      XXGYRSDRVRSWLNPENDPQDSGYQARQAKFALAQXXXXXXXXXXXVAKWNYLPNAHNDFIFAIIXXXXX
FTSW_CYAPA      LKPYQLSRITSFLDPWKDPRGKGYQLVQSLXXXXXXXXXXXXXXXXLQKTGYLPIHYTDFIFAVYIEEFG
FTSW_MYCTU      IFEHVRLRVQTWLDPFADPDGTGYQIVQSLFSFATXXXXXXXXXXXQPDT--VPAASTDFIIAAFGEELG
FTSW_MYCBO      IFEHVRLRVQTWLDPFADPDGTGYQIVQSLFSFATXXXXXXXXXXXQPDT--VPAASTDFIIAAFGEELG
FTSW_ENTHR      ------DRIAMVHNPFLDEHGAGYQMSNSYYALYNGGLFGRGMGNSITKKGYLPESETDFIFSVIAEEFG
FTSW_LACLA      PITYINKRFEAFVNPFTDLANSGHQLANSYYAIVNGGWTGRGLGNSIQKNGFLPEAQTDFIFPIVVEEXX
YLAO_BACSU      LTEGRLARFESLEDPFKYANSSGLQVINSYYAXXXXXXXXXXXXXXXQKYGYLPESHTDFIMAVIAEEXX
RODA_TREPA      --PYQMMRLIIFLNPEVDPLKAGWHIIQSMIAIGSGGAFGMGYLRGPQSHYFLPQQSTDFIFSILSEEWG
FTSW_BORBU      LEPYRVSRIFAFLNPYDDPSGKGYQIIASLNAXXXXXXXXXXXXXXEVKLGKLPEANSDFIF---SXXXX
RODA_HELPJ      HD-YQKKRIADFLSE-----KPNYHVMQSIIAIGSGGFLGKSKEACTQTKFFLPIATSDFIFAYFVERFG
RODA_SHIFL      ---YQRQRVMMLLDPESDPLGAGYHIIQSKIAIGSGGLRGKGLHGTQSQLEFLPERHTDFIFAXXXXXXX
RODA_HELPY      HD-YQKKRIADFLSE-----KPNYHVMQSIIAIGSGGFLGKSKEACTQTKFFLPIATSDFIFAYFVERFG
RODA_ECOLI      ---YQRQRVMMLLDPESDPLGAGYHIIQSKIAIGSGGLRGKGLHGTQSQLEFLPERHTDFIFAXXXXXXX
RODA_ECO57      ---YQRQRVMMLLDPESDPLGAGYHIIQSKIAIGSGGLRGKGLHGTQSQLEFLPERHTDFIFAXXXXXXX
FTSW_HELPY      ------------------------------------------------------EVHTDMVLAGIAEEWG
FTSW_HELPJ      ------------------------------------------------------EVHTDMVLAGIAEEWG
YWCF_BACSU      IQDYQIKRVTSWVSASNETQEDSWQVDQAIMAXXXXXXXXXXXXXX---KVYVPESTTDXXXXXXXXXXX
FTSW_MYCLE      TFEHIRVRMQVWWDPFTNLDVGGYQIVQSLFSFATXXXXXXXXXXXQPDA--IPAASTDFIIXXXXXXXX


                         .         *         .         .         .         .         +:350
query           LVGSLAVIALFTVLVYRALLIGRAAERAGRVFGAYLAYGLGIWIGLQAFINLGVNMGVLPTKGLTLPLMS
FTSW_BUCAI      YXXXXXXXXXXXXXXXRAMYIGQKALEKKQIFSGFLACSIGIWLSFQTSINVGSVTGILPTKGLTLPFIS
FTSW_ECOLI      YXXXXXXXXXXXXXXXXXMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLIS
FTSW_ECOL6      YXXXXXXXXXXXXXXXXXMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLIS
FTSW_ECO57      YXXXXXXXXXXXXXXXXXMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLIS
FTSW_BUCAP      YIGCXXXXXXXXXXSFRAMYIGQQSFEKKQVFSGFLACSIGLWFSFQTLINIGAVTGILPTKGLTLPLIS
FTSW_HAEIN      XXXXXXXXXXXXXXXXRAMKIGRESLMLEQRFRGFFALGIGFWIFFQGFVNLGMALGMLPTKGLTFPLVS
SP5E_BACSU      XXXXXXXXXXXSVLLWRGI---RIALGAPDLYGSFVAVGIISMIAIQVMINIGVVTGLIPVTGITLPFLS
FTSW_BUCBP      YIGACTILFMIFFISFRAFKIGKIALKNKIFFSGYFAFSIGLWLIFQTLINV------------------
FTSW_MESVI      LLGAXXXXXXXXXXXXXGMIV--VLSNKSKV-NRLLALGCIMVLVGQSLINIGVSVGILPTTGLPLPFFS
RODA_HAEIN      MIGFLILMAIYLFIIVRGLMI---AVNAQTSFGRILAGATTLIFFVYVFVNIGMVSGILPVVGVPLPLFS
FTSW_SYNY3      LVGCLAFLGLFTTMGLRVAM--RCRHRVKRLIG----LGVVIFLVGQSLLNIGVASGALPTTGLPLP---
FTWH_MYCTU      XXXXXXXXXXXXXXXYTGM---RIASRSADPFLRLLTATTTLWVLGQAFINIGYVIGLLPVTGLQLPLIS
FTWH_MYCBO      XXXXXXXXXXXXXXXYTGM---RIASRSADPFLRLLTATTTLWVLGQAFINIGYVIGLLPVTGLQLPLIS
FTSW_CYAPA      FIGA---VSXXXXXXXXXXXXXXXXXKTNHPVLRLVGCGAIILLMIQTLLNMAVATGIFPTTGLPLPFFS
FTSW_MYCTU      LVGLTAILMLYTIVIIRGL---RTAIATRDSFGKLLAAGLSSTLAIQLFIVVGGVTRLIPLTGLTTPWMS
FTSW_MYCBO      LVGLTAILMLYTIVIIRGL---RTAIATRDSFGKLLAAGLSSTLAIQLFIVVGGVTRLIPLTGLTTPWMS
FTSW_ENTHR      LIGAXXXXXXXXXXCMR---IFQKSTKQKNQQANLILIGVGTWILVQTSINIGSILGLIPMTGVPLPFVS
FTSW_LACLA      XXXXXXXXXXXXXXXSRMLIVGIRAKSA---FNSLIMIGVSGLLLVQVFVNVGGAIGIIPETGVTFP---
YLAO_BACSU      XXXXXXXXXXXXXXXXKGFYIARKCEDP---FGSLLAIGISSMIAIQSFINLGGVSGLIPITGVTLPFI-
RODA_TREPA      FVGGVIVFGLYLLFFLHTLSI---MSHVDDLYGKLIASGLGMFL-FHFVVNVGMTMGIMPITGIPXXXXX
FTSW_BORBU      XXXXXXXXXXXXXXXXXXXXXXXXXXHSNSRFKXXXXXXXXXXXXXQSMMNILIAIGLLPPTGINLPFFS
RODA_HELPJ      FLGAILLFAIYIGLSLH--LFFYLFESNSDWFLKIVALGISILIFVYSSVNIAMTLGLAPVVGIPLPLFS
RODA_SHIFL      XXXXXXXXXXXXXXXMRGLWI---AARAQTTFGRVMAGGLMLILFVYVFVNIGMXXXXXXXXXXXXXXXX
RODA_HELPY      FLGAMLLFAIYIGLSLH--LFFYLFESNSDWFLKIVALGISILIFVYSSVNIAMTLGLAPVVGIPLPLFS
RODA_ECOLI      XXXXXXXXXXXXXXXMRGLWI---AARAQTTFGRVMAGGLMLILFVYVFVNIGMXXXXXXXXXXXXXXXX
RODA_ECO57      XXXXXXXXXXXXXXXMRGLWI---AARAQTTFGRVMAGGLMLILFVYVFVNIGMXXXXXXXXXXXXXXXX
FTSW_HELPY      FLGLCVCFILFSVLI---VLIFRIANRLKEPKYSLFCVGVVLLISFSLVINAFGVGGILPVKGLAVPFLS
FTSW_HELPJ      FLGLCVCFILFSVMI---VLIFRIANRLKEPKYSLFCVGVVLLIGFSLVINAFGVGGIFPVKGLAVPFLS
YWCF_BACSU      XXXCAIVVIMFFFLIYRLVVLIDKIHPFNR-FASFFCVGYTALIVIHTFQNIGMNIGIMPVTGIPLLFVS
FTSW_MYCLE      XXXXXXXXXXYTIVIVRGL---RTAIATRDSFGKLLAAGLASTLAIQLFIVSXXXXXXXXXXXXXXPWMS


                         .         .         .         .         *         .         .:420
query           AGGSSIIVTCIAVALILRVDLETRFPKTARxxxx
FTSW_BUCAI      YGGSSLIINSIAIFFLLRIDFETR----------
FTSW_ECOLI      YGGSSLLIMSTAIMMLLRIDYETRLEK-------
FTSW_ECOL6      YGGSSLLIMSTAIMMLLRIDYETRLEK-------
FTSW_ECO57      YGGSSLLIMSTAIMMLLRIDYETRLEK-------
FTSW_BUCAP      YGGSSLIVNLMAICILLRIDFEIRFPK-------
FTSW_HAEIN      YGGSSIIIMSATIGILLRIDHENR----------
SP5E_BACSU      YGGSSLTLMLMAVGVLLNVSRYSRY---------
FTSW_BUCBP      ----------------------------------
FTSW_MESVI      YGGNSILATFFVSAILIRVAIET-----------
RODA_HAEIN      YGGTSYVAIMASFGLLMSI---------------
FTSW_SYNY3      ----------------------------------
FTWH_MYCTU      AGGTSTAATLSLIGII------------------
FTWH_MYCBO      AGGTSTAATLSLIGII------------------
FTSW_CYAPA      YGGNALLANLINCSFLIRLALETK----------
FTSW_MYCTU      YGGSS-----------------------------
FTSW_MYCBO      YGGSS-----------------------------
FTSW_ENTHR      YGGTSYLILSFAIGLALNI---------------
FTSW_LACLA      ----------------------------------
YLAO_BACSU      ----------------------------------
RODA_TREPA      XXXXXXWTAMIATGLLMSIN--------------
FTSW_BORBU      SGGSSIIVTMALSGLISNV---------------
RODA_HELPJ      YGGSSFITFMILFAIL------------------
RODA_SHIFL      XXXSALIVLMAGFGIVMSI---------------
RODA_HELPY      YGGSSFITFMILFGIL------------------
RODA_ECOLI      XXXSALIVLMAGFGIVMSI---------------
RODA_ECO57      XXXSALIVLMAGFGIVMSI---------------
FTSW_HELPY      YGGSSLLANCIAIGLVLXLARYTK----------
FTSW_HELPJ      YGGSSLLANCIAIGLVLSLARYTK----------
YWCF_BACSU      YGGSSTLSTLIGFGIVYNASVQ------------
FTSW_MYCLE      YGGSSLLANYVLLAILARISHSARHPLRSR----