[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA59402.1

[Show Plain Result]


## Summary of Sequence Search
    1::337
    6::321     e-124  64%  326 aa  DUSA_VIBVU RecName: Full=tRNA-dihydrouridine synthase A;       
    6::321     e-124  65%  327 aa  DUSA_VIBCH RecName: Full=tRNA-dihydrouridine synthase A;       
    6::321     e-123  64%  326 aa  DUSA_VIBPA RecName: Full=tRNA-dihydrouridine synthase A;       
   17::328     e-123  67%  335 aa  DUSA_SHEON RecName: Full=tRNA-dihydrouridine synthase A;       
   21::332     e-118  64%  345 aa  DUSA_YERPE RecName: Full=tRNA-dihydrouridine synthase A;       
   12::326     e-114  62%  332 aa  DUSA_SALTI RecName: Full=tRNA-dihydrouridine synthase A;       
   12::326     e-113  62%  332 aa  DUSA_SALTY RecName: Full=tRNA-dihydrouridine synthase A;       
   12::322     e-111  61%  327 aa  DUSA_HAEIN RecName: Full=tRNA-dihydrouridine synthase A;       
   12::322     e-110  60%  327 aa  DUSA_PASMU RecName: Full=tRNA-dihydrouridine synthase A;       
   11::325     e-110  61%  331 aa  DUSA_ECOL6 RecName: Full=tRNA-dihydrouridine synthase A;       
   13::324     e-109  60%  334 aa  DUS2_SYNY3 RecName: Full=Probable tRNA-dihydrouridine synthase 2;  
   12::324     e-109  61%  330 aa  DUSA_ECOLI RecName: Full=tRNA-dihydrouridine synthase A;       
   12::324     e-109  61%  330 aa  DUSA_ECO57 RecName: Full=tRNA-dihydrouridine synthase A;       
   12::324     e-108  60%  330 aa  DUSA_SHIFL RecName: Full=tRNA-dihydrouridine synthase A;       
   19::330     e-106  57%  336 aa  DUSA_PSEPK RecName: Full=tRNA-dihydrouridine synthase A;       
    9::319     e-103  57%  323 aa  DUSA_HAEDU RecName: Full=tRNA-dihydrouridine synthase A;       
   15::326     e-101  56%  332 aa  DUSA_PSEAE RecName: Full=tRNA-dihydrouridine synthase A;       
    8::324     e-100  55%  334 aa  DUSA_XANAC RecName: Full=tRNA-dihydrouridine synthase A;       
   19::331     6e-99  54%  336 aa  DUSA_PSESM RecName: Full=tRNA-dihydrouridine synthase A;       
    7::322     9e-92  52%  335 aa  DUSA_XANCP RecName: Full=tRNA-dihydrouridine synthase A;       
   16::327     3e-78  48%  332 aa  DUSA_XYLFT RecName: Full=tRNA-dihydrouridine synthase A;       
   16::327     5e-77  47%  340 aa  DUSA_XYLFA RecName: Full=tRNA-dihydrouridine synthase A;       
    2::239     1e-26  33%  327 aa  DUS_RICPR RecName: Full=Probable tRNA-dihydrouridine synthase;     
    1::283     1e-26  35%  332 aa  DUSB_XANAC RecName: Full=tRNA-dihydrouridine synthase B;       
    3::286     7e-26  32%  328 aa  DUS_AZOBR RecName: Full=Probable tRNA-dihydrouridine synthase;     
    2::239     3e-25  31%  325 aa  DUS_RICFE RecName: Full=Probable tRNA-dihydrouridine synthase;     
    1::283     3e-25  33%  332 aa  DUSB_XANCP RecName: Full=tRNA-dihydrouridine synthase B;       
    2::239     2e-24  32%  327 aa  DUS_RICTY RecName: Full=Probable tRNA-dihydrouridine synthase;     
    4::286     2e-24  31%  332 aa  DUSB_PSEAE RecName: Full=tRNA-dihydrouridine synthase B;       
    2::285     3e-24  32%  331 aa  DUS_RICCN RecName: Full=Probable tRNA-dihydrouridine synthase;     
    1::233     1e-23  31%  332 aa  DUSB_PASMU RecName: Full=tRNA-dihydrouridine synthase B;       
    1::282     2e-23  30%  320 aa  DUSB_HAEDU RecName: Full=tRNA-dihydrouridine synthase B;       
    1::284     3e-22  31%  323 aa  DUSB_PROVU RecName: Full=tRNA-dihydrouridine synthase B;       
    2::240     2e-21  31%  326 aa  DUS_RICBR RecName: Full=Probable tRNA-dihydrouridine synthase;     
    1::283     2e-21  29%  322 aa  DUSB_VIBVU RecName: Full=tRNA-dihydrouridine synthase B;       
    1::284     5e-21  31%  330 aa  DUSB_HAEIN RecName: Full=tRNA-dihydrouridine synthase B;       
    1::283     7e-21  30%  322 aa  DUSB_SHEON RecName: Full=tRNA-dihydrouridine synthase B;       
    1::298     3e-20  29%  322 aa  DUSB_VIBCH RecName: Full=tRNA-dihydrouridine synthase B;       
    1::283     1e-19  29%  322 aa  DUSB_VIBPA RecName: Full=tRNA-dihydrouridine synthase B;       
   42::236     1e-19  33%  333 aa  DUS1_BACSU RecName: Full=Probable tRNA-dihydrouridine synthase 1;  
   16::247     2e-19  31%  328 aa  DUS_STAAN RecName: Full=Probable tRNA-dihydrouridine synthase;     
   16::247     2e-19  31%  328 aa  DUS_STAAM RecName: Full=Probable tRNA-dihydrouridine synthase;     
   16::247     1e-18  30%  328 aa  DUS_STAAW RecName: Full=Probable tRNA-dihydrouridine synthase;     
   16::247     1e-18  30%  328 aa  DUS_STAAS RecName: Full=Probable tRNA-dihydrouridine synthase;     
   16::247     1e-18  30%  328 aa  DUS_STAAR RecName: Full=Probable tRNA-dihydrouridine synthase;     
   16::247     1e-18  30%  328 aa  DUS_STAAC RecName: Full=Probable tRNA-dihydrouridine synthase;     
   64::236     2e-18  38%  317 aa  DUSC_PSESM RecName: Full=tRNA-dihydrouridine synthase C;       
    1::284     2e-18  27%  321 aa  DUSB_KLEPN RecName: Full=tRNA-dihydrouridine synthase B;       
    1::284     2e-18  27%  321 aa  DUSB_ERWCA RecName: Full=tRNA-dihydrouridine synthase B;       
   16::247     3e-18  31%  326 aa  DUS_STAEQ RecName: Full=Probable tRNA-dihydrouridine synthase;     
    4::286     4e-18  29%  337 aa  DUSB_PSESM RecName: Full=tRNA-dihydrouridine synthase B;       
   16::247     1e-17  31%  326 aa  DUS_STAES RecName: Full=Probable tRNA-dihydrouridine synthase;     
    4::310     1e-17  27%  316 aa  DUS_AQUAE RecName: Full=Probable tRNA-dihydrouridine synthase;     
   33::236     2e-17  34%  315 aa  DUSC_PSEAC RecName: Full=tRNA-dihydrouridine synthase C;       
    1::265     2e-17  28%  321 aa  DUSB_ECOLI RecName: Full=tRNA-dihydrouridine synthase B;       
    1::265     2e-17  28%  321 aa  DUSB_ECOL6 RecName: Full=tRNA-dihydrouridine synthase B;       
    1::265     2e-17  28%  321 aa  DUSB_ECO57 RecName: Full=tRNA-dihydrouridine synthase B;       
    1::265     2e-17  28%  321 aa  DUSB_SHIFL RecName: Full=tRNA-dihydrouridine synthase B;       
    1::265     2e-17  28%  321 aa  DUSB_SALTY RecName: Full=tRNA-dihydrouridine synthase B;       
    1::265     2e-17  28%  321 aa  DUSB_SALTI RecName: Full=tRNA-dihydrouridine synthase B;       
   15::237     3e-17  29%  321 aa  DUSB_YERPE RecName: Full=tRNA-dihydrouridine synthase B;       
    2::272     6e-17  33%  312 aa  DUSC_SALTI RecName: Full=tRNA-dihydrouridine synthase C;       
   67::272     8e-17  34%  312 aa  DUSC_YERPE RecName: Full=tRNA-dihydrouridine synthase C;       
    2::232     8e-17  33%  315 aa  DUSC_SHEON RecName: Full=tRNA-dihydrouridine synthase C;       
   59::237     1e-16  35%  322 aa  DUSC_RALEH RecName: Full=tRNA-dihydrouridine synthase C;       
   64::272     2e-16  34%  312 aa  DUSC_SALTY RecName: Full=tRNA-dihydrouridine synthase C;       
   67::272     3e-16  33%  315 aa  DUSC_SHIFL RecName: Full=tRNA-dihydrouridine synthase C;       
   15::237     3e-16  27%  334 aa  DUSB_SERMA RecName: Full=tRNA-dihydrouridine synthase B;       
   16::251     3e-16  30%  317 aa  DUS4L_HUMAN RecName: Full=tRNA-dihydrouridine synthase 4-like;     
   33::254     3e-16  29%  423 aa  DUS1_YEAST RecName: Full=tRNA-dihydrouridine synthase 1;       
   67::272     6e-16  33%  316 aa  DUSC_ECO57 RecName: Full=tRNA-dihydrouridine synthase C;       
   16::240     2e-15  29%  325 aa  DUS2_BACSU RecName: Full=Probable tRNA-dihydrouridine synthase 2;  
   64::294     2e-15  29%  322 aa  DUSC_VIBPA RecName: Full=tRNA-dihydrouridine synthase C;       
   67::272     2e-15  32%  315 aa  DUSC_ECOLI RecName: Full=tRNA-dihydrouridine synthase C;       
   67::272     2e-15  32%  316 aa  DUSC_ECOL6 RecName: Full=tRNA-dihydrouridine synthase C;       
    4::295     2e-15  25%  337 aa  DUSB_PSEPK RecName: Full=tRNA-dihydrouridine synthase B;       
   64::254     3e-15  32%  323 aa  DUSC_PSEPK RecName: Full=tRNA-dihydrouridine synthase C;       
   16::251     3e-15  29%  324 aa  DUS4L_MOUSE RecName: Full=tRNA-dihydrouridine synthase 4-like;     
   38::245     5e-15  32%  325 aa  DUSC_HAEDU RecName: Full=tRNA-dihydrouridine synthase C;       
    5::248     7e-15  29%  333 aa  DUSC_NEIMA RecName: Full=tRNA-dihydrouridine synthase C;       
   31::334     9e-15  27%  355 aa  DUS1_SYNY3 RecName: Full=Probable tRNA-dihydrouridine synthase 1;  
   21::241     9e-15  30%  438 aa  DUS1L_RAT RecName: Full=tRNA-dihydrouridine synthase 1-like;       
   21::325     1e-14  29%  389 aa  DUS_MYCTU RecName: Full=Probable tRNA-dihydrouridine synthase;     
    2::233     1e-14  29%  310 aa  DUSC_HAEIN RecName: Full=tRNA-dihydrouridine synthase C;       
   64::236     2e-14  35%  319 aa  DUSC_PSEAE RecName: Full=tRNA-dihydrouridine synthase C;       
   21::241     2e-14  31%  473 aa  DUS1L_HUMAN RecName: Full=tRNA-dihydrouridine synthase 1-like;     
   60::287     2e-14  31%  318 aa  DUSC_VIBVU RecName: Full=tRNA-dihydrouridine synthase C;       
   50::319     3e-14  31%  384 aa  DUS_MYCLE RecName: Full=Probable tRNA-dihydrouridine synthase;     
   64::256     3e-14  31%  323 aa  DUSC_VIBCH RecName: Full=tRNA-dihydrouridine synthase C;       
   59::237     3e-14  31%  326 aa  DUSC_RALSO RecName: Full=tRNA-dihydrouridine synthase C;       
   25::257     3e-14  28%  326 aa  DUS4_SCHPO RecName: Full=tRNA-dihydrouridine synthase 4;       
   74::294     3e-14  27%  399 aa  DUS1_SCHPO RecName: Full=tRNA-dihydrouridine synthase 1;       
   64::240     3e-14  34%  312 aa  DUSC_PASMU RecName: Full=tRNA-dihydrouridine synthase C;       
   21::241     3e-14  30%  475 aa  DUS1L_MOUSE RecName: Full=tRNA-dihydrouridine synthase 1-like;     
   22::261     6e-14  32%  284 aa  YQI2_CAEEL RecName: Full=Uncharacterized tRNA-dihydrouridine
  335::559     6e-14  26%  650 aa  DUS3L_HUMAN RecName: Full=tRNA-dihydrouridine synthase 3-like;     
  324::584     8e-14  27%  639 aa  DUS3L_XENTR RecName: Full=tRNA-dihydrouridine synthase 3-like;     
  325::549     1e-13  26%  640 aa  DUS3L_XENLA RecName: Full=tRNA-dihydrouridine synthase 3-like;     
  362::570     1e-13  26%  685 aa  DUS3L_ORYSJ RecName: Full=tRNA-dihydrouridine synthase 3-like;     
   14::248     3e-13  29%  333 aa  DUSC_NEIMB RecName: Full=tRNA-dihydrouridine synthase C;       
   14::286     7e-13  27%  324 aa  DUS_RHOCA RecName: Full=Probable tRNA-dihydrouridine synthase;     
   47::229     7e-13  24%  493 aa  DUS2L_MOUSE RecName: Full=tRNA-dihydrouridine synthase 2-like;     
   47::216     7e-13  25%  493 aa  DUS2L_HUMAN RecName: Full=tRNA-dihydrouridine synthase 2-like;     
  387::602     1e-12  27%  725 aa  DUS3_CRYNE RecName: Full=tRNA-dihydrouridine synthase 3;       
   47::314     1e-12  27%  340 aa  DUS_TREPA RecName: Full=Probable tRNA-dihydrouridine synthase;     
    6::226     3e-12  29%  317 aa  DUS_RHILP RecName: Full=Probable tRNA-dihydrouridine synthase;     
  325::549     6e-12  25%  640 aa  DUS3L_RAT RecName: Full=tRNA-dihydrouridine synthase 3-like;       
  377::585     1e-11  24%  700 aa  DUS3L_ARATH RecName: Full=tRNA-dihydrouridine synthase 3-like;     
  354::552     2e-11  25%  671 aa  DUS3L_DICDI RecName: Full=tRNA-dihydrouridine synthase 3-like;     
  322::582     3e-11  25%  637 aa  DUS3L_MOUSE RecName: Full=tRNA-dihydrouridine synthase 3-like;     
  303::533     4e-11  30%  647 aa  DUS3_ASHGO RecName: Full=tRNA-dihydrouridine synthase 3;       
  341::553     2e-10  29%  676 aa  DUS3_COPC7 RecName: Full=tRNA-dihydrouridine synthase 3;       
  520::741     3e-10  34%  867 aa  DUS3_USTMA RecName: Full=tRNA-dihydrouridine synthase 3;       
   65::266     9e-10  28%  367 aa  DUS4_YEAST RecName: Full=tRNA-dihydrouridine synthase 4;       
  325::553     2e-09  29%  665 aa  DUS3_KLULA RecName: Full=tRNA-dihydrouridine synthase 3;       
    2::288     4e-09  24%  328 aa  DUS_HELPJ RecName: Full=Probable tRNA-dihydrouridine synthase;     
  295::408     4e-09  34%  640 aa  DUS3_CANGA RecName: Full=tRNA-dihydrouridine synthase 3;       
  331::520     8e-09  33%  613 aa  DUS3_CANAL RecName: Full=tRNA-dihydrouridine synthase 3;       
  425::646     2e-08  26%  766 aa  DUS3_MALGO RecName: Full=tRNA-dihydrouridine synthase 3;       
  319::546     4e-08  27%  664 aa  DUS3_VANPO RecName: Full=tRNA-dihydrouridine synthase 3;       
  321::554     6e-08  26%  668 aa  DUS3_YEAST RecName: Full=tRNA-dihydrouridine synthase 3;       
  321::554     6e-08  26%  668 aa  DUS3_YEAS7 RecName: Full=tRNA-dihydrouridine synthase 3;       
   70::251     1e-07  23%  479 aa  DUS2_SCHPO RecName: Full=tRNA-dihydrouridine synthase 2;       
  270::519     2e-07  25%  613 aa  DUS3_PICST RecName: Full=tRNA-dihydrouridine synthase 3;       
    2::238     2e-07  24%  328 aa  DUS_HELPY RecName: Full=Probable tRNA-dihydrouridine synthase;     
  275::529     3e-07  26%  622 aa  DUS3_YARLI RecName: Full=tRNA-dihydrouridine synthase 3;       
  282::550     4e-07  27%  622 aa  DUS3_DEBHA RecName: Full=tRNA-dihydrouridine synthase 3;       
  436::645     5e-07  26%  739 aa  DUS3_MAGGR RecName: Full=tRNA-dihydrouridine synthase 3;       
   98::277     2e-06  24%  312 aa  PYRDB_ENTFA RecName: Full=Dihydroorotate dehydrogenase B, catalytic
   93::253     3e-06  35%  302 aa  PYRD_PYRKO RecName: Full=Dihydroorotate dehydrogenase;       
  267::495     4e-06  25%  607 aa  DUS3_PICGU RecName: Full=tRNA-dihydrouridine synthase 3;       
   57::123     5e-06  36%  246 aa  HIS4_THICR RecName:
  433::640     6e-06  25%  737 aa  DUS3_NEUCR RecName: Full=tRNA-dihydrouridine synthase 3;       
   57::123     8e-06  38%  245 aa  HIS4_PSESM RecName:
  360::550     8e-06  26%  642 aa  DUS3_LODEL RecName: Full=tRNA-dihydrouridine synthase 3;       
   74::225     8e-06  27%  384 aa  DUS2_YEAST RecName: Full=tRNA-dihydrouridine synthase 2;       
  410::617     1e-05  28%  713 aa  DUS3_CHAGB RecName: Full=tRNA-dihydrouridine synthase 3;       
  445::654     1e-05  25%  750 aa  DUS3_BOTFB RecName: Full=tRNA-dihydrouridine synthase 3;       
   95::281     1e-05  24%  304 aa  PYRD_BACSK RecName: Full=Dihydroorotate dehydrogenase;       
   60::123     3e-05  35%  245 aa  HIS4_TERTT RecName:
   57::123     3e-05  36%  245 aa  HIS4_PSEU2 RecName:
   57::123     3e-05  36%  245 aa  HIS4_PSE14 RecName:
  445::630     3e-05  25%  750 aa  DUS3_SCLS1 RecName: Full=tRNA-dihydrouridine synthase 3;       
   90::277     7e-05  24%  304 aa  PYRD_OCEIH RecName: Full=Dihydroorotate dehydrogenase;       
   41::123     7e-05  34%  247 aa  HIS4_PSEU5 RecName:
   57::123     7e-05  35%  245 aa  HIS4_PSEFS RecName:
   57::123     7e-05  35%  249 aa  HIS4_CHRSD RecName:
  330::503     7e-05  28%  617 aa  DUS3_SCHPO RecName: Full=tRNA-dihydrouridine synthase 3;       
  365::499     7e-05  30%  748 aa  DUS3_ASPNC RecName: Full=tRNA-dihydrouridine synthase 3;       
   93::274     9e-05  21%  304 aa  PYRD_LISMO RecName: Full=Dihydroorotate dehydrogenase;       
   57::123     9e-05  35%  245 aa  HIS4_PSEF5 RecName:
   86::233     9e-05  28%  238 aa  HIS4_LEUMM RecName:
   99::164     1e-04  35%  302 aa  PYRD_SYNWW RecName: Full=Dihydroorotate dehydrogenase;       
   93::274     1e-04  21%  304 aa  PYRD_LISMH RecName: Full=Dihydroorotate dehydrogenase;       
   93::274     1e-04  20%  304 aa  PYRD_LISMF RecName: Full=Dihydroorotate dehydrogenase;       
   93::274     1e-04  20%  304 aa  PYRD_LISMC RecName: Full=Dihydroorotate dehydrogenase;       
   93::274     1e-04  21%  304 aa  PYRD_LISIN RecName: Full=Dihydroorotate dehydrogenase;       
   95::278     1e-04  25%  312 aa  PYRD_ANOFW RecName: Full=Dihydroorotate dehydrogenase;       
   93::274     1e-04  20%  304 aa  PYRD_LISW6 RecName: Full=Dihydroorotate dehydrogenase;       
   64::127     1e-04  30%  246 aa  HIS4_PSYCK RecName:
   64::127     1e-04  30%  246 aa  HIS4_PSYA2 RecName:
   57::123     1e-04  33%  245 aa  HIS4_PSEE4 RecName:
  102::206     1e-04  28%  238 aa  HIS4_LACCB RecName:
   57::123     1e-04  35%  245 aa  HIS4_AZOVD RecName:
   60::123     1e-04  35%  243 aa  HIS4_ACIAD RecName:
  426::615     1e-04  25%  728 aa  DUS3_ASPCL RecName: Full=tRNA-dihydrouridine synthase 3;       
   90::163     2e-04  27%  301 aa  PYRD_THEVO RecName: Full=Dihydroorotate dehydrogenase;       
   57::123     2e-04  33%  245 aa  HIS4_PSEPW RecName:
   57::123     2e-04  33%  245 aa  HIS4_PSEPK RecName:
   57::123     2e-04  33%  245 aa  HIS4_PSEP1 RecName:
  102::206     2e-04  29%  238 aa  HIS4_LACC3 RecName:
   60::123     2e-04  35%  243 aa  HIS4_ACIBS RecName:
   95::274     3e-04  24%  313 aa  PYRD_GEOTN RecName: Full=Dihydroorotate dehydrogenase;       
   57::123     3e-04  33%  245 aa  HIS4_PSEMY RecName:
   60::123     3e-04  35%  243 aa  HIS4_ACIBY RecName:
   60::123     3e-04  35%  243 aa  HIS4_ACIBT RecName:
   60::123     3e-04  35%  243 aa  HIS4_ACIBC RecName:
   60::123     3e-04  35%  243 aa  HIS4_ACIB5 RecName:
   60::123     3e-04  35%  243 aa  HIS4_ACIB3 RecName:
  654::709     3e-04  39% 1025 aa  DPYD_PONAB RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
  654::709     3e-04  39% 1025 aa  DPYD_HUMAN RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
   90::163     3e-04  30%  300 aa  PYRD_THEAC RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     3e-04  22%  309 aa  PYRD_BACAH RecName: Full=Dihydroorotate dehydrogenase;       
   60::123     3e-04  35%  243 aa  HIS4_SACD2 RecName:
   57::123     3e-04  33%  245 aa  HIS4_PSEAE RecName:
   57::123     3e-04  33%  245 aa  HIS4_PSEAB RecName:
   57::123     3e-04  33%  245 aa  HIS4_PSEA8 RecName:
   57::123     3e-04  33%  245 aa  HIS4_PSEA7 RecName:
  102::274     4e-04  27%  311 aa  PYRD_SULSY RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACHK RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACCZ RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACCR RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACCQ RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACC7 RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACC4 RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACC3 RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACC2 RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACC1 RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACC0 RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACAN RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACAC RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     4e-04  22%  309 aa  PYRD_BACAA RecName: Full=Dihydroorotate dehydrogenase;       
   64::124     4e-04  37%  245 aa  HIS4_NEIG2 RecName:
   64::124     4e-04  37%  245 aa  HIS4_NEIG1 RecName:
  654::800     4e-04  29% 1025 aa  DPYD_BOVIN RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
   68::122     6e-04  43%  252 aa  HIS6_CAMC5 RecName: Full=Imidazole glycerol phosphate synthase
   64::124     6e-04  37%  245 aa  HIS4_NEIMF RecName:
   64::124     6e-04  37%  245 aa  HIS4_NEIMB RecName:
   64::124     6e-04  37%  245 aa  HIS4_NEIMA RecName:
   64::124     6e-04  37%  245 aa  HIS4_NEIM0 RecName:
  642::804     6e-04  26% 1009 aa  DPYD_DICDI RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
  166::262     7e-04  28%  278 aa  YDJI_ECOLI RecName: Full=Uncharacterized protein ydjI;
  204::263     7e-04  27%  270 aa  PYRD_THEP1 RecName: Full=Dihydroorotate dehydrogenase;       
  204::263     7e-04  27%  270 aa  PYRD_THEMA RecName: Full=Dihydroorotate dehydrogenase;       
   60::123     7e-04  30%  245 aa  HIS4_MARAV RecName:
  143::235     7e-04  30%  241 aa  HIS4_GRAFK RecName:
   83::276     0.001  27%  301 aa  PYRD_THETN RecName: Full=Dihydroorotate dehydrogenase;       
   95::274     0.001  22%  309 aa  PYRD_BACWK RecName: Full=Dihydroorotate dehydrogenase;       
   93::276     0.001  24%  311 aa  PYRD_BACSU RecName: Full=Dihydroorotate dehydrogenase, catalytic
   57::121     0.001  31%  243 aa  HIS4_RUTMC RecName:
    1::337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxKKTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIHGNRARFLAYH
DUSA_VIBVU      --------------------RLSVAPMLDWTDRHCRYFHRLMTKETLLYTEMITTGAIIHG-KGDFLAYN
DUSA_VIBCH      --------------------RLSVAPMLDWTDRHCRYFHRLLSAQTLLYTEMVTTGAIIHG-RGDFLAYN
DUSA_VIBPA      --------------------RLSVAPMLDWTDRHCRYFHRLMTKETLLYTEMVTTGAIIHG-KGDFLAYN
DUSA_SHEON      ----------------------SIAPMLDWTDRHYRYFARLMSANALLYTEMVTTGAILHG-RGDYLTYN
DUSA_YERPE      --------------------RFSVAPMLDWTDRHCRYFHRLLTKQALLYTEMVTTGAIIHG-KADYLAYS
DUSA_SALTI      ------------------AYRFSIAPMLDWTDRHCRYFLRLLSRQTLLYTEMVTTGAIIHG-KGDYLAYS
DUSA_SALTY      ------------------AYRFSIAPMLDWTDRHCRYFLRLLSRQTQLYTEMVTTGAIIHG-KGDYLAYS
DUSA_HAEIN      --------------------RFSVAPMLDWTTRHCRYFHRQFSKHALLYTEMVTAPAIIHA-KYDHLDFD
DUSA_PASMU      --------------------RFSVAPMLDWTTRHCRYFHRQFSQHALLYTEMVTTGAIIHA-KYDHLEFS
DUSA_ECOL6      ------------------AYRFSIAPMLDWTDRHCRYFLRLLSRNTLLYTEMVTTGAIIHG-KGDYLAYS
DUS2_SYNY3      ---------------------LSVAPMMDHTDRHFRYFLRQLTRHTLLYTEMITAQAILHGDRQRLLNFS
DUSA_ECOLI      --------------------RFSVAPMLDWTDRHCRYFLRLLSRNTLLYTEMVTTGAIIHG-KGDYLAYS
DUSA_ECO57      --------------------RFSVAPMLDWTDRHCRYFLRLLSRNTLLYTEMVTTGAIIHG-KGDYLAYS
DUSA_SHIFL      --------------------RFSVAPMLDWTDRHCRYFLRLLSRNTLLYTEMVTTGAIIHG-KGDYLAYS
DUSA_PSEPK      --------------------RFSVAPMMDWTDRHCRFFLRLLSRQTLLYTEMVTTGALLHNDAHRFLRHD
DUSA_HAEDU      --------------------RFAVAPMLDWTTRHCRYFHRQFSQQALLYTEMITAPAILHA-KYDLLEYD
DUSA_PSEAE      --------------------RFSVAPMMDWTDRHCRFFLRQLSRHTLLYTEMVTTGALLHGDRQRFLRYD
DUSA_XANAC      ---------------YAASLRLSVAPMMDWTDRHCRVFHRLLAPSARLYTEMVHANAVIHGDRARLIGFD
DUSA_PSESM      --------------------RFSVAPMMDWTDHHCRYFMRLLSSQALLYTEMVTTGALLHGDRERFLRHD
DUSA_XANCP      -------------AAYADSLRLSVAPMMDWTDRHCRVFHRLLAPSARLYTEMVHANAVIHGDRQRLIGFD
DUSA_XYLFT      -------------------FRLSVAPMMNWTDRYCRVFHRVLAPSARLYTEMVHAKAVIYGDRERLLGFA
DUSA_XYLFA      -------------------FRLSVAPMMNWTDRYCRVFHRVLAPSARLYTEMVHAKAVIYGDRERLLGFA
DUS_RICPR       ----------IKIGNIELSSNVILAPMSDVTDLEFRKLVKRFG-AGLVVSEMIASRAMIMKSRQKCAIMH
DUSB_XANAC      ----------MQIGPYSIAPKVILAPMAGVTDKPFRLLCKRLG-AGLAVSEMTISDPRFWGTRK---SLH
DUS_AZOBR       ----------IQIGTISLEGPVILAPMSGVTDLPFRRLVKQ-SGCGLVVSEMVASQAMIRENRQRMVECE
DUS_RICFE       ----------IKIGDIELSSNVILAPMSDITDLEFRKLVKRFG-AGLVVSEMIASRAMVVKSRQKCAIVH
DUSB_XANCP      ----------MQIGPYTIAPKVILAPMAGVTDKPFRLLCKRLG-AGLAVSEMTISDPRFWGTRK---SLH
DUS_RICTY       ----------IKIGNIELSSNVILAPMSNITDLEFRKLVKRFG-AGLVVSEMIASRAMIMKSRQKCAIMH
DUSB_PSEAE      ----------VRIGPYTLPNRLILAPMAGVTDRPFRQLCRRLG-AGMVVSEMVTSDVRLWNSRSRLRLIH
DUS_RICCN       ----------IKIGNIELSSNIILAPMSGVTDLEFRRLVKRFG-AGLVVSEMVASRAMIVESRQKSAIMR
DUSB_PASMU      ----------MRIGSYQLKNRIFLAPMAGITDQP---FRRICTHAGLTFSEMMSTNPQVHTEKSKLLAHH
DUSB_HAEDU      ----------MRIGQYEINSRIFLAPMAGITDQP---FRRLCSQAGLTFSEMMSTNPDVHTEKSRLLAHH
DUSB_PROVU      ----------MRIGQYQLKNCLIAAPMAGVTDRPFRSLCYDMG-AGMTVSEMLSSNPQVQTDKSRLRMVH
DUS_RICBR       ----------IKIGNIELSSNIILAPMSGVTDLEFRRLVKRFG-AGLVVSEMIASRAMIVESRQKCSIMQ
DUSB_VIBVU      ----------MKIGNYQLKNKLIVAPMAGVTDRPFRE-LCLRYGAGMAVSEMMSSNPLWKTSKSKQRMVH
DUSB_HAEIN      ----------MRIGSYQLRNRVLLAPMAGITDQP---FRRLCAYAGLTFSEMMSTNPQVHTEKSKLRLAH
DUSB_SHEON      ----------MQIGPYQLKNQLIVAPMAGVTDQAFRN-LCLRYGAALAVSEMLSSNPEVWDDKSRQRMTH
DUSB_VIBCH      ----------MKIGNYQLKNNLIVAPMAGVTDRPFRE-LCLRYGAGMAVSEMMSCNALWKTAKSQNRMVH
DUSB_VIBPA      ----------MKIGNYQLKNNLIVAPMAGVTDRPFRE-LCLRYGAGMAVSEMMSANPLWKTSKSKQRMVH
DUS1_BACSU      ----------------------------------------MVSDKAILYNNARTMGMLYIDER-------
DUS_STAAN       -----------------------LAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFIHSVRGR-LTFS
DUS_STAAM       -----------------------LAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFIHSVRGR-LTFS
DUS_STAAW       -----------------------LAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFIHSVRGR-LTFS
DUS_STAAS       -----------------------LAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFIHSVRGR-LTFS
DUS_STAAR       -----------------------LAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFIHSVRGR-LTFS
DUS_STAAC       -----------------------LAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFIHSVRGR-LTFS
DUSC_PSESM      ----------------------------------------------------------------------
DUSB_KLEPN      ----------MRIGHYQLRNRLIAAPMAGITDRPFRTLCYEMG-AGLTVSEMMSSNPQVESDKSRLRMVH
DUSB_ERWCA      ----------MHIGQFQLTNRLIAAPMAGISDRPFRALCHAMG-AGMTVSEMLSSNPEVRSDKSRLRMVH
DUS_STAEQ       -----------------------LAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESYIHSVRGR-LTFS
DUSB_PSESM      ----------VRIGPYTVHNGLILAPMAGVTDQPFRQLCRQLG-AGLVVSEMVTSDSLWNSRKSRLRMIH
DUS_STAES       -----------------------LAPMEDVTNIVFRHVVSEAARPDVFFTEFTNTESYIHSVRGR-LTFS
DUS_AQUAE       -----------------KKGEVILAPMASYTHSAFRRLCRRLGADRT-YTELISAGVLRNGIPMKLAYFT
DUSC_PSEAC      -------------------------------------FIRVSERLLPAATYHKLAPELFNGSRTR-----
DUSB_ECOLI      ----------MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMG-AGLTVSEMMSSNPQVESDKSRLRMVH
DUSB_ECOL6      ----------MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMG-AGLTVSEMMSSNPQVESDKSRLRMVH
DUSB_ECO57      ----------MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMG-AGLTVSEMMSSNPQVESDKSRLRMVH
DUSB_SHIFL      ----------MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMG-AGLTVSEMMSSNPQVESDKSRLRMVH
DUSB_SALTY      ----------MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMG-AGLTVSEMMSSNPQVESDKSRLRMVH
DUSB_SALTI      ----------MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMG-AGLTVSEMMSSNPQVESDKSRLRMVH
DUSB_YERPE      ------------------------APMAGITDRPFRALCHGMG-AGMAVSEMLSSNPEVRTDKSRLRMVH
DUSC_SALTI      --------------------RVLLAPMEGVLDALVRELLTEVNDYDLCITEFVRVPELLHASRT------
DUSC_YERPE      ----------------------------------------------------------------------
DUSC_SHEON      --------------------RVILAPMEGVVDDLMRDILSSINPYDLLVTEFVRVVDQLLPEKV-FLGYT
DUSC_RALEH      --------------------------------------------------------------------YT
DUSC_SALTY      ----------------------------------------------------------------------
DUSC_SHIFL      ----------------------------------------------------------------------
DUSB_SERMA      ------------------------APMAGITDRPFRTLCHAMG-AGMAVSEMLSSNPEVRTDKSRLRMVH
DUS4L_HUMAN     -------KDPIEMFHSGQLVKVC-APMVRYSKLAFRTLVRKYSCD-LCYTPMIVAADFVKSIKARDSEFN
DUS1_YEAST      -----------------------VAPMVDQSELAWRILSRRYG-ATLAYTPMLHAKLFATSKKYRSLDGS
DUSC_ECO57      ----------------------------------------------------------------------
DUS2_BACSU      -----------------------LAPMEDVTDVVFRHVVSEAGRPDVFFTEFTNSESYCHPDRGR-LTFT
DUSC_VIBPA      ----------------------------------------------------------------------
DUSC_ECOLI      ----------------------------------------------------------------------
DUSC_ECOL6      ----------------------------------------------------------------------
DUSB_PSEPK      ----------VRIGQYTLRNNLILAPMAGVTDQPFRTLCQRLGAGXXXXXXXXXXXXLWNSRKSSLRRIH
DUSC_PSEPK      ----------------------------------------------------------------------
DUS4L_MOUSE     -------KDPIEMFHSGQLVKVC-APMVRYSKLAFRTLVRKYSCD-LCYTPMIIAADFVRSIKARDSEFN
DUSC_HAEDU      -------------------------------------FVRVVDQRLPKKTFYRLAPELLQGGLT------
DUSC_NEIMA      -----------QTTEPKQKTRIILAPMQGLVDDVMRDLLTRIGGYDECVSEFVRITHTVH-SRATWLKYV
DUS1_SYNY3      --------KPLQIGSLTLHSRVLQSPLSGVTDLVFRRLVRRYAPQAMLYTEMVSATEIHHRTLPQVMEID
DUS1L_RAT       -----------------------VAPMVDQSELAWRLLSR--RHGALCYTPMLHAQVFVRDANYRYCDVC
DUS_MYCTU       ------------------ASPVVLAPMAGVTNVAFRALCRQLEQSGLYVCEMVTARALIHPVTMHMTTFS
DUSC_HAEIN      --------------------RVILAPMQGVLDPFVRELLTEVNDYDLCITEFVRVVDQLLPEKVFYRGFT
DUSC_PSEAE      ----------------------------------------------------------------------
DUS1L_HUMAN     -----------------------VAPMVDQSELAWRLLSR--RHGALCYTPMLHAQVFVRDANYRYCEVC
DUSC_VIBVU      ----------------------------------------------------------------------
DUS_MYCLE       ----------------------------------------------LYVCEMVTARALVERNAVHMTTFA
DUSC_VIBCH      ----------------------------------------------------------------------
DUSC_RALSO      --------------------------------------------------------------------YT
DUS4_SCHPO      ------------------------APMVRYSKLPFRQLVRDYN-TDIVYTPMILAKEFLHPKGRYFFSTN
DUS1_SCHPO      ----------------------------------------------------------------------
DUSC_PASMU      ----------------------------------------------------------------------
DUS1L_MOUSE     -----------------------VAPMVDQSELAWRLLSR--RHGALCYTPMLHAQVFVRDANYRYCDVC
YQI2_CAEEL      ------------------------------------------------FTPMIYAKNFIESEKCRSLSVC
DUS3L_HUMAN     --------------------------------------------------EMAVCTNLLQGQMSEWLKRH
DUS3L_XENTR     --------------------------------------------------EMAMCTNLLQGQPSEWLKRH
DUS3L_XENLA     --------------------------------------------------EMAMCTNLLQGQPSEWLKRH
DUS3L_ORYSJ     --------------------------------------------------EMAMCTNLLQGQASEWLRRH
DUSC_NEIMB      --------------------RIILAPMQGLVDDVMRDLLTRIGGYDECVSEFVRITHTVH-SRSIWLKYV
DUS_RHOCA       ---------------------VLLAPMAGITDLP---FRRMVARAGLVVSEMVASGEMLTAKRAKAQAEL
DUS2L_MOUSE     --------------------------------------LKMLQCKRVVNEVLSTVDFVAPDDRVVFRTCE
DUS2L_HUMAN     --------------------------------------LKMIQCKRVVNEVLSTVDFVAPDDRVVFRTCE
DUS3_CRYNE      -------------------------------------------------SEMALAQPLVYGAKEEWVRRH
DUS_TREPA       ------------------------------------------------YTEMVSSEAMVRDNTKRLIRRA
DUS_RHILP       --------------------RVVLAPMSGVTDMPFRELAWRFG-AGLVVTEMVASRELVNDTAESWSRLK
DUS3L_RAT       --------------------------------------------------EMAMCTNLLQGQMSEWLKRH
DUS3L_ARATH     --------------------------------------------------EMAMCTNLLQGQASEWLRRH
DUS3L_DICDI     --------------------------------------------------EMALTTKLLEGTKSELLKRH
DUS3L_MOUSE     --------------------------------------------------EMAVCTNLLQGQMSEWLKRH
DUS3_ASHGO      ------------------------------------------------YSEMALAVPLIQGTNSEWALAH
DUS3_COPC7      --------------------------------------------------EMGLATSFLAGSKEEWVRRH
DUS3_USTMA      --------------------------------------------------EMGLAESFLHGNAAEWVRRH
DUS4_YEAST      ----------------------------------------------IVYSPMILAREYVRNEHARILSTN
DUS3_KLULA      ------------------------------------------------YSEMALAVPLIQGTNSEWALAH
DUS_HELPJ       --------------DFKNKKWLFLAPLAGYTDLPFRSVVKKFGVDVTT-SEMVSSHSLVYAKTSKMLEKS
DUS3_CANGA      ------------------------------------------------YSEMALAVPLVQGTNSEWALAH
DUS3_CANAL      ----------------------------------------------------------------------
DUS3_MALGO      --------------------------------------------------EMGMAESFLQGHASEWSLVR
DUS3_VANPO      ------------------------------------------------YSEMALAVPLIQGTNSEWALAH
DUS3_YEAST      ------------------------------------------------YSEMALAVPLIQGTNSEWALAH
DUS3_YEAS7      ------------------------------------------------YSEMALAVPLIQGTNSEWALAH
DUS2_SCHPO      -------------------------------------------------------------NKVLFRVHP
DUS3_PICST      ----------------------------------------------ITYSEMALSVPLLQATNAEWALAH
DUS_HELPY       --------------DFKNKKWLFLAPLAGYTDLPFRSVVKKFGVDVTT-SEMVSSHSLVYAKTSKMLEKS
DUS3_YARLI      ------------------------------------------------YGEMALTLPLIQGHKAEWALTH
DUS3_DEBHA      ------------------------------------------------YSEMALSVPLLQGTNAEWALAH
DUS3_MAGGR      ----------------------------------------------------------------------
PYRDB_ENTFA     ----------------------------------------------------------------------
PYRD_PYRKO      ----------------------------------------------------------------------
DUS3_PICGU      ------------------------------------------------YSEMALSLPLLQATNSEWALAH
HIS4_THICR      ----------------------------------------------------------------------
DUS3_NEUCR      ----------------------------------------------------------------------
HIS4_PSESM      ----------------------------------------------------------------------
DUS3_LODEL      ----------------------------------------------------------------------
DUS2_YEAST      -----------------------------------------------------------------FRTYP
DUS3_CHAGB      ----------------------------------------------------------------------
DUS3_BOTFB      ----------------------------------------------------------------------
PYRD_BACSK      ----------------------------------------------------------------------
HIS4_TERTT      ----------------------------------------------------------------------
HIS4_PSEU2      ----------------------------------------------------------------------
HIS4_PSE14      ----------------------------------------------------------------------
DUS3_SCLS1      ----------------------------------------------------------------------
PYRD_OCEIH      ----------------------------------------------------------------------
HIS4_PSEU5      ----------------------------------------------------------------------
HIS4_PSEFS      ----------------------------------------------------------------------
HIS4_CHRSD      ----------------------------------------------------------------------
DUS3_SCHPO      ----------------------------------------------------------------------
DUS3_ASPNC      ------------------------------------------------YSEMAMSLPLIQGNKSEWMRAH
PYRD_LISMO      ----------------------------------------------------------------------
HIS4_PSEF5      ----------------------------------------------------------------------
HIS4_LEUMM      ----------------------------------------------------------------------
PYRD_SYNWW      ----------------------------------------------------------------------
PYRD_LISMH      ----------------------------------------------------------------------
PYRD_LISMF      ----------------------------------------------------------------------
PYRD_LISMC      ----------------------------------------------------------------------
PYRD_LISIN      ----------------------------------------------------------------------
PYRD_ANOFW      ----------------------------------------------------------------------
PYRD_LISW6      ----------------------------------------------------------------------
HIS4_PSYCK      ----------------------------------------------------------------------
HIS4_PSYA2      ----------------------------------------------------------------------
HIS4_PSEE4      ----------------------------------------------------------------------
HIS4_LACCB      ----------------------------------------------------------------------
HIS4_AZOVD      ----------------------------------------------------------------------
HIS4_ACIAD      ----------------------------------------------------------------------
DUS3_ASPCL      ----------------------------------------------------------------------
PYRD_THEVO      ----------------------------------------------------------------------
HIS4_PSEPW      ----------------------------------------------------------------------
HIS4_PSEPK      ----------------------------------------------------------------------
HIS4_PSEP1      ----------------------------------------------------------------------
HIS4_LACC3      ----------------------------------------------------------------------
HIS4_ACIBS      ----------------------------------------------------------------------
PYRD_GEOTN      ----------------------------------------------------------------------
HIS4_PSEMY      ----------------------------------------------------------------------
HIS4_ACIBY      ----------------------------------------------------------------------
HIS4_ACIBT      ----------------------------------------------------------------------
HIS4_ACIBC      ----------------------------------------------------------------------
HIS4_ACIB5      ----------------------------------------------------------------------
HIS4_ACIB3      ----------------------------------------------------------------------
DPYD_PONAB      ----------------------------------------------------------------------
DPYD_HUMAN      ----------------------------------------------------------------------
PYRD_THEAC      ----------------------------------------------------------------------
PYRD_BACAH      ----------------------------------------------------------------------
HIS4_SACD2      ----------------------------------------------------------------------
HIS4_PSEAE      ----------------------------------------------------------------------
HIS4_PSEAB      ----------------------------------------------------------------------
HIS4_PSEA8      ----------------------------------------------------------------------
HIS4_PSEA7      ----------------------------------------------------------------------
PYRD_SULSY      ----------------------------------------------------------------------
PYRD_BACHK      ----------------------------------------------------------------------
PYRD_BACCZ      ----------------------------------------------------------------------
PYRD_BACCR      ----------------------------------------------------------------------
PYRD_BACCQ      ----------------------------------------------------------------------
PYRD_BACC7      ----------------------------------------------------------------------
PYRD_BACC4      ----------------------------------------------------------------------
PYRD_BACC3      ----------------------------------------------------------------------
PYRD_BACC2      ----------------------------------------------------------------------
PYRD_BACC1      ----------------------------------------------------------------------
PYRD_BACC0      ----------------------------------------------------------------------
PYRD_BACAN      ----------------------------------------------------------------------
PYRD_BACAC      ----------------------------------------------------------------------
PYRD_BACAA      ----------------------------------------------------------------------
HIS4_NEIG2      ----------------------------------------------------------------------
HIS4_NEIG1      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
HIS6_CAMC5      ----------------------------------------------------------------------
HIS4_NEIMF      ----------------------------------------------------------------------
HIS4_NEIMB      ----------------------------------------------------------------------
HIS4_NEIMA      ----------------------------------------------------------------------
HIS4_NEIM0      ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
YDJI_ECOLI      ----------------------------------------------------------------------
PYRD_THEP1      ----------------------------------------------------------------------
PYRD_THEMA      ----------------------------------------------------------------------
HIS4_MARAV      ----------------------------------------------------------------------
HIS4_GRAFK      ----------------------------------------------------------------------
PYRD_THETN      ----------------------------------------------------------------RELPFL
PYRD_BACWK      ----------------------------------------------------------------------
PYRD_BACSU      ----------------------------------------------------------------------
HIS4_RUTMC      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGRFGACLMAEPELVAECVAAMAQA
DUSA_VIBVU      QEEHPVALQLGGSNPQDLATCAKLAAERGYDEVNLNVGCPSDRVQNGRFGACLMAEPQLVADCVAAMKEV
DUSA_VIBCH      QEEHPVALQFGGSNPKDLAHCAKLAQERGYDEINLNVGCPSDRVQNGRFGACLMGEPDLVAECVAAMRAV
DUSA_VIBPA      EEEHPLALQLGGSNPEDLAKCAKLAQERGYDEINLNVGCPSDRVQNGRFGACLMAEPQLVADCVAAMKEV
DUSA_SHEON      QEEHPLALQLGGSNPVELARCAKLAAERGYDEVNLNVGCPSDRVQNGRFGACLMAEPELVAECVDAMKQV
DUSA_YERPE      EQDHPVALQLGGSDPQALAHCAKLAEQRGYNEINLNVGCPSDRVQNGRFGACLMGEADLVADCIKAMRDA
DUSA_SALTI      EEEHPVALQLGGSDPAQLAHCAKLAEARGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDV
DUSA_SALTY      EEEHPVALQLGGSDPAQLAHCAKLAEARGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDV
DUSA_HAEIN      LQENPVALQLGGSDPEQLKYCAKLAEERGYHEINLNVGCPSDRVQNGMFGACLMAKADLVADCVEQMQSA
DUSA_PASMU      PAENPVALQLGGSDPTQLAQCAKIAQQRGYTEINLNVGCPSDRVQNGMFGACLMAKADLVADCVSAMQTE
DUSA_ECOL6      EEEHPVALQLGGSDPXXXXXXXXXXXXRGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDV
DUS2_SYNY3      PEEKPVALQLGGDDPQLLAECARIGQDWGYDEINLNVGCPSDRVQSGNFGACLMAQPDLVAQCVSAMQKA
DUSA_ECOLI      EEEHPVALQLGGSDPXXXXXXXXXXXXRGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDV
DUSA_ECO57      EEEHPVALQLGGSDPXXXXXXXXXXXXRGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDV
DUSA_SHIFL      EEEHPVALQLGGSDPXXXXXXXXXXXXRGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDV
DUSA_PSEPK      ASEHPLALQLGGSVPADLAACARLAEEAGYDEVNLNVGCPSDRVQNNMIGACLMAHPALVADCVKAMRDA
DUSA_HAEDU      PAEQPVALQLGGSDPTQLANCAKLVQARGYTEINLNVGCPSDRVQNGMFGACLMANADLVADCIKAMQDV
DUSA_PSEAE      ECEHPLALQLGGSVPXXXXXXXXXXXXXGYDEVNLNVGCPSDRVQHNMIGACLMGHPALVADCVKAMLDA
DUSA_XANAC      PVEHPLALQLGGSDPXXXXXXXXXXXEWGFDEINLNCGCPSDRVQAGRFGACLMREPALVAECVAAMCAA
DUSA_PSESM      ETEHPXXXXXXXXXXXXXXXXXXXXXXXXYDEVNLNVGCPSDRVQNNMIGACLMAHPQLVADCVKAMRDA
DUSA_XANCP      AVEHPLALQLGGSDPXXXXXXXXXXXXWGYDEINLNCGCPSDRVQAGRFGACLMREPXXXXXXXXXXXXX
DUSA_XYLFT      SVEQPVALQLGGSEPALLAKAASIAVDWGYSEINLNCGCPSDRVQAGSFGACLMREPXXXXXXXXXXXXX
DUSA_XYLFA      SVEQPVALQLGGSEPALLAKAARIAVDWGYSEINLNCGCPSDRVQAGSFGARLMREPXXXXXXXXXXXXX
DUS_RICPR       DDPTSACVQLAGCEPDVIAEAAKMNEDMGAKIIDLNFGCPAKKVVGGYAGSALMRDEQLAAKIFEATVKA
DUSB_XANAC      RMDHPISVQIAGTEPQQLAEAARYNVDHGAQLIDINMGCPAKKVCNAWAGSALMRDEELVARILTAVVQA
DUS_AZOBR       PEQFPMAVQLAGCEPDVMAEAAKLNEDRGAAIIDINFGCPVKKVVNGHAGSSLMRDEALAARILEATAKA
DUS_RICFE       DDPTSACVQLAGCEPNVIAEAAKMNEDMGAKIIDLNFGCPAKKVVGGYAGSALMRDEQLAAKIFEATVKA
DUSB_XANCP      RMDHPISVQIAGTEPQQLAEAARYNVDHGAQLIDINMGCPAKKVCNAWAGSALMRDEDLVARILSAVVRA
DUS_RICTY       DDPTSACVQLAGCEPDVIADAAKMNEDMGAKIIDLNFGCPAKKVVGGYAGSALMRDERLATKIFEATVKA
DUSB_PSEAE      DGEEPRSVQIAGGDPAMLAEAAQRNVELGAQIIDINMGCPAKKVCNKAAGSALLRDEALVAEILDAVVRA
DUS_RICCN       DDATSACVQLAGCEPNVIAEAAKMNEGMGAKIIDLNFGCPAKKVVGGYSGSALMKDEQLAAKIFEATVEA
DUSB_PASMU      QEAGINAVQIAGCDPDEMAKAAQINVEYGAEIIDINMGCPAKKVNRKMAGSALLQYPDLVKQILNKVVKS
DUSB_HAEDU      AEIGINAVQIAGSEPTEIAEAAKINVAYGAQIIDINMGCPAKKVNKKMAGSALLREPQLVARILDAVVNA
DUSB_PROVU      SDELGISVQIAGSDPVDMAAAAKINADSGAQIIDINMGCPAKKVNKKLAGSALLRHPDLVAEILSAVVNA
DUS_RICBR       DDATSACVQLAGCEPNVIAEAAKMNEDMGAKIIDLNFGCPAKKVVNGYSGSALMRDEGLAAKIFEAAVKA
DUSB_VIBVU      EGESGISVQIAGSDPQLMADAAQFSVENGAQIIDINMGCPAKKVNKKLAGSALLKYPDIIEQILKAVVDA
DUSB_HAEIN      SEDLGLAVQIAGSDPLEMAQAAAINVEYGAQIIDINMGCPAKKVNRKLAGSALLQFPDLVEKILREVVSA
DUSB_SHEON      SGEEGISVQIAGADPELMAQAAQFNVEQGAHIIDINMGCPAKKVNKKLAGSALMQNPPLVKDILQAVVAA
DUSB_VIBCH      EGESGISVQIAGSDPQLMAEAAQFSVENGAQIIDINMGCPAKKVNKKLAGSALLRYPDVIEDILKAVVNA
DUSB_VIBPA      EGESGISVQIAGSDPQLMADAAQFSVENGAQIIDINMGCPAKKVNKKLAGSALLQYPTIIEEILKAVVNA
DUS1_BACSU      --EKPLSLQIFGGKKETLVEAAKFVDNTTADIIDINMGCPVPKITKCDAGAKWLLDPDKIYEMVSAVVDA
DUS_STAAN       EDEHPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILRPDVAAEIIQA-TKA
DUS_STAAM       EDEHPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILRPDVAAEIIQA-TKA
DUS_STAAW       EDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILRPDVAAEIIQA-TKA
DUS_STAAS       EDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILRPDVAAEIIQA-TKA
DUS_STAAR       EDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILRPDVAAEIIQA-TKA
DUS_STAAC       EDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILRPDVAAEIIQA-TKA
DUSC_PSESM      ----PLRLQLLGSDPVCLAENAAFACELGAPVLDLNFGCPAKTVNRSRGGAILLKEPELLHTIVSQVRRA
DUSB_KLEPN      VDEPGITVQIAGSVPKEMAAAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDQVKSILTAVVKA
DUSB_ERWCA      SDEPGIAVQIAGCDPDEMAAARRINADSGAQIIDINMGCPAKKVNRKMAGSALLQYPDLVKQILSTVVKA
DUS_STAEQ       DDEQPMVAHIWGDKPEQFREMSIGLADMGFKGIDLNMGCPVANVAKKGKGSGLILRPETAAEIIQA-SKA
DUSB_PSESM      AGDEPRSVQIXXXXXXXXXXXXXXNVELGAQIIDINMGCPAKKVCNKAAGSALLKDEQLVNDILQAVVAA
DUS_STAES       DDEQPMVAHIWGDKPEQFREMSIGLADMGFKGIDLNMGCPVANVAKKGKGSGLILRPETAAEIIQA-SKA
DUS_AQUAE       EEERPIHIQVFGSNPEEIAQASVIAKELKPDFIDINFGCSVPKVLRNKAAGYMLQCPPLMGEVVKETVEA
DUSC_PSEAC      -AGTPMRVQFLGSDPQCLADNAAFACTLGAPVIDLNFGCPAKTVNKSRGGAVLLKEPELLHAIVREVRRT
DUSB_ECOLI      IDEPGITVQIAGSDPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNA
DUSB_ECOL6      IDEPGITVQIAGSDPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNA
DUSB_ECO57      IDEPGITVQIAGSDPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNA
DUSB_SHIFL      IDEPGITVQIAGSAPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNA
DUSB_SALTY      VDEPGITVQIAGSDPVEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDLVKSILIGVVNA
DUSB_SALTI      VDEPGITVQIAGSDPVEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDLVKSILIGVVNA
DUSB_YERPE      VDEPGIRVQIAGNDPDEMAAAARINVASGAQIIDINMGCPAKKVNRKLAGSALLQHPDLVKQILSAVVNA
DUSC_SALTI      PSGTPVRIQLLGQHPQWLAENAARATALGSYGVDLNCGCPSKVVNGSGGGATLLTDPELIYQGAKAMRAA
DUSC_YERPE      -------IQLLGQYPEWLAENAARAVALGSYGVDLNCGCPSKLVNGSGGGATLLKDPELIYQGAKAMRAA
DUSC_SHEON      PSGTPVRVQLLGQEPNCMAENAMRAIELGSHGVDANFGCPAKMVNRSNGGAVLLQYPNTIHDIVRAMRQA
DUSC_RALEH      RSGTPMVIQLLGSDPEWLARNAAYAATLSPHGIDLNFGCPAKVVNRHGGGAMLLTNPELLNRIVASVRAA
DUSC_SALTY      ----PVRIQLLGQHPQWLAENAARATALGSYGVDLNCGCPSKVVNGSGGGATLLKDPELIYQGAKAMRAA
DUSC_SHIFL      -------VQLLGQFPQWLAENAARAVELGFWGVDLNCGCPSKTVNGSGGGATLLKDPELIYQGAKAMREA
DUSB_SERMA      SDEPGISVQIAGCDPDDMAAAARINVASGAQLIDINMGCPAKKVNRKLAGSALLQYPDLVKRILHAVVDA
DUS4L_HUMAN     QGDCPLIVQFAANDARLLSDAARIVCPYA-NGIDINCGCPQRWAMAEGYGACLINKPELVQDMVKQVRNQ
DUS1_YEAST      SVDRPLVVQFCANDPEYLLAAAKLVEDK-CDAVDLNLGCPQGIAKKGHYGSFLMEEWDLIHNLINTLHKN
DUSC_ECO57      -------VQLLGQFPQWLAENAARAVELGSWGVDLNCGCPSKTVNGSGGGATLLKDPELIYQGAKAMREA
DUS2_BACSU      EDEQPIVAHIWGDKPENFRKMSIGMAELGFKGLDINMGCPVPNVAGNGKGSGLICRPAVAAELIQA-AKA
DUSC_VIBPA      ----PVHVQLLGQEPHWMAENAIRAAELGARGIDLNFGCPAKMVNKSKGGAALLQHPELIHSVVKACRDA
DUSC_ECOLI      -------VQLLGQFPQWLAENAARAVELGSWGVDLNCGCPSKTVNGSGGGATLLKDPELIYQGAKAMREA
DUSC_ECOL6      -------VQLLGQFPQWLAENAARAVELGSWGVDLNCGCPSKTVNGSGGGATLLKDPELIYQGAKAMREA
DUSB_PSEPK      EGDEPRSVQIXXXXXXXXXXXXXXXXXXXXQIIDINMGCPAKKVCNKAAGSALLRDEALVSEILHAVVSA
DUSC_PSEPK      ----PMRVQLLGSDPVXXXXXXXXXXXXXXPVIDLNFGCPAKTVNKSRGGAVLLKEPELLHAIVREVRRA
DUS4L_MOUSE     QGDCPLIVQFAANDARLLSDAALLVCPYA-NGIDINCGCPQRWAMADGYGACLINKPELVHDMVRQVRNR
DUSC_HAEDU      DSGTPIRVQLLGQYPQWLAENAQLAIELGSYGIDFNCGCPSKTVNGSHGGAALLKDPELIYCATKAIREA
DUSC_NEIMA      PSGTPCTVQLLGSDADNMAANALEAVRFGADKIDLNFGCPAPTVNRHKGGAILLKEPELIFHIVKTLREP
DUS1_SYNY3      PRENPISIQLFDCRPDFMXXXXXXXXXXXXXSVDINMGCPVNKITKKGGGSSLLRQPAVAEAIXXXXXXX
DUS1L_RAT       PEDRPLIVQFCANDPEVFVQAALLAQDY-CDAIDLNLGCPQMIAKRGRYGAFLQEEWDLLQRMILLAHER
DUS_MYCTU       ADESPRSLQLYTVDPDTTYAAARMIAGEGLDHIDMNFGCPVPKVTKRGGGAALPFKRRLFGQIVAAAVRA
DUSC_HAEIN      SSGTPVRVQLLGQHPKCLAENAIRAIDLGSHGIDLNCGCPSKTVNGSNGGAALLKQPELIYRATQALRRA
DUSC_PSEAE      ----PMRVQLLGSDPACLADNAAFACELGAPVIDLNFGCPAKTVNRSRGGAVLLKEPELMHDIVAAVRRA
DUS1L_HUMAN     PEDRPLIVQFCANDPEVFVQAALLAQDY-CDAIDLNLGCPQMIAKRGHYGAFLQDEWDLLQRMILLAHEK
DUSC_VIBVU      KNGVPVKVQLLGQDPHWMAENAIRAAQLGAHGIDLNFGCPAKMVNQSKGGAALLQHPELIYQVVKACRDA
DUS_MYCLE       PDESPRSLQLYTVDPATTYTAAKMVADEGLDHIDMNFGCPMPKVTRRGGGAALPYKRRLFGQIVAAAVRA
DUSC_VIBCH      ----PVKVQLLGQDPHWMAENAIRAAELGAYGIDLNFGCPAKMVNQSKGGAALLQHPELIYQVVKACRDA
DUSC_RALSO      ASGTPMVIQLLGSDPEWLARNAAQAATVSPHGIDLNFGCPAKVVNRHGGGAMLLATPELLHRIVSTVRAA
DUS4_SCHPO      DADASLILQFGVDDPVILEKAAQLVGPY-VDGIGINCGCPQTWAIQEGIGSALLDEPEKVHKLVRAVKSG
DUS1_SCHPO      --ERPLIIQFCGNDPEIMLKAAKIAAPY-CDAVDVNLGCPQGIAKKGKYGSFLQENWNLIESIITKLHTE
DUSC_PASMU      ----PVRVQLLGQHPQWLAENAQRAIELGSHGIDLNCGCPSKTVNGSNGGASLLKQPELIYHATKALRAA
DUS1L_MOUSE     PEDRPLIVQFCANDPEVFVQAALLAQDY-CDAIDLNLGCPQMIAKRGHYGAFLQEEWDLLQRMILLAHER
YQI2_CAEEL      EGDSPLIVQFATDDPFVLSEAAEMVYKCSTG-VDLNCGCPKHDVRSKGFGSALLSKPELLADMVRARIPD
DUS3L_HUMAN     QCEDIFGVQLEGAFPDTMTKCAELSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQV
DUS3L_XENTR     HSEDIFGVQLEGAFPDTMTKCAELLNTIDVDFVDINVGCPIDLVYKKGGGCGLMNRTNKFEQIVKGMNSV
DUS3L_XENLA     HSEDIFGVQLEGAFPDTMTKCAELLNTIDVDFVDINVGCPIDLVYKKGGGCGLMNRTNKFEQIVKGMNSV
DUS3L_ORYSJ     SSEDLFGVQICGAYPDTVARTVELVDECSVDFIDINMGCPIDIVVNKGAGSSLLTKPMRIKSIVQAASTV
DUSC_NEIMB      PSGTPCTVQLLGSDADNMAANALEAVRFGANKIDLNFGCPAPTVNKHKGGAILLKEPELIFHIVKTLRLP
DUS_RHOCA       TAGLPTSVQLXXXXXXXXXXXXXXXXDMGAEIIDINMGCPAKKVTGGLSGAALMRNPDHALRLIEAVVGA
DUS2L_MOUSE     REQSRVVFQMGTSDAERALAVARLVEN-DVAGIDVNMGCPKEYSTKGGMGAALLSDPDKIEKILSTLVKG
DUS2L_HUMAN     REQNRVVFQMGTSDAERALAVARLVEN-DVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKILSTLVKG
DUS3_CRYNE      ESEKMFGVQVAGGFPNRMVPAAEVIANTGVDFVDVNMGCPIDLVFNQGAGSALMDSPGRLGKLLVGMNRA
DUS_TREPA       SNETHYAIQIFGSNPAVMAETAKLIVDSAQPSIDINAGCPMPKITKTGAGAALTREPTRLYEVVKAVADA
DUS_RHILP       AAGRPHMVQLAGREAHWMXXXXXXXXXXXXXXXXXNMGCPAKKVIGGYSGSALMRDPDHALGLIEATVKA
DUS3L_RAT       PCEDIFGVQLEGAFPDTMTKCAELLNTIDVDFVDINVGCPIDLVYKKGGGCALMNRSAKFQQIVRGMNEV
DUS3L_ARATH     SSEDLFGVQICGSYPDTVSRVVELIDECTVDFIDINMGCPIDMVVNKSAGSALLNKPLRMKNIVEVSSSI
DUS3L_DICDI     PCEDKFGVQICGSYVDAAVKCAEFIEEIDADFVDINSGCPIDLVCNMGAGAALMERPKKVEQLLRGISSS
DUS3L_MOUSE     PCEDIFGVQLEGAFPDTMTKCAELLNTIDVDFVDINVGCPIDLVYKKGGGCALMNRSAKFQQIVRGVNGV
DUS3_ASHGO      CSELPFGVQLACSKPWQAAKAAEALADNGLSEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYV
DUS3_COPC7      PSEKIFGIQVAGNKPHTLVPTAEVAKEFGVDFVDLNCGCPIDLVFKAGSGSALLDNAGKLGKIIQGMNRA
DUS3_USTMA      ESERIFGTQLCGGKPDLLALKAEVGD--GLDFVDINCGCPIDLVFNKGAGSALLDHPTKLSKIVRGMAVL
DUS4_YEAST      NEDTPLIVQVGVNNVADLLKFVEMVAPY-CDGIGINCGCPIKEQIREGIGCALIYNSDLLCSMVHAVKDK
DUS3_KLULA      CSEFPFGVQIACSKTWQXXXXXXXXXXNGVSEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNGMNYS
DUS_HELPJ       PLEDHFMAQISGS--KESVVKEAVEKINALDHVSFNCGCPAPKVANHGNGSGLLKDLNHLVEILKVIREN
DUS3_CANGA      ESEYPFGVQVACSKGWQASKAAEALATYGISEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYV
DUS3_CANAL      -------------------------------ELNLNCGCPIDLLYKQGQGSALLDQPSKLLRILSGMASS
DUS3_MALGO      RGERIFGTQVCGAKPELLVPTAEVLAGRGLDFVDVNCGCPIDLVYNKGAGSALLDHANKLGRIVRGMSEA
DUS3_VANPO      STEIPFGVQIXXXXXXXXXXXXXXXXXFTPDEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYV
DUS3_YEAST      TSEFPFGVQVXXXXXXXXXXXXXXXXNSEISEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYV
DUS3_YEAS7      TSEFPFGVQVXXXXXXXXXXXXXXXXNSEISEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYV
DUS2_SCHPO      LEANRLIFQLGSASPELAVEAAKLVAN-DVAGIDLNCGCPKHFSVHAGMGAGLLKNQDRLVSILDALVNE
DUS3_PICST      RTEYPYGVQIATSKHWAAAKVAEIIETEHVSELNLNCGCPIDLLYRQGQGSALLEQPARLVRILKAMASS
DUS_HELPY       PLEDHFMAQISGS--KESVVKEAVEKINALEHVNFNCGCPAPKVANHGNGSGXXXXXXXXXXXXXTIREN
DUS3_YARLI      SSENHFGVQVTAPKHWQAIKAAQAVSELGISEINLNCGCPIDLVYRQGAGSALMDQQGKTARIVRGMSMV
DUS3_DEBHA      RTEYPYGVQIATSKXXXXXXXXXXXXXTHVSELNLNCGCPIDLLYRQGQGSALMEQPARLLRILKGMASS
DUS3_MAGGR      --------------------------------IDLNCGCPIDMIYKAGAGSALLEQHNKIERIIRGMAVS
PYRDB_ENTFA     ----PIIANVAGACEEDVAVCAKIGQAPNVKAIELNISCPN--VKHG--GIAFGTDPEVAFQLTQAVKKV
PYRD_PYRKO      --DFPLIVSIFGGTPEEFAFLAEKLSEVA-DAFELNLSCPHAK----GYGMEIGQKPENVYAVVKAVKDA
DUS3_PICGU      SSEYPFGVQIATSKHWXXXXXXEVIETTHVSELNLNCGCPIDLLYRQGQGSALMEQPARLLRILKGMASS
HIS4_THICR      ----------------------------------------------------------------------
DUS3_NEUCR      --------------------------------IDLNCGCPIDMVYKSGAGSALLDAPSKLERMIRGMNTV
HIS4_PSESM      ----------------------------------------------------------------------
DUS3_LODEL      -------------------------------EINLNCGCPIDLLKQGQGSALLDSPPRLIRIVKAMNASS
DUS2_YEAST      KLESSLIFQIGSASPA-LATQAALKVINDVSGIDINAGCPKHFSIHSGMGSALLRTPDILKELVKNVGNP
DUS3_CHAGB      --------------------------------VDLNCGCPVDAVFKSGSGSALLDSHSKLERMIRGMAVS
DUS3_BOTFB      --------------------------------IDLNCGCPIELVYRQGAGSALLDAPSKLEKMIRGMAVS
PYRD_BACSK      ----PILANIAGSTMDDIEVAAELSQQRNVSAIELNISCPNVKQGGIAFGTV----PEIAAELTKEVKAV
HIS4_TERTT      ----------------------------------------------------------------------
HIS4_PSEU2      ----------------------------------------------------------------------
HIS4_PSE14      ----------------------------------------------------------------------
DUS3_SCLS1      --------------------------------IDLNCGCPIELVYRQGAGSALLDAPSKLEKMIRGMAVS
PYRD_OCEIH      KYDTSIIANIAGSSIEEYEVAASFNQTTDVDALELNISCPNVKEGGIQFG----TDPFMAKKVTEVVKKA
HIS4_PSEU5      ----------------------------------------------------------------------
HIS4_PSEFS      ----------------------------------------------------------------------
HIS4_CHRSD      ----------------------------------------------------------------------
DUS3_SCHPO      ----------------------------GVDFLDLNCGCPIDLVFRQGAGSSLLENPGRLLRNLQGMAVS
DUS3_ASPNC      ESEMLPPTMLPGANSKDMKFGAQIAANKPWQAIDLNCGCPIDLVFKDGAGSALLEHPSKLEKIIRGMTVS
PYRD_LISMO      --ETPIIANVAGATEDDVQVCARIGESKAVKAIELNISCPN--VKHG--GIAFGTDPEVAHRLTKAVKNV
HIS4_PSEF5      ----------------------------------------------------------------------
HIS4_LEUMM      ------------------------------EQVNQYLNIGINRVI---IGSAALTHPELVRTAVAKYGSD
PYRD_SYNWW      ---------IAGNSIEEYALMASLLQGQGIAGIELNISCPNVKQGGIQFGT----DPETVRQVVAAVKKE
PYRD_LISMH      --ETPIIANVAGATEDDVQVCARIGESKAVKAIELNISCPN--VKHG--GIAFGTDPEVAHRLTKAVKNV
PYRD_LISMF      --ETPIIANVAGATEDDVQVCARIGESKAVKAIELNISCPN--VKHG--GIAFGTDPDVAHRLTKAVKNV
PYRD_LISMC      --ETPIIANVAGATEDDVQVCARIGESKAVKAIELNISCPN--VKHG--GIAFGTDPDVAHRLTKAVKNV
PYRD_LISIN      --ETPIIANVAGATEDDVQVCSRIGESKAVKAIELNISCPN--VKHG--GIAFGTDPEVAHRLTKAVKSV
PYRD_ANOFW      ----PIIANVAGSTVEEVEVAKRISKAPNVHALELNISCPNVKKGGIAFGTV----PEVAAELTRAVKEV
PYRD_LISW6      --ETPIIANVAGATEDDVEVCSRIGESKAVKAIELNISCPN--VKHG--GIAFGTDPEVAHRLTKAVKSV
HIS4_PSYCK      ----------------------------------------------------------------------
HIS4_PSYA2      ----------------------------------------------------------------------
HIS4_PSEE4      ----------------------------------------------------------------------
HIS4_LACCB      -------------------------------------------------GSAAVSDPDLVEQAIARFG-S
HIS4_AZOVD      ----------------------------------------------------------------------
HIS4_ACIAD      ----------------------------------------------------------------------
DUS3_ASPCL      --------------------------------IDLNCGCPIDQVYRDGAGSALLDHQSKLEKILRGMAVS
PYRD_THEVO      EAKRPIIGSVFAYNAEEFTKLSVKMEEYGVDAIELNLSCPHVK----GFGLEVGSDPDLVEDIVNEIKSK
HIS4_PSEPW      ----------------------------------------------------------------------
HIS4_PSEPK      ----------------------------------------------------------------------
HIS4_PSEP1      ----------------------------------------------------------------------
HIS4_LACC3      -------------------------------------------------GSAAVSDPDLVEQAIARFG-S
HIS4_ACIBS      ----------------------------------------------------------------------
PYRD_GEOTN      ----PIIANIAGSTMEEVEVAAAISKAPNVHALELNISCPNVKKGGIAFGTV----PEVAAELTRLVKEV
HIS4_PSEMY      ----------------------------------------------------------------------
HIS4_ACIBY      ----------------------------------------------------------------------
HIS4_ACIBT      ----------------------------------------------------------------------
HIS4_ACIBC      ----------------------------------------------------------------------
HIS4_ACIB5      ----------------------------------------------------------------------
HIS4_ACIB3      ----------------------------------------------------------------------
DPYD_PONAB      ---------------------AKKSEDSGADALELNLSCPHGMGERGMGLAC-GQDPELVRNICRWVRQA
DPYD_HUMAN      ---------------------AKKSEDSGADALELNLSCPHGMGERGMGLAC-GQDPELVRNICRWVRQA
PYRD_THEAC      RSGKPVIGSVFASDAESFVNLGRKMQEYGCDAVELNLSCPHVK----GFGLEVGSDPDLVEDIVNEMKSK
PYRD_BACAH      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
HIS4_SACD2      ----------------------------------------------------------------------
HIS4_PSEAE      ----------------------------------------------------------------------
HIS4_PSEAB      ----------------------------------------------------------------------
HIS4_PSEA8      ----------------------------------------------------------------------
HIS4_PSEA7      ----------------------------------------------------------------------
PYRD_SULSY      ----------GEDEDEYLAVAERLDKADGVHGLELNVSCPN--VKKG--GIAFGTDPEVLYNLVYKMKKI
PYRD_BACHK      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACCZ      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACCR      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACCQ      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACC7      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACC4      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACC3      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACC2      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACC1      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACC0      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACAN      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACAC      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACAA      ----PIIANVAGSQAEDVAVAKEISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
HIS4_NEIG2      ----------------------------------------------------------------------
HIS4_NEIG1      ----------------------------------------------------------------------
DPYD_BOVIN      ---------------------SRKAEASGADALELNLSCPHGMGERGMGLAC-GQDPELVRNICRWVRQA
HIS6_CAMC5      ----------------------------------------------------------------------
HIS4_NEIMF      ----------------------------------------------------------------------
HIS4_NEIMB      ----------------------------------------------------------------------
HIS4_NEIMA      ----------------------------------------------------------------------
HIS4_NEIM0      ----------------------------------------------------------------------
DPYD_DICDI      -----------GFNKEDWTQLAKMAEASGADGIELNLSCPHGMGEKGMGLAC-GQDTELVFHICQWVRAA
YDJI_ECOLI      -------------------------------------GCDSLAVAIGNQHGVYTSEPQLNFEVVKRVRDA
PYRD_THEP1      ----------------------------------------------------------------------
PYRD_THEMA      ----------------------------------------------------------------------
HIS4_MARAV      ----------------------------------------------------------------------
HIS4_GRAFK      ----------------------------------------------------------------------
PYRD_THETN      KSDVPVIVNIAGETVEEFVYMAEKLDIEGIEGIEINVSCPNVKKGGMAFG----VNPDDIFDITRKVRKA
PYRD_BACWK      ----PIIANVAGSQAEDVAVAKAISKAPNVHALELNISCPNVKTGGIAFGT----NPEIAADLTKRVKEV
PYRD_BACSU      ----PIIANVAGSQVDDYVEVAEISKAPNVHALELNISCPNVKTGGIAFGT----NPEMAADLTKAVKEV
HIS4_RUTMC      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TQIPVTVKTRIGIDEQDSYEALDHFISTVAQAGCRTFIIHARKAWLQGLSPKENREKPPLRYDVVRTIKQ
DUSA_VIBVU      VDIPVTVKTRIGIDDQDSYEFLTDFVSIVSEGGCEQFTIHARKAWLSGLSPKENREIPPLDYPRAYQLKK
DUSA_VIBCH      VDIPVTVKTRIGIDDQDSYEFLTQFIATVAEGGCEQFTIHARKAWLSGLSPKENREIPPLDYPRAYQIKR
DUSA_VIBPA      VDVPVTVKTRIGIDDQDSYEFLTDFVSIVSEGGCEQFTIHARKAWLSGLSPKENREIPPLDYPRAYQLKQ
DUSA_SHEON      VDIPVTVKTRIGIDEQDSYEFLTHFIDTVMAKGCGEFIIHARKAWLQGLSPKENREIPPLDYDRVYQLKR
DUSA_YERPE      VAIPVTVKTRIGIDQLDSYEFLCEFVQTVAERGCEIFTIHARKAWLSGLSPKENREVPPLDYERVYQLKR
DUSA_SALTI      VSIPVTVKTRIGIDDQDSYAFLCDFINTVSQGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKR
DUSA_SALTY      VSIPVTVKTRIGIDDQDSYAFLCDFIDTVSQGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKR
DUSA_HAEIN      VKIPVTVKTRIGIDELDSYEFLCDFIEKVQGKGCQEFIIHARKAWLSGLSPKENREIPPLDYIRVYQLKR
DUSA_PASMU      VSIPVTVKTRIGIDDLDSYEFLCEFVQKVHEAGCQEFIIHARKAWLSGLSPKENREIPPLDYERVYQLKR
DUSA_ECOL6      VSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGCEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKR
DUS2_SYNY3      VEIPVTVKHRIGIDHRDSYEDLVHFVEIVANAGCQRFTVHARKAWLQGLSPKENRTIPPLRYEDVYQLKK
DUSA_ECOLI      VSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGCEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKR
DUSA_ECO57      VSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGCEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKR
DUSA_SHIFL      VSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGCEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKR
DUSA_PSEPK      VSTPVTVKHRIGINGRDSYAELSDFVGQVREAGCRSFTVHARIAILEGLSPKENREIPPLRYDIAAQLKR
DUSA_HAEDU      VDIPVTIKHRIGIDTLDSYAFLCDFIDKI-QPYSQDFIVHARKAWLSGLSPKENREIPPLDYERVYQLKR
DUSA_PSEAE      VEIAVTVKHRIGINGRDSYAELCDFVGQVREAGCRSFTVHARIAILEGLSPKENREVPPLRYEVAAQLKK
DUSA_XANAC      THLPITVKCRLGVDDDDDYALFARFVDQXXXXXXXXXXXXXRNAWLKGLSPKENREVPPLRYDWAYRLKQ
DUSA_PSESM      VGIPVTVKHRIGINGRDSYAELCDFVGTVHDAGCQSFTVHARIAILEGLSPKENRDIPPLRYDVVAQLKT
DUSA_XANCP      XXXPVTVKCRLGVDDDDDYAVFAGFIDQXXXXXXXXXXXXXRNAWLKGLSPKENREVPPLRYDWAYRLKQ
DUSA_XYLFT      XXXXXXXKCRLGVNEDDDYGRFAKFVDVIGASSSRMIVVHARNAWLQGLSPKENREIPPLRYDWVYRLKR
DUSA_XYLFA      XXXXXXXKCRLGVNEDDDYGRFAKFVDWVSRASSRMIVVHARNAWLQGLSPKENREIPPLRYDWVYRLKR
DUS_RICPR       VKIPVTVKMRIGWD--DNTRNAPTLAKIAANSGVQMVTVHGRTR-CQFYSGNAN-------WDFIRTVKE
DUSB_XANAC      VNVPVTLKIRTGWD-------CDHTIARIAQCGIAALAVHGR--------TRDQHYTGSAEYATIAQIKA
DUS_AZOBR       VTIPVTLKMRKGWD--DSSLNAPRLARIAEECGIKLVTVHGR--------TREQFYNGTADWSFIRSVKE
DUS_RICFE       VKIPITVKMRMGWD--DNTKNAPDLAKIAESSGVQMVTVHGRTR-CQFYSGNAD-------WDFIRSVKE
DUSB_XANCP      VDVPVTLKIRTGWD-------CDHTIARIAQCGIAALAVHGR--------TRDQHYTGTAEYATIAQIKA
DUS_RICTY       VKIPVTVKMRMGWD--DNTKNAPTLAVIAASSGVQMVTVHGRTR-CQFYSGNAN-------WDFIRVVKE
DUSB_PSEAE      VDVPVTLKIRTGWDRDNRNGVT--VAKLAEQAGIQALAVHGR--------TRADLYTGEAEYETIAAIKQ
DUS_RICCN       VKLPVTVKMRMGWD--DNTKNAPTLAKIAESSGVQMITVHGRTR-CQFYSGNAD-------WDFIRSVKE
DUSB_PASMU      VTVPVTLKIRTGWD-KDNRNCLE--IAKIAQCGIQALTIHGR--------TRSCMFEGEAEYDNIKAVKE
DUSB_HAEDU      VDVPVTLKIRTGWDK--THKNFLQIAKIAEKAGISALTIHGR--------TRDCLFNGQAEYESIKAVKQ
DUSB_PROVU      VDVPVTLKIRTGPDERNCVE----IAKLAERCGIQALTIHGR--------TRECLFKGEAEYDSIRTVKQ
DUS_RICBR       VKIPVTVKMRMGWDDQT--KNAPTLAKIAERSGIQMVTVHGRTR-CQFYSGNAD-------WEFIKNVKE
DUSB_VIBVU      VDVPVTLKTRTGWDTEN--KNCIHIAKLAEDCGIQALALHGR--------TKACMYKGEAEYDSIKAVKQ
DUSB_HAEIN      VNVPVTLKIRTGWDK--SNRNCVQIGKIAEQCGIQALTVHGR--------TRACLFEGEAEYDNIKAVKQ
DUSB_SHEON      VDVPVTLKIRTGWEPEHRNGVQ---IAQIAECGIASLAVHGR--------TRQCMYKGNAEYDTIKAIKQ
DUSB_VIBCH      VNVPVTLKTRTGWD-TDNKNCLS--IAQLAECGIQALALHGR--------TRACMYKGEAEYDSIKAVKA
DUSB_VIBPA      VDVPVTLKTRTGWDTDN--KNCVQIAKLAEDCGIQALALHGR--------TKACMYKGEAEYDSIKAVKE
DUS1_BACSU      VNKPVTVKMRMGWDEDHIFAVKN--AQAVERAGGKAVALHGR--------TRVQMYEGTANWDIIKEVKQ
DUS_STAAN       GGLPVSVKTRLGYYEIDEWK---DWLKHVFEQDIANLSIHLR--------TRKEMSKVDAHWELIEAIKE
DUS_STAAM       GGLPVSVKTRLGYYEIDEWK---DWLKHVFEQDIANLSIHLR--------TRKEMSKVDAHWELIEAIKE
DUS_STAAW       GGLPVSVKTRLGYYEIDEWK---DWLKHVFEQDIANLSIHLR--------TRKEMSKVDAHWELIEAIKE
DUS_STAAS       GGLPVSVKTRLGYYEIDEWK---DWLKHVFEQDIANLSIHLR--------TRKEMSKVDAHWELIEAIKE
DUS_STAAR       GGLPVSVKTRLGYYEIDEWK---DWLKHVFEQDIANLSIHLR--------TRKEMSKVDAHWELIEAIKE
DUS_STAAC       GGLPVSVKTRLGYYEIDEWK---DWLKHVFEQDIANLSIHLR--------TRKEMSKVDAHWELIEAIKE
DUSC_PSESM      VDIPVTAKMRLGYENTDG--ALD-CARALADGGAAQIVVHAR--------TKVDGYKPPAHWEWIARI-Q
DUSB_KLEPN      VDVPVTLKIRTGWEPE--HRNCVEIAQLAEECGIQALTIHGRTRACLFNGDAE--------YDSIRAVKQ
DUSB_ERWCA      VDVPVTLKIRTGWAPE--HRNCVEIAKLAEDCGIQALTIHTRACLFNGFA----------EYDSIRAVKQ
DUS_STAEQ       GGLPVSVKTRLGYYDIDEWR---DWLKHVFEQDIANLSIHLR--------TRKEMSKVDAHWELIEAIKE
DUSB_PSESM      VDVPVTLKIRTGWD-RDNRNGLT--VAKIAQAGIQALAVHGR--------TRADLYTGEAEYDTIAMIKQ
DUS_STAES       GGLPVSVKTRLGYYDIDEWR---DWLKHVFEQDIANLSIHLR--------TRKEMSKVDAHWELIEAIKE
DUS_AQUAE       LKIPVSAKIRLGFEKDE----VERIVEELQKAGVSLIAIHARTA-KQGFSGK-------ALWHRIKEAKK
DUSC_PSEAC      AEIPVTAKMRLGFEGKEG--ALD-CARALAEGGASQIVVHAR--------TKVEGYKPPAHWEWVARV-Q
DUSB_ECOLI      VDVPVTLKIRTGWAPE--HRNCEEIAQLAEDCGIQALTIHGRRACL------FNGE---AEYDSIRAVKQ
DUSB_ECOL6      VDVPVTLKIRTGWAPE--HRNCEEIAQLAEDCGIQALTIHGRRACL------FNGE---AEYDSIRAVKQ
DUSB_ECO57      VDVPVTLKIRTGWAPE--HRNCEEIAQLAEDCGIQALTIHGRRACL------FNGE---AEYDSIRAVKQ
DUSB_SHIFL      VDVPVTLKIRTGWAPE--HRNCEEIAQLAEDCGIQALTIHGRRACL------FNGE---AEYDSIRAVKQ
DUSB_SALTY      VDVPVTLKIRTGWAPE--HRNCVEIAQLAEDCGIQALTIHGRRACL------FNGE---AEYDSIRAVKQ
DUSB_SALTI      VDVPVTLKIRTGWAPE--HRNCVEIAQLAEDCGIQALTIHGRRACL------FNGE---AEYDSIRAVKQ
DUSB_YERPE      VDVPVTLKIRTGWSPE--HRNCIEIAQLAENCGIQALTIHGRTR-----SCLFNGE---AEYDSIRAVKQ
DUSC_SALTI      SHLPVTVKVRLGWDSGDKFEIAD----AVQQAGASELVVHGR-------TKAQGYRAEHIDWQAIGEIRQ
DUSC_YERPE      AHLPVTVKIRLGWDSGDQFEIAD----AVQQAGATELAVHGR-------TKEDGYQAERINWQAIGEIRQ
DUSC_SHEON      AEHPVTAKIRLGYEDKSLF--MENALA-VYEAGATELAIHARS--------KVDGYKPPAYWEYITEVRE
DUSC_RALEH      AHIAVTAKMRLGV--SDASLAID-CATALAEGGAASLVVHAR--------TRDHGYRPPAHWDWIARIAA
DUSC_SALTY      SHLPVTVKVRLGWDSGDKFEIAD----AVQQAGASELVVHGR-------TKAQGYRAEHIDWQAIGEIRQ
DUSC_SHIFL      AHLPVSVKVRLG---WDSGEKKFEIADAVQQAGATELVVHGR-------TKEQGYRAEHIDWQAIGEIRQ
DUSB_SERMA      VDVPVTLKIRTGWAPE--HRNCVEIAQLAEDCGIQALTIHGRTRACLFNGDAE--------YDSIRAVKQ
DUS4L_HUMAN     VETPVSIKIRIHDDLKRTVDLCQKAEAT----GVSWITVHGRTA--------EERHQ-PVHYDSIKIIKE
DUS1_YEAST      LKVPVTAKIRIFDDCEKSL----NYAKMVLDAGAQFLTVHGR------VREQKGQKTGLANWETIKYLRD
DUSC_ECO57      AHLPVSVKVRLG---WDSGEKKFEIADAVQQAGATELVVHGR-------TKEQGYRAEHIDWQAIGEIRQ
DUS2_BACSU      GGLPVSVKTRLGYTDVDEWR---EWLTHILKQDIANLSIHLRTRW--ELIPEIKKLRDEVAPDTLLTING
DUSC_VIBPA      ANIPVSAKIRLGWENEDCFEIVD----AIQSAGANELTVHAR-------TKQGGYKASEIKWEYINKIRE
DUSC_ECOLI      AHLPVSVKVRLG---WDSGEKKFEIADAVQQAGATELVVHGR-------TKEQGYRAEHIDWQAIGDIRQ
DUSC_ECOL6      AHLPVSVKVRLG---WDSGEKKFEIADAVQQAGATELVVHGR-------TKEQGYRAEHIDWQAIGEIRQ
DUSB_PSEPK      VDVPVTLKIRTGWDRANKNGL--NVAKIAEQAGIQALAVHGR--------TRADLYTGEAEYDTIGAIKQ
DUSC_PSEPK      ANIPVTSKMRLGFDSPDG--ALE-CATALAEGGSAHLVVHAR--------TKVEGYKPPAHWEWVARV-Q
DUS4L_MOUSE     VESPVSIKIRI---HDDLARTID-LCRKAEATGVSWITVHGRTV--------EERHQ-PVHYDAIKMIKE
DUSC_HAEDU      VAQPVSVKMRLGWDASQCFEIAD----AIQQAGADEITVHGR-------TKQDGYRAERINWQAIGQIQQ
DUSC_NEIMA      AHIPLTAKMRLGYEDK---SPXXXXXXXXXXXXXXXXTVHAR--------TKAEGYEPPAHWEWIRKIR-
DUS1_SYNY3      XXXXXXXXXRLGWD--DGEINIVEFAQRLQDAGAQMLTLHGRTR-AQGYNGR-------ARWQWIAKVKQ
DUS1L_RAT       LSVPVTCKIRVEIDKTVRYAQM------LEKAGCQLLTVHGR----------TKEQKGPMSWEHIKAVRK
DUS_MYCTU       TEIPVTVKFRIGIDDA-HHTHLD---------XXXXXXXXXXXXXXXXXXXXXQRYSGTADWEQIARLKQ
DUSC_HAEIN      SEFPVSVKVRLGWDDSQAFEIAD----AVEQGGATEITVHGR-------TKADGYRADRINWKKISEVRE
DUSC_PSEAE      SEIAVTSKMRLGYDSPDG--ALD-CARALADGGSAHVVVHAR--------TKVDGYRPP-XXXXXXXXXX
DUS1L_HUMAN     LSVPVTCKIRVEIDKTVRYAQM------LEKAGCQLLTVHGR----------TKEQKGPLSWEHIKAVRK
DUSC_VIBVU      SHIPVSAKIRLGWENEDCFEIVD----AVEQGKADELTVHAR-------TKAGGYKASEIKWDYIDQIRQ
DUS_MYCLE       TEIPVTVKFRIGIDD-EHHTHLD---------XXXXXXXXXXXXXXXXXXXXXQRYSGTADWAQIAQLKQ
DUSC_VIBCH      AHIPVSAKIRLGEDPEDCFEIVD----AVAQAKADELTVHAR-------TKAGGYKASEIKWHYIDQIRQ
DUSC_RALSO      ARIAVTAKMRLGVSD---XXXXXXXXXXXXXXXXXXLVVHAR--------TRDHGYRPPAHWDWIARI-A
DUS4_SCHPO      ESFCTEVKIRIAKD----LNKTRHLMQVIEKSGADIITVHGR--------TRQDRSSFPVNLDAIREVR-
DUS1_SCHPO      LSIPVTAKIRIFPDPQKTLD----YAKMILKAGASILAVHGR------LREQKGHFTGIADWEQIQMLRK
DUSC_PASMU      VALPVSVKVRLGWDSEQAFEIAD----AVQQGGATEITIHGR-------TKMDGYRADRINWAKINDVRQ
DUS1L_MOUSE     LSVPVTCKIRVEIDKTVRYAQM------LEKAGCQLLTVHGR----------TKEQKGPMSWEHIKAVRK
YQI2_CAEEL      PDFSVSLKIRINHDIEKTVD----LCRKAEAAGVTHLTVHGR-------TPSQRAE--PIDIQALRIVK-
DUS3L_HUMAN     LDVPLTVKIRTGV--QERVNLAHRLLPELRDWGVALVTLHGRS--------REQRYTKLADWQYIEECVQ
DUS3L_XENTR     LDVPLTVKIRTGV--QEKINIAHKLIPNLRDWGVSLVTLHGRS--------REQRYTKLADWEYIAQCAD
DUS3L_XENLA     LDVPLTVKIRTGV--QEKVNIAHKLIPNLRDWGVSLVTLHGRS--------REQRYTKLANWEYIDQCAK
DUS3L_ORYSJ     TEKPLTVKVRTAFFE--GRNRADSIVSDIYDWGASAITVHGRS--------RQQRYSKLADWDYIYQCAQ
DUSC_NEIMB      AHIPLTAKMRLGYEDK---SRXXXXXXXXXXXXXXXXTVHAR--------TKAEGYEPPAHWEWIRKIR-
DUS_RHOCA       VDLPVTLKMRLGWDEDQL--NXXXXXXXXXXXGVKMIVIHGR---------TRMQFYTGXXXXXXXXXXX
DUS2L_MOUSE     THRPVTCKIRI----LPSLEDTLNLVKRIERTGISAIAVHGRN--------RDERPQHPVSCEVIRAIAE
DUS2L_HUMAN     TRRPVTCKIRILPSLEDTLS----LVKRIERTGIAAIAVHGRK--------REERPQHPVSCEVIKAI-A
DUS3_CRYNE      LDIPLTVKFRTGVGKPNAHKLIPRF---VTEWGAGALTIHGRS--------RQQRYSKPADWEYIKTADA
DUS_TREPA       ARIPVTVKIRAGWEE--AHLTWKEXXXXXXXXXXXXXXLHPRTC-AQCYAGEAN-------WDIIADLVQ
DUS_RHILP       VDIPVTLKMRLGWDE-NSINAPD--IARRAEAGIQLVTIHGRTR----MQFYEGRAD----WDAIRAVRE
DUS3L_RAT       LDVPLTVKMRTGVQERVS--LAHRLLPELRNWGVALVTLHGRS--------REQRYTRLADWPYIEQCAK
DUS3L_ARATH     VETPITIKVRTAFFE--GKNRIDSLIADIGNWGATAVTIHGRS--------RQQRYSKSADWDIYQCTKN
DUS3L_DICDI     LSCPTTIKIRIG--KSEDAPTAHKLIPSLGEWGACAVTLHGRS--------RAQRYSRLANWDYVKQC-S
DUS3L_MOUSE     LDVPLTVKMRTGVQERVS--LAHRLLPELRDWGVALVTLHGRS--------REQRYTRLADWPYIEQCAK
DUS3_ASHGO      SKVPVSVKLRTGTRDGHPI-ALGLCKRLVMETDVAAITLHGRTRQQRYTRSADGQVADALRYETERAEKE
DUS3_COPC7      LEIPLTVKIRTGVKERNNAHKLMPRIS--AEWSASAITLHGR--------TRQQRYTKLADWDYIREADE
DUS3_USTMA      GDTPLTIKLRTGTGAKQT----THKIFAKAQTEWR-----VAAATLHGRSRKQ-RYKNDADWGYIATCAN
DUS4_YEAST      YGDKLRIETKIRI-----HEALDETVEKLCDAGVDWITIHGR--------TRRTRSSQPANLDAIKYIIE
DUS3_KLULA      NDIPVTVKIRTGTREGHPI-ALSITKRLVLETDVAAITLHGRTR-QQRYTKSADWDYVGEVANAVRTYER
DUS_HELPJ       TNKKITVKVRLGFEKKIPKE-IAHALN---DAPVDYVVVHGR-------TRSDRYQKDKIDYESIALMKK
DUS3_CANGA      SDIPITVKIRTGTKE-------------------------------------------------------
DUS3_CANAL      GDIPVTVKIRTGIKEGKNTAV--NLVSRVLEEGAAAITLHGRKNWEQQKEDKEGRDRDPVYF--------
DUS3_MALGO      LEIPLTIKLRTGTTSKPTTHKI--FARAQTEWGVGGLSLHGRQRYKNDADWAYIRTCVDTLHDAVRTWNE
DUS3_VANPO      SSIPITVKIRTG--TRDSHPVADTLVKLVYETDVAAITLHGRS--------RQQRYTRVADWDYVSTVRE
DUS3_YEAST      SKIPITVKIRTGTKE--GHPIAEGLVKLVNETDVAAITLHGRSR-QQRYTKSADWDYVSQVADTLRSAEA
DUS3_YEAS7      SKIPITVKIRTGTKE--GHPIAEGLVKLVNETDVAAITLHGRSR-QQRYTKSADWDYVSQVADTLRSAEA
DUS2_SCHPO      IGKPYKISISCKIRLLETKEDTLKLVERICDTGVRAITVHCR------TTPMRNTEPADRSYEIVGVCRN
DUS3_PICST      GDIPVTVKIRTG-SKENKNTAKTLVERLLAENDVAAITLHGRS--------RQQRYTKEADWNYIAEVGQ
DUS_HELPY       TSKKITVKVRLGFEKKIPKE-IAHALN---DAPVDYVVVHGR-------TRSDKYQKDKIDYESIALMKK
DUS3_YARLI      SDVPITVKMRTGTGSTPTAKKLT--ARLLAEGQTAAFTLHGRSR--------------AQRY----TKLA
DUS3_DEBHA      GDIPVTVKIRTGTKEKNTAKALVERILSENEVAAIT--LHGRSR-----QQRYTKEADWSYVQDVANIVQ
DUS3_MAGGR      GEVPITCKLRIGVKEERAVFGSPDFRNQLGAPGCAAITLHGR--------TRQQRYKKPADWGLIQSYRD
PYRDB_ENTFA     ASVPIYVKLSPNVTDADGFSMINTLLGMRIDLKTRKPILANQTGGLSG---------PAIKPVAIRLIRQ
PYRD_PYRKO      TDKPVIAKLTPNIDDLAAENAGADAVSAINTLKAIAIDIYARKPILSGVKPVALRAV----YDLARTL--
DUS3_PICGU      GDIPVTVKIRTGTDNKNTAKSLVERV--LAENDVAAITLHGRS--------RQQRYTKDADWEYIKEVXX
HIS4_THICR      -------------------------------------------------------EGKPVNGDAVYQVRE
DUS3_NEUCR      SEVPVTAKIRMGV--RDNHLTAQKLVERLAAPGCAAVTLHGRTAECAALVKSFNEKADSLQDTIREADER
HIS4_PSESM      -------------------------------------------------------EGQPVNGDVVTAIAK
DUS3_LODEL      GDIPVTIKIRTGVKENKNTAV--HLVNRVEETQVAAITLHGRS--------RQQRYTKEADWDYIEEVGK
DUS2_YEAST      HSKPISVKIRLLDTKQDTLQLVKRLCAT----GITNLTVHCRKTEMR------NREQPITDYIAEIYEIC
DUS3_CHAGB      GEVPITAKIRMGLTAQKLVERLEDLRDMIGAPGCAAVTLHGRTR-LQRYTKKQFNEKSNDLADTIREADE
DUS3_BOTFB      GEVPITAKIRMGTGKPTAFKTIERLAERLGAPGCAAITLHGRSAECAALVKSYNQKKDDLTDTVMEPDAR
PYRD_BACSK      SAVPVYVKLSPNVADADGLAMINTLLGMRIDAKTRRPVLANQYGGLSGAAIK------PVALRMIHQVSQ
HIS4_TERTT      ----------------------------------------------------------PVNGDVVTAIAK
HIS4_PSEU2      -------------------------------------------------------EGQPVNGDVVTAIAR
HIS4_PSE14      -------------------------------------------------------EGQPVNGDVVTAIAR
DUS3_SCLS1      GEVPITAKIRMGTGKPTALKTIERLAERLGAPGCAAITLHGRSAECAALVKSYNQKKDDLTDTIMEPDAR
PYRD_OCEIH      SNKPVYVKLSPNVHNADGLSMINTLTGMKIHLPSRKPLIANKTGGLSGPAIK------PVAIRMIYEVRQ
HIS4_PSEU5      ------------------------------QAGCRRLHLVDLNGAFEG---------QPVNGEVVTAIAK
HIS4_PSEFS      -------------------------------------------------------EGQPVNGEVVTAIAK
HIS4_CHRSD      -------------------------------------------------------EGKPVNAEAVTAIAR
DUS3_SCHPO      GQIPVTVKLRMG--NKDDHPVVKNLIGRIFNE------TNTSAATLHGRS-RQQRYSKNANWDYIGEIAD
DUS3_ASPNC      DQIPITVKIRMGTKDNN-----------------------------------------------------
PYRD_LISMO      ASVPVYVKLSVSIAQAIEAAGADGLTMINTLLGMRIDLKTRKPIIANGTGGLSGPAIKPVAIRMIHQVRA
HIS4_PSEF5      -------------------------------------------------------EGQPVNGEVVTAIAK
HIS4_LEUMM      -------KIVVGVDGRDSDTSFDDIVEAMLSVGVSNFVVTARDGTLSGPN-----------IELLSRLQN
PYRD_SYNWW      TSLPVIPK--------------------------------------------------------------
PYRD_LISMH      ATVPVYVKLSVSIAQAIEAAGADGLTMINTLLGMRIDLKTRKPIIANGTGGLSGPAIKPVAIRMIHQVRA
PYRD_LISMF      ATVPVYVKLSVSIAQAIEAAGADGLTMINTLLGMRIDLKTRKPIIANGTGGLSGPAIKPVAIRMIHQVR-
PYRD_LISMC      ATVPVYVKLSVSIAQAIEAAGADGLTMINTLLGMRIDLKTRKPIIANGTGGLSGPAIKPVAIRMIHQVR-
PYRD_LISIN      ASVPVYVKLSISIAQAIEAAGADGLTMINTLLGMRIDLKTRKPVIANGTGGLSGPAIKPVAIRMIHQVRA
PYRD_ANOFW      SDVPVYVKLSPNVTEQAGADGLT-MINTL--VGMRIDVKTGKPILANGTGGLSGPAIKPIAIRMIYEVSQ
PYRD_LISW6      ASVPVYVKLSVSIAQAIEAAGADGLTMINTLLGMRIDLKTRKPIIANGTGGLSGPAIKPVAIRMIHQVR-
HIS4_PSYCK      ----------------------------------------------------------PVHKQVVHDIAK
HIS4_PSYA2      ----------------------------------------------------------PVHKQVVHDIAK
HIS4_PSEE4      -------------------------------------------------------EGQPVNGEVVTAIAK
HIS4_LACCB      NRIAVGIDTRAGKVATNSQQTANALLTAMQQRGVTTFIVTAKDGMMQGPNAQ-----------LLADLQQ
HIS4_AZOVD      -------------------------------------------------------EGQPINGEVVTAIAR
HIS4_ACIAD      ----------------------------------------------------------PIHKPVVEAIAK
DUS3_ASPCL      EAIPITVKIRTGLIERLTLGGHESSMLNIGPPGVAAITLHGRTALIKRLNEKTDEVTDTVREPDARTLPN
PYRD_THEVO      VKVPVFAK--------------------------------------------------------------
HIS4_PSEPW      -------------------------------------------------------EGQPVNGEVVTAIAK
HIS4_PSEPK      -------------------------------------------------------EGQPVNGEVVTAIAK
HIS4_PSEP1      -------------------------------------------------------EGQPVNGEVVTAIAK
HIS4_LACC3      NRIAVGIDTRAGKVATNSQQTANALLTAMQQRGVTTFIVTAKDGMMQGPNAQ-----------LLADLQQ
HIS4_ACIBS      ----------------------------------------------------------PIHKPVVEAIAK
PYRD_GEOTN      SAVPVYVKLSPNVTEQAGADGLT-MINTL--VGMRIDVKTGRPILANGTGGLSGPAVKPIAVRMIYEVSQ
HIS4_PSEMY      -------------------------------------------------------EGQPVNGEVVTAIAK
HIS4_ACIBY      ----------------------------------------------------------PIHKPVVEAIAK
HIS4_ACIBT      ----------------------------------------------------------PIHKPVVEAIAK
HIS4_ACIBC      ----------------------------------------------------------PIHKPVVEAIAK
HIS4_ACIB5      ----------------------------------------------------------PIHKPVVEAIAK
HIS4_ACIB3      ----------------------------------------------------------PIHKPVVEAIAK
DPYD_PONAB      VQIPFFAK--------------------------------------------------------------
DPYD_HUMAN      VQIPFFAK--------------------------------------------------------------
PYRD_THEAC      ISVPVFAK--------------------------------------------------------------
PYRD_BACAH      SEVPVYVKLSVEIAKAIANAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
HIS4_SACD2      ----------------------------------------------------------PVNGEVVKAIAK
HIS4_PSEAE      -------------------------------------------------------EGKPVNGEVVTAIAR
HIS4_PSEAB      -------------------------------------------------------EGKPVNGEVVTAIAR
HIS4_PSEA8      -------------------------------------------------------EGKPVNGEVVTAIAR
HIS4_PSEA7      -------------------------------------------------------EGKPVNGEVVTAIAR
PYRD_SULSY      TKKPLLVKLSPNVS-----NILDTADACVSAGADGLVLINT----LLGVAIDVEREKPPIAVRMIWQVYQ
PYRD_BACHK      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACCZ      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACCR      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACCQ      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACC7      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACC4      SEVPVYVKLSVEIAKAIETAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACC3      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACC2      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACC1      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACC0      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACAN      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACAC      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
PYRD_BACAA      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVAIRMVHEVSQ
HIS4_NEIG2      ----------------------------------------------------------PAIKDILAAVAK
HIS4_NEIG1      ----------------------------------------------------------PAIKDILAAVAK
DPYD_BOVIN      VRIPFFAKLTPNVTD------IVSIARAAKEGGANGVTATNTVSGLMGLKPAVGREKRPIALRAVTTIAR
HIS6_CAMC5      ---------------------------------------------------------------IARVAKE
HIS4_NEIMF      ----------------------------------------------------------PAIKDILAAVAK
HIS4_NEIMB      ----------------------------------------------------------PAIKDILAAVAK
HIS4_NEIMA      ----------------------------------------------------------PAIKDILAAVAK
HIS4_NEIM0      ----------------------------------------------------------PAIKDILAAVAK
DPYD_DICDI      TRLPFFAKLTPNVTEIKEIAKAAHAINTVSDSNAWPAIGDEKRTTYGGVSGNATR---PIALRAVSSIRK
YDJI_ECOLI      VSVPLVLHGASGISDAD--------IKTAISLGIAKINIHTELCQAAMVAVKENQDQPHLEREVRKAVKE
PYRD_THEP1      ----------------------------------------------------------PIALRAVYEVKK
PYRD_THEMA      ----------------------------------------------------------PIALRAVYEVKK
HIS4_MARAV      ----------------------------------------------------------PVNGEIVKAIAV
HIS4_GRAFK      ---------------EDSNEEIIPFIQNYEEKGVKYVICTSKDGMLEGPS-----------FELYKEILS
PYRD_THETN      TSKTVIVKLTPNVTEKGGADAIS-LINTV--AGMAVDIDKRRPVFIGGLSPAIKPIALKMVYEVVTVV--
PYRD_BACWK      SEVPVYVKLSVEIAKAIENAGADGLTMINTLLGMRLDLKTAKPILANRTGGLSGPAIKPVALRMVHEVSQ
PYRD_BACSU      SDVPVYVKIALAIEEADGLTMINTLIGMRLDLKTGKPILANKTGGLSGPAVK------PVAIRMVYEVSQ
HIS4_RUTMC      -------------------------------------------------------EGRPVNVSSVTEVVS


                         .         .         .         +         .         .         .:280
query           DFPQLTVIINGGITTLEEISEHLELLDGVMIGRAAYHNPYLLAQVDRNFYGDFHPFLTRHEIIEAFLPYV
DUSA_VIBVU      DFSHLTIAINGGVKSLEEAKEHLQHLDGVMIGREAYQSPYLLASVDQELFGSQSPIKKRRQIVEEMYPYI
DUSA_VIBCH      DFPHLTIAVNGGVKSLEEAKLHLQHLDGVMIGREAYQNPYLLAEVDQQIFGLETPVKKRSQVIHEMMPYI
DUSA_VIBPA      DFSHLTIAINGGVKSLEEAKVHLQHLDGVMIGREAYQSPYLLASVDQELFGSNAPVKKRSEIVEEMYPYI
DUSA_SHEON      DYPALNISINGGITSLEQAQTHLQHLDGVMVGREAYQNPYMLAQVDQVLCGSTKAVMSREAVIEAMLPYI
DUSA_YERPE      DFPALTIAINGGVKTLAEAKEHLKHLDGVMMGREAYQNPGILTQVDRELFDPNAPVVDSVKAIEALYPYI
DUSA_SALTI      DFPHLTMSINGGIKSLEEAKEHLRHMDGVMVGREAYQNPGILAAVDREIFGADTTDTDPVAVVRAMYPYI
DUSA_SALTY      DFPHLTMSINGGIKSLEEAKEHLRHMDGVMVGREAYQNPGILAAVDREIFGADTTDADPVAVVRAMYPYI
DUSA_HAEIN      DFPHLTIAINGGIKTIEEMKQHLQYVDGVMVGREAYQNPSLLGQIDQALFDPNAPIVTAHEAVESMLPYI
DUSA_PASMU      DFPHLLMSINGGIKTLEEMQQHLQYMDGVMVGREAYQNPSLLGYIDQALFDPTCPVVTPREAVEKMFPYI
DUSA_ECOL6      DFPHLTMSINGGIKSLEEAKAHLQHMDGVMVGREAYQNPGILAAVDREIFGSSDTDADPVAVVRAMYPYI
DUS2_SYNY3      DFPQLLIEINGGITQTEQIQQHLSHVDAVMVGRAAYENPYLFATVDRDIYHKTNLVPSRAEIIERMLPYV
DUSA_ECOLI      DFPHLTMSINGGIKSLEEAKAHLQHMDGVMVGREAYQNPGILAAVDREIFGSSDTDADPVAVVRAMYPYI
DUSA_ECO57      DFPHLTMSINGGIKSLEEAKAHLQHMDGVMVGREAYQNPGILAAVDREIFGSSDTDADPVAVVRAMYPYI
DUSA_SHIFL      DFPHLTMSINGGIKSLEEAKAHLQHMDGVMVGREAYQNPGILAAVDREIFGSSDTDADPVAVVRAMYPYI
DUSA_PSEPK      DFPDLEIVLNGGIKTLDECQAHLETFDGVMLGREAYHNPYLLAEVDQQLFGSDAPVVSRSEALAQLRPYI
DUSA_HAEDU      DFPQLNISINGGIKTIDEIKQHLTKVDGVMVGREAYQNPALLGEIDQQLFDQNQPLITARIAVENMLPYI
DUSA_PSEAE      DFPDLEIVLNGGIKTLEACREHLQTFDGVMLGREAYHNPYLLAAVDSQLFGSEAPPLSRSEALLRLRPYI
DUSA_XANAC      ERPGLPVVLNGGIVAVEPAIAHLQHADGVMLGRAAYHDPYVLHCLDAAL--NQRPEQPRESLLRAYQPYV
DUSA_PSESM      DFPELEIVLNGGIKTLEQCSEHLQTFDGVMLGREAYHNPYLLAQVDQQLFGSVAPVISRHAALESMRPYI
DUSA_XANCP      ERPALPVVLNGGIASVEASLAHLQHTDGVMLGRAAYHDPYVLHQLEAALSG--RPERARADLLQAYQPYV
DUSA_XYLFT      ECPELAVVLNGGITSVEAGLDHLLMVDGVMLGRAAYQDPYILHQ----FYCALXXXXXXXXXXXXXXXYV
DUSA_XYLFA      ERPELAVVLNGGITSVEAGLDHLLMVDGVMLGRAAYQDPYILHQFDCALSN--XXXXXXXXXXXXXXXYV
DUS_RICPR       AV-KIPVIANGDITNFAKAKEALQRADGIMVGRGVYGKPWLISQI-------------------------
DUSB_XANAC      AL-QIPVVANGDIDSPQKAAQVLREADAVMIGRAAQGRPWI--------FGEVAHFLATGEV----LPPP
DUS_AZOBR       AV-SIPVVVNGDITSFDAVDRALSGADGVMIGRGAYGRPWFPAQVMHYITGERLPDPPLHEQLDTLLEHY
DUS_RICFE       AV-KIPVIANGDITNFAKAKEALQKADGIMVGRGAYGKPWLVSQI-------------------------
DUSB_XANCP      AL-QIPVIANGDIDSPQKAAQVLRGVDAVMIGRAAQGRPWIFGEV------------AHYLATGALLPPP
DUS_RICTY       AV-KIPVIANGDITNFAKAKEALQKADGIMVGRGVYGKPWLISQI-------------------------
DUSB_PSEAE      AV-SIPVFANGDIDSPEKARKVIEQVDALLIGRAAQGRPWIFREID-------HYLRTGEHLPAAPLPE-
DUS_RICCN       SV-KIPVIANGDITNFAKAKEALQKADGIMVGRGAYGKPWLISQIDH--------YLKTGE--EKSAPSI
DUSB_PASMU      QL-SIPIIANGDITSAEKAKYVLDYADAIMIGRGSLGNPWL-----------------------------
DUSB_HAEDU      AV-FMPIIANGDITSPQKAKDVLDYADAVMIGRGSFGRPWLFQELKQ--------FLETGDIIDLSIDEK
DUSB_PROVU      NV-SIPIIANGDITDPLKARAVLDYADALMIGRAAQGRPWIFREIQH--------YLDTGELLPP-LPIA
DUS_RICBR       AV-KIPVIANGDITNFXXXXXXXXXXDGVMVGRGAYGKPWLISQID------------------------
DUSB_VIBVU      AV-SIPVIANGDIDSPEKAKYVLEYADALMIGRPAQGRPWIFQEI--------HHYLEN----GTTMPEL
DUSB_HAEIN      AI-AIPVIANGDIDSARKAKFVLNYADAIMIGRAALGNPWLFQAVEN---------LIEHNSISQ-MPSL
DUSB_SHEON      NV-SIPVVANGDIDSPEKARFVLDYVDALMIGRGAQGRPWIFREIQ-------HYLETGNKLAPI---EV
DUSB_VIBCH      AV-SIPVIANGDIDSPEKARYVLEYADALMIGRPAQGRPWIFQEIQHFLHGTTMPELPISEVKDIMLGHV
DUSB_VIBPA      AI-SIPVIANGDIDSPEKAKFVLEYADALMIGRPAQGRPWIFQEI--------HHYLENGTTMDE----L
DUS1_BACSU      SV-SIPVIGNGDVKTPQDAKRMLDEVDGVMIGRAALGNPWMI----------------------------
DUS_STAAN       IAPNTLLTINGDIPDRKTGLELAEKIDGVMIGRGIFHNPFAFEKEPR-----------------------
DUS_STAAM       IAPNTLLTINGDIPDRKTGLELAEKIDGVMIGRGIFHNPFAFEKEPR-----------------------
DUS_STAAW       IAPNTLLTINGDIPDRKTGLELAEKIDGVMIGRGIFHNPFAFEKEPR-----------------------
DUS_STAAS       IAPNTLLTINGDIPDRKTGLELAEKIDGVMIGRGIFHNPFAFEKEPR-----------------------
DUS_STAAR       IAPNTLLTINGDIPDRKTGLELAEKIDGVMIGRGIFHNPFAFEKEPR-----------------------
DUS_STAAC       IAPNTLLTINGDIPDRKTGLELAEKIDGVMIGRGIFHNPFAFEKEPR-----------------------
DUSC_PSESM      EVVKVPVVANGEIWTVEDWRRCREICGAIMIGRGLVARPDLARQI-------------------------
DUSB_KLEPN      KV-SIPVIANGDITDPLKARAVLDYADALMIGRAAQGRPWIFREIQHYLTGELLPPLPLAEVKRLLCAHV
DUSB_ERWCA      AV-SIPIIANGDITDPHKARAVLDYADALMIGRAAQGRPWIFREIQH--------YLDTGELL-APLPLV
DUS_STAEQ       IAPNTLLTINGDITGLELANKY--GIDGIMIGRGIFHNPFAFEKEPR-----------------------
DUSB_PSESM      AV-SIPVFANGDIDSPEKARHVLQAADGLLIGRAAQGRPWIFREIE-------HYLLTGKT-----LPAL
DUS_STAES       IAPNTLLTINGDITGLELANKY--GIDGIMIGRGIFHNPFAFEKEPR-----------------------
DUS_AQUAE       -VASVPIIGSGDVKSWRDIERMFEECDGVMVGRAALSNPWIFKEFKEK--RDIEVGLERMDFILEELSMM
DUSC_PSEAC      EVVGVPVFANGEVWTLDDWRRCREIVDDIMLGRGLVSRPGLARQI-------------------------
DUSB_ECOLI      KV-SIPVIANGDITDPLKARAVLDYADALMIGRAAQGRPWIFREIQHYLTGELLPPLPLAEVKRLLCAHV
DUSB_ECOL6      KV-SIPVIANGDITDPLKARAVLDYADALMIGRAAQGRPWIFREIQHYLTGELLPPLPLAEVKRLLCAHV
DUSB_ECO57      KV-SIPVIANGDITDPLKARAVLDYADALMIGRAAQGRPWIFREIQHYLTGELLPPLPLAEVKRLLCAHV
DUSB_SHIFL      KV-SIPVIANGDITDPLKARAVLDYADALMIGRAAQGRPWIFREIQHYLTGELLPPLPLAEVKRLLCAHV
DUSB_SALTY      KV-SIPIIANGDITNPHKARAVLDYADALMIGRAAQGRPWIFREIQHYLTGELLPPLPLAEVKRLLCTHV
DUSB_SALTI      KV-SIPIIANGDITNPHKARAVLDYADALMIGRAAQGRPWIFREIQHYLTGELLPPLPLAEVKRLLCTHV
DUSB_YERPE      TV-SIPVIANGDITDPHKARAVLDYADALMIGRAAQGRPWIFREI-------------------------
DUSC_SALTI      RL-TIPVIANGEIWDWQSAQACMATCDAVMIGRGALNIPNLSRVVKYN-----EPRMPWPEVVTLLQKYT
DUSC_YERPE      RL-TIPVIANGEIWDYQSAQECMKVCDAVMLGRGALNVPNLSRVVKYN-----EPRMPWLEVVKLLQKYV
DUSC_SHEON      RLP-IPVIANGEIWNRDDAKRCMQVCDSIMIGRGAISLPNL-----------------------------
DUSC_RALEH      AV-DVPVIANGDVWTVAD-WERCRAVSGVMIGRGAVSDPFLALRI-------------------------
DUSC_SALTY      RL-TIPVIANGEILDWQSAQACMATCDAVMIGRGALNIPNLSRVVKYN-----EPRMPWPEVVTLLQKYT
DUSC_SHIFL      RL-NIPVIANGEIWDWQSAQQCMAICDAVMIGRGALNIPNLSRVVKYN-----EPRMPWPEVVALLQKYT
DUSB_SERMA      SV-SIPIIANGDITDPHKARAVLDYADALMIGRAAQGRPWIFREI-------------------------
DUS4L_HUMAN     NM-SIPVIANGDIRSLKEAENRITGTDGVMVARGLLANPAMFA---------------------------
DUS1_YEAST      NLPKETVFFNGNILYPEDISRCMEHIDAVMSAEGNLYNP-------------------------------
DUSC_ECO57      RL-NIPVIANGEIWDWQSAQECMAICDSVMIGRGALNIPNLSRVVKYN-----EPRMPWPEVVALLQKYT
DUS2_BACSU      DIPDRQT----GLKLAEQYG-----VDGIMIGRGIFTNPF------------------------------
DUSC_VIBPA      RF-SIPLIANGEIWNFEDGQRCIETVDSLMVCRGAFNIPNLGNMVKHN-----HTPMVWSDVVDLLIYYS
DUSC_ECOLI      RL-NIPVIANGEIWDWQSAQQCMAICDAVMIGRGALNIPNLSRVVKYN-----EPRMPWPEVVALLQKYT
DUSC_ECOL6      RL-NIPVIANGEIWDWQSAQQCMAICDAVMIGRGALNIPNLSRVVKYN-----EPRMPWPEVVALLQKYT
DUSB_PSEPK      AV-SIPVFANGDITSPEKARAVLETVDGLLIGRAAQGRPWIFREIEHYLRTGEH------------LPAP
DUSC_PSEPK      DVVKVPVFANGEIWTVDDWRRCREVAEDIMLGRGLVSRPDLGLQIAAARDGRDYQPMSWHDLL-------
DUS4L_MOUSE     NV-SIPIVANGDIRSLKEAENVWQMTDGVMVARGLLANPAMFA---------------------------
DUSC_HAEDU      RL-NIPVIANGEILDFNSAQKCREITAGLMIGRGALNTPNLSKVIKYN----------------------
DUSC_NEIMA      DSVDIPVTANGDVFSLQDYIKTISGCNSVMLGRGAVIRPDLARQI-------------------------
DUS1_SYNY3      AL-TIPVIANGDIFSVEAAIACLEEADGVMCSRGSLGYPFLVGEIE-------HFFKTGE---KRKAPTV
DUS1L_RAT       AV-GIPVFANGNIRCLQDVERCIQGVQGVMSAEGNLHNPAL-----------------------------
DUS_MYCTU       HVRTIPVLGNGDIYDAGDALAMMSTCDGVVIGRGCLGRPWLFAELSAAFTGSPAPTPPTADIIRRHGTLL
DUSC_HAEIN      RL-SIPVIANGEIWHWQDGQDCLSQCQDLMVGRGALNIPNL-----------------------------
DUSC_PSEAE      XXXXXXXXXNGEVWTLDDYLRCREVVEDIMLGRGLVSRPGLARQI-------------------------
DUS1L_HUMAN     AV-AIPVFANGNIQCLQDVERCLRGVQGVMSAEGNLHNPAL-----------------------------
DUSC_VIBVU      R-STIPLIANGEIWNYADGQACIETIDSLMVCRGALNVPNLGNIVKHN-----HRAMPWHEVVDLLLKYT
DUS_MYCLE       QVRTIPVLGNGDIYDASDALAMMAVCDGVVIGRGCLGRPWLFAELSAAFTG-------RPAPAPPTLGEV
DUSC_VIBCH      KC-SIPLIANGEVWNYADGQACIQTVDSLMVCRGALNVPNLGNVVKHN-----HAAMPWHEVVDLLLRY-
DUSC_RALSO      DAVRVPVVANGEVWTVDDWARAVSGCDDVMIGRGAVSDPFLALRI-------------------------
DUS4_SCHPO      PCVQIPVVANGDVKSLREIAKYTE-TQGIMSARGLLENPALFAGYEETPWGCVERFL-------------
DUS1_SCHPO      NLPSETVLFNGNILHAQDIDRCIKYVDGVLSAEGSLYNP-------RIFLPPSSPLMTLYDMCEEYLNII
DUSC_PASMU      RL-SIPVIANGEIWDWQSGQACLAECQDLMIGRGALNIPNLSQVVKFN----------------------
DUS1L_MOUSE     AV-GIPVFANGNIQCLQDVERCIQGVQGVMSAEGNLHNPAL-----------------------------
YQI2_CAEEL      DSVSVPIIANGGITTREEALFLAEQVDGIMAANGLLDNPAL-------FAGHEH---TPSDCVENFMEYG
DUS3L_HUMAN     AASPMPLFGNGDILSFEDANRAMQTVTGIMIARGALLKPWLFTEIKEQRHWDISS-SERLDILRDFTNYG
DUS3L_XENTR     IASPLPLFGNGDIISYEDANRALQTVSGIMLARGALLKPWLFTEIKEQRHWDISS-TERFDILKDFTNYG
DUS3L_XENLA     IASPVPLFGNGDIISYEDANRALQTVAGVMLARGALFKPWLFTEIKEQRHWDISS-TERFDILKDFTNYG
DUS3L_ORYSJ     KAPQLHVVGNGDVFSFTDWNKHVSKISTSMIARGALIKPWIFTEVKEQRHWD------------------
DUSC_NEIMB      DSVNIPVTANGDVFSLQDYIKTISGCNSVMLGRGAVIRPDLARQI-------------------------
DUS_RHOCA       XXXXXXXXXNGDITDAASARRALDQAAGVMVGRGAQGAPWRLAQIAAALFGEFSDFVSEH--YEAILSFY
DUS2L_MOUSE     TL-SIPVIANGG--SHDHIQQHVDIED-------------------------------------------
DUS2L_HUMAN     DTLSIPVIANGG----------------------------------------------------------
DUS3_CRYNE      NLPPVPIFGNGDCFSAASYYEEMDRVDGVMVARGALIKPWIFTEI-------------------------
DUS_TREPA       GWGEVPVFGSGDLHAPEDARAMLEACAGVMFARGAMGNPFIFRQTRQLLTEGYYTPVTFEQKLRAALHLL
DUS_RHILP       VI-SVPLIANGDVETAHDAQEILRRADAVMIGRGCQGRPW------------------------------
DUS3L_RAT       VASPMPLFGNGDILSFEDANCAMQTVAGIMVARGALLKPWLFTEIKEQRHWDISS-SERLDILRDFTHYG
DUS3L_ARATH     ATTNLQVIGNGDVYSYLDWNKHCPELSSCMIARGALIKPWIFTEIKEQRHWD------------------
DUS3L_DICDI     EVSSIPLIGNGDIYNYQDVVNIYDKVSSIMIARGALIKPWIFTEI-------------------------
DUS3L_MOUSE     VASPMPLFGNGDILSFEDANCAMQTVAGIMVARGALLKPWLFTEIKEQRHWDISS-SERLDILRDFTHYG
DUS3_ASHGO      GKLRIQFVGNGDCNNWEDWYRHLENVDSVMVARGALIKPWIFEEVDARQYID------------------
DUS3_COPC7      DLPPVPIFGGGDCFSSQDYWEKINNVDGVMIGRGALIKPWIFTEI-------------------------
DUS3_USTMA      DEPEMVVYGNGDVYSWQDYYERIERVDGEMIARGALIKPWLFTEI-------------------------
DUS4_YEAST      NIKNVPVIANGDLSDLERITKYTG-AHGVMAVRGLLSNPALFA---------------------------
DUS3_KLULA      DGQKIQFVGNGDCNNWEDWYKHLENMDSVMVARGALIKPWIFEEVDAQQYMD------------------
DUS_HELPJ       ILKK-PVIANGEIDSVKKAFEVLQITDGLMIGRATLRAPWIFWQI-RNNTTELPAVVKKDLVLEHFDKMV
DUS3_CANGA      ----------------------------------------------------------------------
DUS3_CANAL      -------VGNGDVYSHEDWYEHVNTIDSVMVARGALIKPWIFEEVEAQQYLD-KSSSERLDILGKFAKYA
DUS3_MALGO      DMVPVPVYGNGDVYGWRDYYDHLEHVDGTMIARGALIKPWIFTEI-------------------------
DUS3_VANPO      SKRRIQFVGNGDVNNFEDILNNDENIDSIMVARGALIKPWVFEEVD------------------------
DUS3_YEAST      DFNRIQFVGNGDVNNFEDWYRYLENIDSVMVARGALIKPWIFEEVESQQYLD------------------
DUS3_YEAS7      DFNRIQFVGNGDVNNFEDWYRYLENIDSVMVARGALIKPWIFEEVESQQYLD------------------
DUS2_SCHPO      --KDVSILVNGDVLSYNDGLDVIEKVDGVLIARAAERN--------------------------------
DUS3_PICST      DTQRTCFVGNGDVFSHVDNAVNTDGIDSVMVARGALIKPWIFEEVEAQQYLD-KTATERLDILKTFSDYA
DUS_HELPY       ILKK-PVIANGEIDSVKKAFEVLQITDGLMIGRAALRAPWIFWQIRNN----------------------
DUS3_YARLI      DWNYIREVADSVVNTRDDVREKSELDDHVI-----SHPTWVVGNGDCYTWSDWHRAVDEAHVDSVMVPWI
DUS3_DEBHA      DWTQPTCFVNGDVYTHEDWYNAVNIVDSVMVARGALIKPWIFEEVEAQQYLD-KSSTERLEMIGQYAKFA
DUS3_MAGGR      KRDELTTVREPDASTLAPSSEVFFLGNGDCYSHADYYKAIDESHVDTVMIG-------RGALIK---PWV
PYRDB_ENTFA     SVSQLPIIGMGGVQTVDDVLEFMAGASAVGVGTANFTDPYI-----------------------------
PYRD_PYRKO      DIP---VIGIGGITTWQDAVEFL-----------------------------------------------
DUS3_PICGU      XXXRTNFVGNGDVFTHEDNAVNTEGVDSVMVARGALIKPWIFEEVEAQQYLD------------------
HIS4_THICR      AFPDLPIQIGGGIRDLETIEAYLKAVSYCIIGTKAVHNPEFVAEACKAFPG-------------------
DUS3_NEUCR      SLPRMYFVGNGDCYSHVDYFNHVDKVDSVMVGRGAIIKPWIFEEISAGQYLD-KSATERLAYVEKFAKYG
HIS4_PSESM      RYPNLPIQIGGGIRSLETIEHYIKAVSYVIIGTKAVKDPEFVAQACRAFPG-------------------
DUS3_LODEL      VVKTWNFVGNGDVYSHEDNGVNREGVDSVMVARGALIKPWIFEEVEAQQYLD-KSSTERLAMLEKYAKYA
DUS2_YEAST      QANNVSLIVNGAI---------------------------------------------------------
DUS3_CHAGB      NTGKMYFLGNGDCYSHVEYFDHVDKVDSVMIGRGALVKPWVFEEIEKGQYLD-KSSSERLTYIEKFVRYG
DUS3_BOTFB      TLPKIHFIGNGDCYSHIDYLDHIQNVDSVMVARGALIKPWLFEEIEKGQVLD-KSASERLEYVEKFTRYG
PYRD_BACSK      QV-DIPIIGMGGIQTAEDVIEF--LLAGIAVGTANFTDPYTCPNIIRD----------------------
HIS4_TERTT      AFPELPIQIGGGIRSAETIEHYLQAVNYVIIGTKAVKEPEFVTEMCKQFAG-------------------
HIS4_PSEU2      RYPNLPIQIGGGIRSLETIEHYVKAVSYVIIGTKAVKEPEFVAEACRAFPG-------------------
HIS4_PSE14      RYPNLPIQIGGGIRSLETIEHYVKAVSYVIIGTKAVKEPEFVAEACRAFPG-------------------
DUS3_SCLS1      TLPKLHFIGNGDCYSHVDYLDHIQSVDSVMVARGALIKPWLFEEIEK-----------------------
PYRD_OCEIH      QV-SIPIIGMGGITSAEDVLEYLIAADAVAVGTANFQNPFVCVDI-------------------------
HIS4_PSEU5      RYPDLPIQIGGGIRTLETIEHYVRAVSYVIIGTKAVKEPEFVTEACRAFPG-------------------
HIS4_PSEFS      RYPNLPIQIGGGIRSLETIEHYVKAVSYVIIGTKAVKDPAFVAEACRAFPG-------------------
HIS4_CHRSD      AYPDLPIQIGGGIRTAETIEAYLEAVSYVIIGTQAVKEPAFVGEMCRRFPG-------------------
DUS3_SCHPO      ELPELSLIGNGDCYSWQDWYDGVNKVDTVMIARGALVKPWIFEEIEARQFID------------------
DUS3_ASPNC      ----------------------------------------------------------------------
PYRD_LISMO      -VSNIPIIGMGGVQTVDDVLEFLIAADAVAVGTMNFTDPFI-----------------------------
HIS4_PSEF5      RYPNLPIQIGGGIRSLETIEHYVKAVSYVIIGTKAVKEPEFVAEACRAFPG-------------------
HIS4_LEUMM      KFPKSNIIASGGIANIKNVTDQASGIHDIIVGRALYDGDVTLAQL-------------------------
PYRD_SYNWW      ----------------------------------------------------------------------
PYRD_LISMH      -VSNIPIIGMGGVQTVDDVLEFLIAADAVAVGTMNFTDPFI-----------------------------
PYRD_LISMF      EVSNIPIIGMGGVQTVDDVLEFLIAADAVAVGTMNFTDPFI-----------------------------
PYRD_LISMC      EVSNIPIIGMGGVQTVDDVLEFLIAADAVAVGTMNFTDPFI-----------------------------
PYRD_LISIN      -VSNIPIIGMGGVQTVDDVLEFLIAADAVAVGTMNFTDPFI-----------------------------
PYRD_ANOFW      AV-SLPIIGMGGIQSAEDVIEFFYAASAVAIGTANFIDPYVCPNI-------------------------
PYRD_LISW6      SVSNIPIIGMGGVQTVDDVLEFLIAADAVAVGTMNFTDPFI-----------------------------
HIS4_PSYCK      AFPKLPIQLGGGVRNMQTIEQYITALTYIIIGTKAVEDPDFVAEACREFAG-------------------
HIS4_PSYA2      AFPKLPIQLGGGVRNMQTIEQYITALTYIIIGTKAVEDPDFVAEACREFAG-------------------
HIS4_PSEE4      RYPNLPIQIGGGIRSLETIEHYVKAVSHVIIGTKAVKQPEFVAEACKAFPG-------------------
HIS4_LACCB      AMPQATIIASGGVSSLADL---------------------------------------------------
HIS4_AZOVD      RYPDLPIQIGGGIRSLETIEHYVKAGVGVIIGTKAVKQPEFVGEACRAFPG-------------------
HIS4_ACIAD      AQPELPIQIGGGIRSLETIEHYLDAVSFVIIGTKAVQDPEFVEQACKQFAG-------------------
DUS3_ASPCL      G-GKVYFLGNGDCYSHKDYEDHINNVDAVMVGRGAIIKPWVFEEIQTGQYLD------------------
PYRD_THEVO      ----------------------------------------------------------------------
HIS4_PSEPW      RYPNLPIQIGGGIRSLETIEHYVKAVSYVIIGTKAVKQPEFVAEACKAFPG-------------------
HIS4_PSEPK      RYPNLPIQIGGGIRSLETIEHYVKAVSYVIIGTKAVKQPEFVAEACKAFPG-------------------
HIS4_PSEP1      RYPNLPIQIGGGIRSLETIEHYVKAVSYVIIGTKAVKQPEFVAEACKAFPG-------------------
HIS4_LACC3      AMPQATIIASGGISLLADL---------------------------------------------------
HIS4_ACIBS      AQPELPIQIGGGIRSLETIEHYLEAVTFVIIGTKAVQEPEFVEEACKSFAG-------------------
PYRD_GEOTN      AV-SIPIIGMGGVQTAEDVLEFFYAASAVAVGTANFIDPFV-----------------------------
HIS4_PSEMY      RYPNLPIQIGGGIRTLETIEHYVRAVSYVIIGTKAVKEPEFVTEACKAFPG-------------------
HIS4_ACIBY      AQPELPIQIGGGIRSLETIEHYLEAVTFVIIGTKAVQEPEFVEEACKRFAG-------------------
HIS4_ACIBT      AQPELPIQIGGGIRSLETIEHYLEAVTFVIIGTKAVQEPEFVEEACKRFAG-------------------
HIS4_ACIBC      AQPELPIQIGGGIRSLETIEHYLEAVTFVIIGTKAVQEPEFVEEACKRFAG-------------------
HIS4_ACIB5      AQPELPIQIGGGIRSLETIEHYLEAVTFVIIGTKAVQEPEFVEEACKRFAG-------------------
HIS4_ACIB3      AQPELPIQIGGGIRSLETIEHYLEAVTFVIIGTKAVQEPEFVEEACKRFAG-------------------
DPYD_PONAB      ----------------------------------------------------------------------
DPYD_HUMAN      ----------------------------------------------------------------------
PYRD_THEAC      ----------------------------------------------------------------------
PYRD_BACAH      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
HIS4_SACD2      AYPNLPIQIGGGIRSLETIKHYLDAVTYVIIGTKAVKEPEFVKQACDAFPG-------------------
HIS4_PSEAE      RYPDLPIQIGGGIRSLETIEHYVRAVSYVIIGTKAVKQPEFVGEACRAFPG-------------------
HIS4_PSEAB      RYPDLPIQIGGGIRSLETIEHYVRAVSYVIIGTKAVKQPEFVGEACRAFPG-------------------
HIS4_PSEA8      RYPDLPIQIGGGIRSLETIEHYVRAVSYVIIGTKAVKQPEFVGEACRAFPG-------------------
HIS4_PSEA7      RYPDLPIQIGGGIRSLETIEHYVRAVSYVIIGTKAVKQPEFVGEACRAFPG-------------------
PYRD_SULSY      KYSRIPIIGVGGISNYKDALQHLAGASAIQVGTANFYDP-------------------------------
PYRD_BACHK      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACCZ      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACCR      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACCQ      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACC7      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACC4      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACC3      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACC2      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACC1      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACC0      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACAN      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACAC      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACAA      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
HIS4_NEIG2      DIP---VQLGGGMRDLKTIGQYLDLLNDVIIGTAAVKNPDLVREACKAFPG-------------------
HIS4_NEIG1      DIP---VQLGGGMRDLKTIGQYLDLLNDVIIGTAAVKNPDLVREACKAFPG-------------------
DPYD_BOVIN      ALPEFPILATGGIDSAE-----------------------------------------------------
HIS6_CAMC5      LFIPLTV--GGGIRTLDDISRLLNVCDKVSLNSAAIHNPNLIDEAANKF---------------------
HIS4_NEIMF      DIP---VQLGGGIRDLKTIGQYLDLLNDVIIGTAAVKNPDFVREACKAFPG-------------------
HIS4_NEIMB      DIP---VQLGGGIRDLKTIGQYLDLLNDVIIGTAAVKNPDFVREACKAFPG-------------------
HIS4_NEIMA      DIP---VQLGGGIRDLKTIGQYLDLLNDVIIGTAAVKNPDFVREACKAFPG-------------------
HIS4_NEIM0      DIP---VQLGGGIRDLKTIGQYLDLLNDVIIGTAAVKNPDFVREACKAFPG-------------------
DPYD_DICDI      SLPDYPIMATGGADSADATIQFL-----------------------------------------------
YDJI_ECOLI      ----------------------------------------------------------------------
PYRD_THEP1      RFPELFVIASGGVYSVKDAEEFLKVADVIGVGSALFKDPGVVEEIGK-----------------------
PYRD_THEMA      RFPELFVIASGGVYSVKDAEEFLKVADVIGVGSALFKDPGVVEEIGK-----------------------
HIS4_MARAV      KYPNLPIQIGGGIRSAETIEAYLKAVQWVIIGTKAVKEPEFVTEMCKEFPG-------------------
HIS4_GRAFK      ETKNINLIASGGISEFDELPKLAELCEGVIIGKAIYENRISLKQFE------------------------
PYRD_THETN      ---SIPVIGMGGIMNYKDALEFLIVARAIAVGTCNFVNPYCTVEI-------------------------
PYRD_BACWK      AV-NIPIIGMGGIETAEDVIEFFYAASAVAVGTANFIDPFV-----------------------------
PYRD_BACSU      -MVNIPIIGMGGVQTAEDALEFLLAASAVAVGTANFVNPFACPEI-------------------------
HIS4_RUTMC      AFPDLPVQIGGGIRNMQIANAYIEAIDYLIIGTMAVTNPEFVSELCREF---------------------


                         .         *         .         .         .         .         +:350
query           AEQLVQGVYLNHMTRHILGLFQGQPGARAWRRHLSENAHRPGAGIEIIREALRQMPx
DUSA_VIBVU      EQQLANGAYLGHMTRHMLGLFQNMPGARQWRRHISENAHKPGSGIEVLQQALAKIP-
DUSA_VIBCH      ERELSQGTHLGHMTRHMLGLFQNMPGARQWRRHISENAHKPGAGLEVVEQALAKIP-
DUSA_VIBPA      EAQLAKGAYLGHITRHMLGLFQNMPGARQWRRHISENAHKPGSGLEVLQDALAKIP-
DUSA_SHEON      EAHLQVGGRLNHITRHMIGLFQGLPGARAWRRYLSENAHKNGAGIEVVKLAYQSV--
DUSA_YERPE      EQELSQGAYLGHITRHILGIFQGIPGARQWRRHLSENAHKPGAGVSVVEEAL-----
DUSA_SALTI      ERELSQGAYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADAAVLEQALK----
DUSA_SALTY      ERELSQGAYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADVAVLEQALK----
DUSA_HAEIN      EQQLSQGIHLNHIVRHILGAFQNCKGARQWRRYLSENAFKQGAGIEVVETAL-----
DUSA_PASMU      EQQLSQGVYLNHVVRHMLGAFQSCKGARQWRRYLSENAHKAGAGLEVVEKAL-----
DUSA_ECOL6      ERELSQGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADINVLEHALK----
DUS2_SYNY3      EERLRHGDRLNQITRHLLSLFNGQPRAKFWRRTLSDSTLLASAGPELLQTALQ----
DUSA_ECOLI      ERELSQGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADINVLEHALK----
DUSA_ECO57      ERELSQGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADINVLEHALK----
DUSA_SHIFL      EHELSQGTYLGHIIRHMLGLFQGIPGARQWRRYLSENAHKAGADINVLEHALK----
DUSA_PSEPK      VAHMESGGAMHHVTRHILGLAQGFKGARRFRQLLSADIHKAAEPLAVFDQAV-----
DUSA_HAEDU      EQQLSKGVYLNHIVRHMLGAFQNCKGARQWRRHLSENACKQGAGIEVVEQALR----
DUSA_PSEAE      ERHQAEGGAMHHVTRHILGLAQGFPGSRRFRQLLSVDVHKAADPLRVFDQAL-----
DUSA_XANAC      ESQLAQGLGLKHMTRHVLGLFHGQPGGRAFRQVLSEGAHRPGAGWELVEQALER---
DUSA_PSESM      AAHIASGGNMHHVTRHMLGLGLGFPGARRFRQLLSVDIHKAENPLLLLDQAAK----
DUSA_XANCP      QAQLDQGLALKHMTRHILGLFHGQPGGRVFRQVLSEGAHRPGAGWELVEQA------
DUSA_XYLFT      EAWLEQGVTLRHIVRHLLGLFHGQPGGRVFRQVLTQGGQRSDADWSLVEQAL-----
DUSA_XYLFA      EVWLEQGLTLRHIVRHLFGLFHGQPGGRVFRQVLTQGGQRSDADWSLVEQAL-----
DUS_RICPR       ---------------------------------------------------------
DUSB_XANAC      SLAFVRDTLLGHL--EALHAFYGQPGVRIARKHL-----------------------
DUS_AZOBR       DAMLTH--------------YGVEGGLRVARKHIS----------------------
DUS_RICFE       ---------------------------------------------------------
DUSB_XANCP      SLAFVRDTLLGHL--EALHAFYGQPGVRIARKHL-----------------------
DUS_RICTY       ---------------------------------------------------------
DUSB_PSEAE      ----VQSILLEHLAE--LHLFYGEEGVRIARKHV-----------------------
DUS_RICCN       AEQ------LDIVTEHILDYYGESVGVPIARKHI-----------------------
DUSB_PASMU      ---------------------------------------------------------
DUSB_HAEDU      CQLMLKHIEDLH---HFYG---EQKGYRIARKHV-----------------------
DUSB_PROVU      EVQQI-------MQKHVRELFYGQKGTRIARKHVS----------------------
DUS_RICBR       ---------------------------------------------------------
DUSB_VIBVU      PIEEVKSIMLGHV--QALHEFYGELGPRIARKHV-----------------------
DUSB_HAEIN      KEKCGQ------ILRHIQELHQEQKGYRIARKHVA----------------------
DUSB_SHEON      AEQ--RQVMLEHLTK-LYDLYGEYKGIRFARKHI-----------------------
DUSB_VIBCH      ALHQFYGEYLGPARKHVSWYLQEHEQASAFRR-------------------------
DUSB_VIBPA      PTQEVKAIMLGHV--NALHEFYGELGPRIARKHV-----------------------
DUS1_BACSU      ---------------------------------------------------------
DUS_STAAN       ---------------------------------------------------------
DUS_STAAM       ---------------------------------------------------------
DUS_STAAW       ---------------------------------------------------------
DUS_STAAS       ---------------------------------------------------------
DUS_STAAR       ---------------------------------------------------------
DUS_STAAC       ---------------------------------------------------------
DUSC_PSESM      ---------------------------------------------------------
DUSB_KLEPN      --------------RELHGFYGQAKGYRIARKHVS----------------------
DUSB_ERWCA      E---VKRLLIEHI-RELHDFYGPGKGFRIARKHVS----------------------
DUS_STAEQ       ---------------------------------------------------------
DUSB_PSESM      QSSEVERILLEHLA--ALHVFYGDMGVRIARKHV-----------------------
DUS_STAES       ---------------------------------------------------------
DUS_AQUAE       TEYMSREKACAEIKSQIVQILKGVPNSRELKTYIAENCKELVKRIEEAKE-------
DUSC_PSEAC      ---------------------------------------------------------
DUSB_ECOLI      RE-------------------------------------------------------
DUSB_ECOL6      RE-------------------------------------------------------
DUSB_ECO57      RE-------------------------------------------------------
DUSB_SHIFL      RE-------------------------------------------------------
DUSB_SALTY      RE-------------------------------------------------------
DUSB_SALTI      RE-------------------------------------------------------
DUSB_YERPE      ---------------------------------------------------------
DUSC_SALTI      RLEKQGDTGLYHVAR------------------------------------------
DUSC_YERPE      QLEKQGDTGLYHVAR------------------------------------------
DUSC_SHEON      ---------------------------------------------------------
DUSC_RALEH      ---------------------------------------------------------
DUSC_SALTY      RLEKQGDTGLYHVAR------------------------------------------
DUSC_SHIFL      RLEKQGDTGLYHVAR------------------------------------------
DUSB_SERMA      ---------------------------------------------------------
DUS4L_HUMAN     ---------------------------------------------------------
DUS1_YEAST      ---------------------------------------------------------
DUSC_ECO57      RLEKQSDTGLYHVAR------------------------------------------
DUS2_BACSU      ---------------------------------------------------------
DUSC_VIBPA      KFEMKKGLYYNRVKQWFAYLRQSYPEANELFREI-----------------------
DUSC_ECOLI      RLEKQGDTGLYHVAR------------------------------------------
DUSC_ECOL6      RLEKQGDTGLYHVAR------------------------------------------
DUSB_PSEPK      QLDEVERILLEHLA--ALHAFYGDMGVRIARKHVGYLATRPG---------------
DUSC_PSEPK      ---------------------------------------------------------
DUS4L_MOUSE     ---------------------------------------------------------
DUSC_HAEDU      ---------------------------------------------------------
DUSC_NEIMA      ---------------------------------------------------------
DUS1_SYNY3      AEKLT--CAQEHL--QMLWEYKGQRGLFQARKHLAWYC-KDFPGAAALREQLFQI--
DUS1L_RAT       ---------------------------------------------------------
DUS_MYCTU       AAHFGEDKGMRDIRKHIAWYLHGFPAGSALRRALA----------------------
DUSC_HAEIN      ---------------------------------------------------------
DUSC_PSEAE      ---------------------------------------------------------
DUS1L_HUMAN     ---------------------------------------------------------
DUSC_VIBVU      QYE-VRGYYPNRIKQWFAYLRQAYPQA------------------------------
DUS_MYCLE       AE------IVRRHGKLLVAHFGEDKGMRDIRKHIAWYLHGFPAGSE-LRNAL-----
DUSC_VIBCH      ---------------------------------------------------------
DUSC_RALSO      ---------------------------------------------------------
DUS4_SCHPO      ---------------------------------------------------------
DUS1_SCHPO      REFKLESDYLSAIKGHLFKLMR-----------------------------------
DUSC_PASMU      ---------------------------------------------------------
DUS1L_MOUSE     ---------------------------------------------------------
YQI2_CAEEL      LDWLLYHQHLQYMLRPVFSAQQ-----------------------------------
DUS3L_HUMAN     LE-------------------------------------------------------
DUS3L_XENTR     LEHWCQGVWLSFLCRYIIGLLEHVP--------------------------------
DUS3L_XENLA     LE-------------------------------------------------------
DUS3L_ORYSJ     ---------------------------------------------------------
DUSC_NEIMB      ---------------------------------------------------------
DUS_RHOCA       GRDLGLRIARKHL--------------------------------------------
DUS2L_MOUSE     ---------------------------------------------------------
DUS2L_HUMAN     ---------------------------------------------------------
DUS3_CRYNE      ---------------------------------------------------------
DUS_TREPA       AQDVGESSACKQMRKRFVSYAKGERGKTQW---------------------------
DUS_RHILP       ---------------------------------------------------------
DUS3L_RAT       LE-------------------------------------------------------
DUS3L_ARATH     ---------------------------------------------------------
DUS3L_DICDI     ---------------------------------------------------------
DUS3L_MOUSE     LEHWTQGVWLSFLCRYVVGLLERPP--------------------------------
DUS3_ASHGO      ---------------------------------------------------------
DUS3_COPC7      ---------------------------------------------------------
DUS3_USTMA      ---------------------------------------------------------
DUS4_YEAST      ---------------------------------------------------------
DUS3_KLULA      ---------------------------------------------------------
DUS_HELPJ       EFYGDRGVIMFRKNLHAYA--KGEMQASAFR--------------------------
DUS3_CANGA      ---------------------------------------------------------
DUS3_CANAL      IE-------------------------------------------------------
DUS3_MALGO      ---------------------------------------------------------
DUS3_VANPO      ---------------------------------------------------------
DUS3_YEAST      ---------------------------------------------------------
DUS3_YEAS7      ---------------------------------------------------------
DUS2_SCHPO      ---------------------------------------------------------
DUS3_PICST      LE-------------------------------------------------------
DUS_HELPY       ---------------------------------------------------------
DUS3_YARLI      FEEVESRQHIDKSATERLEYFQAQYGLEHW---------------------------
DUS3_DEBHA      IEHWGSDEYGVGLARRFMCEFLG----------------------------------
DUS3_MAGGR      FEEIAAGQYLDKSSTERLGYIERRYGMEAW---------------------------
PYRDB_ENTFA     ---------------------------------------------------------
PYRD_PYRKO      ---------------------------------------------------------
DUS3_PICGU      ---------------------------------------------------------
HIS4_THICR      ---------------------------------------------------------
DUS3_NEUCR      ME-------------------------------------------------------
HIS4_PSESM      ---------------------------------------------------------
DUS3_LODEL      VE-------------------------------------------------------
DUS2_YEAST      ---------------------------------------------------------
DUS3_CHAGB      ME-------------------------------------------------------
DUS3_BOTFB      LE-------------------------------------------------------
PYRD_BACSK      ---------------------------------------------------------
HIS4_TERTT      ---------------------------------------------------------
HIS4_PSEU2      ---------------------------------------------------------
HIS4_PSE14      ---------------------------------------------------------
DUS3_SCLS1      ---------------------------------------------------------
PYRD_OCEIH      ---------------------------------------------------------
HIS4_PSEU5      ---------------------------------------------------------
HIS4_PSEFS      ---------------------------------------------------------
HIS4_CHRSD      ---------------------------------------------------------
DUS3_SCHPO      ---------------------------------------------------------
DUS3_ASPNC      ---------------------------------------------------------
PYRD_LISMO      ---------------------------------------------------------
HIS4_PSEF5      ---------------------------------------------------------
HIS4_LEUMM      ---------------------------------------------------------
PYRD_SYNWW      ---------------------------------------------------------
PYRD_LISMH      ---------------------------------------------------------
PYRD_LISMF      ---------------------------------------------------------
PYRD_LISMC      ---------------------------------------------------------
PYRD_LISIN      ---------------------------------------------------------
PYRD_ANOFW      ---------------------------------------------------------
PYRD_LISW6      ---------------------------------------------------------
HIS4_PSYCK      ---------------------------------------------------------
HIS4_PSYA2      ---------------------------------------------------------
HIS4_PSEE4      ---------------------------------------------------------
HIS4_LACCB      ---------------------------------------------------------
HIS4_AZOVD      ---------------------------------------------------------
HIS4_ACIAD      ---------------------------------------------------------
DUS3_ASPCL      ---------------------------------------------------------
PYRD_THEVO      ---------------------------------------------------------
HIS4_PSEPW      ---------------------------------------------------------
HIS4_PSEPK      ---------------------------------------------------------
HIS4_PSEP1      ---------------------------------------------------------
HIS4_LACC3      ---------------------------------------------------------
HIS4_ACIBS      ---------------------------------------------------------
PYRD_GEOTN      ---------------------------------------------------------
HIS4_PSEMY      ---------------------------------------------------------
HIS4_ACIBY      ---------------------------------------------------------
HIS4_ACIBT      ---------------------------------------------------------
HIS4_ACIBC      ---------------------------------------------------------
HIS4_ACIB5      ---------------------------------------------------------
HIS4_ACIB3      ---------------------------------------------------------
DPYD_PONAB      ---------------------------------------------------------
DPYD_HUMAN      ---------------------------------------------------------
PYRD_THEAC      ---------------------------------------------------------
PYRD_BACAH      ---------------------------------------------------------
HIS4_SACD2      ---------------------------------------------------------
HIS4_PSEAE      ---------------------------------------------------------
HIS4_PSEAB      ---------------------------------------------------------
HIS4_PSEA8      ---------------------------------------------------------
HIS4_PSEA7      ---------------------------------------------------------
PYRD_SULSY      ---------------------------------------------------------
PYRD_BACHK      ---------------------------------------------------------
PYRD_BACCZ      ---------------------------------------------------------
PYRD_BACCR      ---------------------------------------------------------
PYRD_BACCQ      ---------------------------------------------------------
PYRD_BACC7      ---------------------------------------------------------
PYRD_BACC4      ---------------------------------------------------------
PYRD_BACC3      ---------------------------------------------------------
PYRD_BACC2      ---------------------------------------------------------
PYRD_BACC1      ---------------------------------------------------------
PYRD_BACC0      ---------------------------------------------------------
PYRD_BACAN      ---------------------------------------------------------
PYRD_BACAC      ---------------------------------------------------------
PYRD_BACAA      ---------------------------------------------------------
HIS4_NEIG2      ---------------------------------------------------------
HIS4_NEIG1      ---------------------------------------------------------
DPYD_BOVIN      ---------------------------------------------------------
HIS6_CAMC5      ---------------------------------------------------------
HIS4_NEIMF      ---------------------------------------------------------
HIS4_NEIMB      ---------------------------------------------------------
HIS4_NEIMA      ---------------------------------------------------------
HIS4_NEIM0      ---------------------------------------------------------
DPYD_DICDI      ---------------------------------------------------------
YDJI_ECOLI      ---------------------------------------------------------
PYRD_THEP1      ---------------------------------------------------------
PYRD_THEMA      ---------------------------------------------------------
HIS4_MARAV      ---------------------------------------------------------
HIS4_GRAFK      ---------------------------------------------------------
PYRD_THETN      ---------------------------------------------------------
PYRD_BACWK      ---------------------------------------------------------
PYRD_BACSU      ---------------------------------------------------------
HIS4_RUTMC      ---------------------------------------------------------