[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA59415.1

[Show Plain Result]


## Summary of Sequence Search
    1::490
   51::414     4e-64  41%  436 aa  Y1259_AQUAE RecName: Full=Uncharacterized protein aq_1259;Flags:
    1::490

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y1259_AQUAE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLAEAVESLRTAMHIPEEFEYKSMYGLGPAASKVYQVG
Y1259_AQUAE     --------------------------------VLKEEFRKLRLEIVMPEA--YKPYAGLGPAASKVYQVK


                         +         .         .         .         .         *         .:210
query           KGLSIGGYGEGRYQTFVNGDGDDNADFARLVLYTGYKFTDRIIFNSEIXXXXXXXXXXXXXXXXVSVEFA
Y1259_AQUAE     KGVSIGGYGELHYINNPDNDPSSIIDLKRLILYFGYSFTENLKFNSEI-EIEHAFVEGGEESGELAVEFA


                         .         .         .         +         .         .         .:280
query           ALDFFLDPRVNIRAGLVLMPMGFINLIHEPPFFFGNNRPEVERRIIPSTWREIGVGLFGELLPGLTYTMY
Y1259_AQUAE     YLDYNFSPKFGLRGGMLLIPVGIVNELHEPPTFPTVDRPYLERNIIPTTWSENGIGIYGD-TDLISYRAY


                         .         *         .         .         .         .         +:350
query           GVNGLNAEEFSSRGIRDGRQSGSKALAEDLAFVGRMDYAPPGMPGLSFGGSAYAGNSGQDQSYGGQDLDV
Y1259_AQUAE     IVNGMKAEEKASAPLKKLRQNGGEAVSDSLAFTGRIDFKLPN--NLTVGASTFISGV---QNEDGKNLGN


                         .         .         .         .         *         .         .:420
query           FTQLYEGHLQWQYRGWWLRALGAWGHIGDAEALSAAKGETIGESNFGWYTELAYNLLPLVWPETIQYLAP
Y1259_AQUAE     I-YLFSPHLWWQYAGWDVRFVGAYATVSDAEKITLELSSATCDKSTGFYLQVAYNILRHF--DTEQELYV


                         .         .         +         .         .         .         .:490
query           FFRFEQLNTIASAPAGFSDKGGINQDIYQVGINYKPIPNVVIKADYxxxxxxxxxxxxxxxxxxxxxxxx
Y1259_AQUAE     FGVYENYDTHASVPSGYEKPKGSEVQIFNFGISYKPHPLVALKADY------------------------