[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA59494.1

[Show Plain Result]


## Summary of Sequence Search
    1::249
    1::249     e-141 100%  249 aa  HIS4_NITOC RecName:
    1::240     1e-95  68%  242 aa  HIS4_THISH RecName:
    1::241     2e-92  66%  242 aa  HIS4_ACIF5 RecName:
    1::241     2e-92  66%  242 aa  HIS4_ACIF2 RecName:
    1::241     2e-90  66%  243 aa  HIS4_METCA RecName:
    1::244     2e-90  62%  246 aa  HIS4_THICR RecName:
    1::245     3e-90  62%  246 aa  HIS4_ALCBS RecName:
    1::245     5e-90  65%  248 aa  HIS4_ALHEH RecName:
    1::246     4e-85  61%  246 aa  HIS4_CHRVO RecName:
    1::244     1e-84  61%  251 aa  HIS4_AZOSB RecName:
    1::249     2e-84  60%  257 aa  HIS4_NITMU RecName:
    1::238     3e-83  61%  243 aa  HIS4_SACD2 RecName:
    1::245     3e-83  60%  247 aa  HIS4_METFK RecName:
    1::243     6e-83  58%  245 aa  HIS4_MARAV RecName:
    1::245     6e-83  59%  246 aa  HIS4_BORPD RecName:
    1::236     8e-83  60%  249 aa  HIS4_CHRSD RecName:
    1::245     8e-83  59%  246 aa  HIS4_BORPE RecName:
    1::245     8e-83  59%  246 aa  HIS4_BORPA RecName:
    1::245     8e-83  59%  246 aa  HIS4_BORBR RecName:
    1::242     1e-82  60%  245 aa  HIS4_PSEU2 RecName:
    1::242     3e-82  59%  245 aa  HIS4_PSE14 RecName:
    1::246     4e-82  60%  251 aa  HIS4_THIDA RecName:
    1::242     5e-82  59%  245 aa  HIS4_PSESM RecName:
    1::245     8e-82  58%  245 aa  HIS4_PSEPG RecName:
    1::236     1e-81  58%  244 aa  HIS4_HAHCH RecName:
    1::245     2e-81  58%  245 aa  HIS4_PSEPK RecName:
    1::245     2e-81  58%  245 aa  HIS4_PSEP1 RecName:
    1::245     3e-81  58%  245 aa  HIS4_PSEF5 RecName:
    1::245     4e-81  57%  245 aa  HIS4_PSEPW RecName:
    1::245     4e-81  57%  245 aa  HIS4_PSEE4 RecName:
    1::246     4e-81  58%  247 aa  HIS4_ACISJ RecName:
    1::246     5e-81  58%  246 aa  HIS4_RHOFD RecName:
    1::245     5e-81  59%  246 aa  HIS4_BORA1 RecName:
    1::238     7e-81  58%  245 aa  HIS4_TERTT RecName:
    1::245     9e-81  58%  245 aa  HIS4_PSEMY RecName:
    1::239     9e-81  58%  245 aa  HIS4_PSEAE RecName:
    1::239     9e-81  58%  245 aa  HIS4_PSEAB RecName:
    1::239     9e-81  58%  245 aa  HIS4_PSEA8 RecName:
    1::239     9e-81  58%  245 aa  HIS4_PSEA7 RecName:
    1::244     9e-81  58%  248 aa  HIS4_NITEC RecName:
    1::246     9e-81  58%  249 aa  HIS4_LEPCP RecName:
    1::244     9e-81  58%  250 aa  HIS4_BURPP RecName:
    1::244     3e-80  58%  250 aa  HIS4_BURXL RecName:
    1::245     4e-80  57%  245 aa  HIS4_PSEFS RecName:
    1::245     5e-80  58%  247 aa  HIS4_DIAST RecName:
    1::239     6e-80  58%  247 aa  HIS4_PSEU5 RecName:
    1::246     8e-80  56%  246 aa  HIS4_POLNA RecName:
    1::238     8e-80  58%  243 aa  HIS4_CELJU RecName:
    1::247     1e-79  57%  251 aa  HIS4_BURS3 RecName:
    1::247     1e-79  57%  251 aa  HIS4_BURCJ RecName:
    1::247     1e-79  57%  251 aa  HIS4_BURCC RecName:
    1::247     1e-79  57%  251 aa  HIS4_BURCA RecName:
    1::246     1e-79  57%  247 aa  HIS4_VARPS RecName:
    1::245     1e-79  57%  245 aa  HIS4_PSEPF RecName:
    1::244     1e-79  60%  245 aa  HIS4_NEIMF RecName:
    1::247     1e-79  57%  251 aa  HIS4_BURVG RecName:
    1::247     1e-79  57%  251 aa  HIS4_BURTA RecName:
    1::245     2e-79  56%  245 aa  HIS4_AZOVD RecName:
    1::246     2e-79  57%  248 aa  HIS4_ACIAC RecName:
    1::254     2e-79  59%  265 aa  HIS4_HERAR RecName:
    1::247     2e-79  56%  251 aa  HIS4_BURCM RecName:
    1::247     2e-79  56%  251 aa  HIS4_BURA4 RecName:
    1::244     4e-79  59%  245 aa  HIS4_NEIMA RecName:
    1::244     4e-79  59%  245 aa  HIS4_NEIM0 RecName:
    1::247     4e-79  57%  251 aa  HIS4_BURPS RecName:
    1::247     4e-79  57%  251 aa  HIS4_BURP6 RecName:
    1::247     4e-79  57%  251 aa  HIS4_BURP1 RecName:
    1::247     4e-79  57%  251 aa  HIS4_BURP0 RecName:
    1::247     4e-79  57%  251 aa  HIS4_BURMS RecName:
    1::247     4e-79  57%  251 aa  HIS4_BURMA RecName:
    1::247     4e-79  57%  251 aa  HIS4_BURM9 RecName:
    1::247     4e-79  57%  251 aa  HIS4_BURM7 RecName:
    1::247     5e-79  56%  251 aa  HIS4_BURCH RecName:
    1::245     7e-79  59%  253 aa  HIS4_POLSQ RecName:
    1::244     2e-78  56%  247 aa  HIS4_RALPJ RecName:
    1::246     3e-78  57%  246 aa  HIS4_POLSJ RecName:
    1::236     3e-78  58%  249 aa  HIS4_NITEU RecName:
    1::244     3e-78  56%  250 aa  HIS4_BURP8 RecName:
    1::256     4e-78  57%  261 aa  HIS4_JANMA RecName:
    1::244     6e-78  58%  245 aa  HIS4_NEIMB RecName:
    1::244     1e-77  58%  245 aa  HIS4_NEIG1 RecName:
    1::244     1e-77  56%  247 aa  HIS4_RALSO RecName:
    1::245     1e-77  58%  253 aa  HIS4_POLNS RecName:
    1::244     1e-77  58%  245 aa  HIS4_NEIG2 RecName:
    1::234     1e-77  58%  243 aa  HIS4_ACIAD RecName:
    1::244     2e-77  56%  245 aa  HIS4_VEREI RecName:
    1::245     2e-77  56%  246 aa  HIS4_HALHL RecName:
    1::245     3e-77  56%  248 aa  HIS4_RALEJ RecName:
    1::246     3e-77  56%  249 aa  HIS4_AZOSE RecName:
    1::234     5e-77  58%  243 aa  HIS4_ACIBY RecName:
    1::234     5e-77  58%  243 aa  HIS4_ACIBT RecName:
    1::234     5e-77  58%  243 aa  HIS4_ACIBC RecName:
    1::234     5e-77  58%  243 aa  HIS4_ACIB5 RecName:
    1::234     5e-77  58%  243 aa  HIS4_ACIB3 RecName:
    1::244     6e-77  56%  246 aa  HIS4_DECAR RecName:
    1::247     2e-76  55%  251 aa  HIS4_BURM1 RecName:
    1::244     1e-75  56%  248 aa  HIS4_RALEH RecName:
    1::234     2e-75  58%  243 aa  HIS4_ACIBS RecName:
    6::239     6e-75  56%  246 aa  HIS4_PSYCK RecName:
    1::244     8e-75  56%  248 aa  HIS4_CUPTR RecName:
    1::228     1e-74  58%  246 aa  HIS4_DELAS RecName:
    6::239     2e-74  56%  246 aa  HIS4_PSYA2 RecName:
    1::247     3e-74  54%  247 aa  HIS4_RALME RecName:
    1::228     6e-74  57%  248 aa  HIS4_METPP RecName:
    1::241     1e-73  57%  245 aa  HIS4_GEOSF RecName:
    1::236     2e-73  52%  243 aa  HIS4_RUTMC RecName:
    1::240     3e-72  55%  242 aa  HIS4_SYNAS RecName:
    1::236     5e-72  52%  243 aa  HIS4_VESOH RecName:
    1::241     2e-71  56%  244 aa  HIS4_GEOSL RecName:
    1::241     3e-71  54%  243 aa  HIS4_GEOSM RecName:
    1::241     9e-71  56%  244 aa  HIS4_GEOMG RecName:
    1::241     9e-71  54%  243 aa  HIS4_GEOBB RecName:
    1::241     4e-69  54%  245 aa  HIS4_GEOUR RecName:
    1::238     6e-69  54%  245 aa  HIS4_PELPD RecName:
    1::241     9e-68  54%  245 aa  HIS4_GEOLS RecName:
    1::240     3e-67  52%  243 aa  HIS4_PELCD RecName:
    1::239     6e-67  52%  250 aa  HIS4_DESAA RecName:
    1::240     3e-66  53%  243 aa  HIS4_PARL1 RecName:
    1::248     5e-66  48%  248 aa  HIS4_RHILW RecName:
    1::244     5e-66  50%  244 aa  HIS4_BRASO RecName:
    4::241     1e-65  52%  245 aa  HIS4_XANP2 RecName:
    1::248     4e-65  48%  248 aa  HIS4_RHIL3 RecName:
    1::246     4e-65  50%  249 aa  HIS4_MAGSM RecName:
    1::240     5e-65  50%  247 aa  HIS4_BRASB RecName:
    1::234     7e-65  52%  245 aa  HIS4_RHOPB RecName:
    1::248     2e-64  48%  248 aa  HIS4_RHIE6 RecName:
    4::241     2e-64  52%  249 aa  HIS4_NITWN RecName:
    1::235     2e-64  53%  257 aa  HIS4_TRIEI RecName:
    1::248     2e-64  48%  248 aa  HIS4_RHIEC RecName:
    1::240     3e-64  49%  245 aa  HIS4_HELMI RecName:
    1::236     3e-64  53%  257 aa  HIS4_ACAM1 RecName:
    1::238     4e-64  50%  241 aa  HIS4_RHORT RecName:
    4::243     5e-64  49%  248 aa  HIS4_BRAJA RecName:
    1::227     1e-63  52%  245 aa  HIS4_RHOPS RecName:
    1::239     1e-63  53%  240 aa  HIS42_SILST RecName:
    4::233     2e-63  51%  248 aa  HIS4_OLICO RecName:
    1::238     3e-63  50%  243 aa  HIS4_AZOC5 RecName:
    1::230     4e-63  50%  245 aa  HIS4_RHOP2 RecName:
    1::230     7e-63  50%  245 aa  HIS4_RHOP5 RecName:
    1::240     1e-62  49%  248 aa  HIS4_SINMW RecName:
    1::246     1e-62  50%  251 aa  HIS4_DESOH RecName:
    1::237     4e-62  51%  249 aa  HIS4_DESVV RecName:
    1::237     4e-62  51%  249 aa  HIS4_DESVH RecName:
    1::240     2e-61  47%  243 aa  HIS4_BRUSI RecName:
    1::240     2e-61  47%  243 aa  HIS4_BRUO2 RecName:
    1::240     2e-61  47%  243 aa  HIS4_BRUME RecName:
    1::240     2e-61  47%  243 aa  HIS4_BRUMB RecName:
    1::240     2e-61  47%  243 aa  HIS4_BRUC2 RecName:
    1::240     2e-61  47%  243 aa  HIS4_BRUAB RecName:
    1::240     2e-61  47%  243 aa  HIS4_BRUA2 RecName:
    1::240     2e-61  47%  243 aa  HIS4_BRUA1 RecName:
    1::236     2e-61  50%  257 aa  HIS4_ANASP RecName:
    1::236     2e-61  51%  256 aa  HIS4_SYNY3 RecName:
    1::236     2e-61  50%  257 aa  HIS4_ANAVT RecName:
    1::241     3e-61  47%  242 aa  HIS4_ERYLH RecName:
    1::241     4e-61  49%  246 aa  HIS4_METSB RecName:
    5::236     5e-61  50%  242 aa  HIS4_GRABC RecName:
    1::241     5e-61  49%  242 aa  HIS4_BEII9 RecName:
    1::244     6e-61  48%  244 aa  HIS4_AGRVS RecName:
    1::238     8e-61  49%  247 aa  HIS4_RHOCS RecName:
    1::238     8e-61  47%  247 aa  HIS4_RHILO RecName:
    1::240     8e-61  47%  243 aa  HIS4_BRUSU RecName:
    1::240     1e-60  48%  247 aa  HIS4_AGRT5 RecName:
    1::241     1e-60  48%  244 aa  HIS4_MESSB RecName:
    1::237     1e-60  48%  245 aa  HIS4_DESDG RecName:
    3::242     2e-60  48%  243 aa  HIS4_SPHWW RecName:
    1::234     2e-60  49%  245 aa  HIS4_RHOPT RecName:
    1::234     2e-60  49%  245 aa  HIS4_RHOPA RecName:
    1::240     3e-60  47%  245 aa  HIS4_RHISN RecName:
    1::240     3e-60  46%  247 aa  HIS4_RHIME RecName:
    1::236     4e-60  50%  256 aa  HIS4_SYNP2 RecName:
    1::230     4e-60  49%  246 aa  HIS4_NITHX RecName:
    1::236     9e-60  50%  254 aa  HIS4_AZOBR RecName:
    1::234     1e-59  52%  239 aa  HIS4_RHOS5 RecName:
    1::234     2e-59  51%  238 aa  HIS4_PARDP RecName:
    1::240     2e-59  45%  241 aa  HIS4_NOVAD RecName:
    1::240     3e-59  46%  243 aa  HIS4_OCHA4 RecName:
    1::234     3e-59  51%  238 aa  HIS4_JANSC RecName:
    1::233     6e-59  47%  236 aa  HIS4_CLOCE RecName:
    1::225     6e-59  52%  240 aa  HIS41_SILPO RecName:
    1::247     1e-58  47%  256 aa  HIS4_SYNFM RecName:
    1::230     2e-58  47%  249 aa  HIS4_AGRRK RecName:
    1::237     3e-58  48%  243 aa  HIS4_DESVM RecName:
    1::236     4e-58  48%  257 aa  HIS4_NOSP7 RecName:
    1::237     8e-58  46%  237 aa  HIS4_CLOTH RecName:
    1::237     1e-57  46%  237 aa  HIS4_THEP3 RecName:
    3::247     1e-57  47%  250 aa  HIS4_DESHD RecName:
    1::234     1e-57  51%  236 aa  HIS4_RHOCA RecName:
    1::240     1e-57  46%  246 aa  HIS4_DESRM RecName:
    1::238     2e-57  47%  244 aa  HIS4_THEYD RecName:
    1::239     2e-57  45%  243 aa  HIS4_MOOTA RecName:
    5::245     3e-57  45%  250 aa  HIS4_ZYMMO RecName:
    1::234     3e-57  50%  239 aa  HIS4_RHOSK RecName:
    1::234     3e-57  50%  239 aa  HIS4_RHOS4 RecName:
    1::234     3e-57  50%  239 aa  HIS4_RHOS1 RecName:
    1::236     5e-57  49%  257 aa  HIS4_THEEB RecName:
    1::241     5e-57  42%  262 aa  HIS4_DESAP RecName:
    1::236     5e-57  48%  257 aa  HIS4_CYAP7 RecName:
    1::238     9e-57  45%  239 aa  HIS4_MAGSA RecName:
    1::239     1e-56  45%  255 aa  HIS4_GLOVI RecName:
    1::241     2e-56  47%  244 aa  HIS4_SYNWW RecName:
    1::236     3e-56  47%  242 aa  HIS4_DESAD RecName:
    1::232     4e-56  44%  259 aa  HIS4_PELTS RecName:
    1::238     6e-56  50%  239 aa  HIS4_ROSDO RecName:
    4::246     6e-56  47%  249 aa  HIS4_BREBN RecName:
    1::233     8e-56  47%  239 aa  HIS4_CLOPH RecName:
    1::238     1e-55  47%  255 aa  HIS4_PROM4 RecName:
    1::242     2e-55  45%  256 aa  HIS4_PROM1 RecName:
    6::239     2e-55  44%  245 aa  HIS4_BACP2 RecName:
    1::242     3e-55  46%  256 aa  HIS4_PROMT RecName:
    1::239     3e-55  46%  241 aa  HIS4_CAUSK RecName:
    6::243     3e-55  45%  245 aa  HIS4_BACA2 RecName:
    1::239     4e-55  45%  241 aa  HIS4_CAUCR RecName:
    8::239     7e-55  45%  245 aa  HIS4_BACLD RecName:
    1::236     9e-55  47%  257 aa  HIS4_CYAA5 RecName:
    5::240     9e-55  46%  244 aa  HIS4_BACHD RecName:
    1::236     1e-54  47%  257 aa  HIS4_CYAP4 RecName:
    1::234     2e-54  46%  237 aa  HIS4_ROSCS RecName:
    1::235     2e-54  46%  240 aa  HIS4_LISW6 RecName:
    6::241     3e-54  45%  245 aa  HIS4_GEOKA RecName:
    4::235     3e-54  46%  244 aa  HIS4_SPHAL RecName:
    1::237     4e-54  43%  247 aa  HIS4_DESMR RecName:
    1::245     4e-54  44%  248 aa  HIS4_DESHY RecName:
    4::244     6e-54  46%  253 aa  HIS4_METS4 RecName:
    1::230     7e-54  46%  237 aa  HIS4_SULNB RecName:
    1::232     7e-54  45%  237 aa  HIS4_DEHE1 RecName:
    1::235     1e-53  45%  240 aa  HIS4_LISMF RecName:
    1::235     1e-53  45%  240 aa  HIS4_LISMC RecName:
    1::237     1e-53  44%  253 aa  HIS4_MICAN RecName:
    4::233     1e-53  46%  253 aa  HIS4_METNO RecName:
    5::240     1e-53  47%  241 aa  HIS4_HYPNA RecName:
    1::235     4e-53  44%  240 aa  HIS4_LISMH RecName:
   10::239     4e-53  45%  244 aa  HIS4_DEHSC RecName:
    6::239     5e-53  45%  245 aa  HIS4_GEOTN RecName:
    1::228     6e-53  47%  236 aa  HIS4_SULDN RecName:
    1::237     6e-53  45%  239 aa  HIS4_BACHK RecName:
    1::236     1e-52  44%  238 aa  HIS4_NITSB RecName:
    5::241     1e-52  44%  246 aa  HIS4_METBU RecName:
    1::237     1e-52  44%  239 aa  HIS4_BACC0 RecName:
   12::250     1e-52  44%  253 aa  HIS4_RHOBA RecName:
    1::235     1e-52  44%  240 aa  HIS4_LISMO RecName:
    1::237     1e-52  44%  239 aa  HIS4_BACAN RecName:
    1::237     1e-52  44%  239 aa  HIS4_BACAC RecName:
    1::237     1e-52  44%  239 aa  HIS4_BACAA RecName:
    1::231     3e-52  43%  237 aa  HIS4_ALKMQ RecName:
    1::235     4e-52  45%  256 aa  HIS4_SYNPW RecName:
    1::236     5e-52  46%  236 aa  HIS4_CAMHC RecName:
    1::241     7e-52  45%  241 aa  HIS4_CHLAD RecName:
    5::236     9e-52  44%  240 aa  HIS4_BACSK RecName:
    1::235     1e-51  44%  240 aa  HIS4_LISIN RecName:
    1::234     1e-51  44%  235 aa  HIS4_ARCB4 RecName:
    1::237     2e-51  44%  239 aa  HIS4_BACC3 RecName:
    1::237     2e-51  44%  239 aa  HIS4_BACAH RecName:
    1::236     2e-51  46%  256 aa  HIS4_SYNP6 RecName:
    1::236     2e-51  46%  256 aa  HIS4_SYNE7 RecName:
    7::238     2e-51  40%  239 aa  HIS4_SULSY RecName:
    1::237     2e-51  43%  239 aa  HIS4_BACCR RecName:
    1::235     3e-51  42%  238 aa  HIS4_CLOK5 RecName:
    1::235     3e-51  42%  238 aa  HIS4_CLOK1 RecName:
    1::238     3e-51  41%  239 aa  HIS4_CLOAB RecName:
    1::231     5e-51  43%  236 aa  HIS4_CAMC1 RecName:
    1::233     6e-51  45%  240 aa  HIS4_OCEIH RecName:
    1::236     6e-51  45%  257 aa  HIS4_CYAP8 RecName:
    1::237     6e-51  43%  239 aa  HIS4_BACWK RecName:
    1::231     8e-51  44%  236 aa  HIS4_CAMFF RecName:
    1::231     8e-51  44%  236 aa  HIS4_CAMC5 RecName:
    1::237     8e-51  43%  239 aa  HIS4_BACCQ RecName:
    1::237     8e-51  43%  239 aa  HIS4_BACC2 RecName:
    1::238     1e-50  41%  238 aa  HIS4_CLONN RecName:
    1::230     1e-50  43%  262 aa  HIS4_CHLT3 RecName:
    5::242     1e-50  43%  246 aa  HIS4_METMA RecName:
    1::237     1e-50  43%  239 aa  HIS4_BACC1 RecName:
    1::237     2e-50  43%  239 aa  HIS4_BACC7 RecName:
    1::237     2e-50  43%  239 aa  HIS4_BACC4 RecName:
    1::228     4e-50  44%  260 aa  HIS4_CHLP8 RecName:
    1::237     5e-50  43%  239 aa  HIS4_BACCZ RecName:
    1::228     7e-50  43%  256 aa  HIS4_PROVI RecName:
    1::231     9e-50  44%  235 aa  HIS4_NAUPA RecName:
    1::242     1e-49  40%  242 aa  HIS4_CLOBL RecName:
    1::238     2e-49  40%  255 aa  HIS4_PROM9 RecName:
    1::228     2e-49  43%  260 aa  HIS4_CHLTE RecName:
    1::236     3e-49  40%  244 aa  HIS4_UNCTG RecName:
    1::232     3e-49  41%  240 aa  HIS4_CLOD6 RecName:
    1::240     3e-49  40%  242 aa  HIS4_CLOBK RecName:
    1::228     4e-49  44%  261 aa  HIS4_PROA2 RecName:
    5::239     6e-49  44%  245 aa  HIS4_METAC RecName:
    1::238     6e-49  43%  250 aa  HIS4_DESDA RecName:
    1::242     6e-49  40%  242 aa  HIS4_CLOBH RecName:
    1::242     6e-49  40%  242 aa  HIS4_CLOB1 RecName:
    1::240     7e-49  40%  242 aa  HIS4_CLOB6 RecName:
    1::229     7e-49  43%  238 aa  HIS4_ANADF RecName:
    1::237     9e-49  44%  240 aa  HIS4_WOLSU RecName:
    1::238     2e-48  39%  238 aa  HIS4_BRAHW RecName:
    6::244     2e-48  40%  245 aa  HIS4_BACSU RecName:
    1::236     2e-48  42%  255 aa  HIS4_PROMM RecName:
    1::235     3e-48  41%  255 aa  HIS4_PROMS RecName:
    1::237     3e-48  45%  240 aa  HIS4_DINSH RecName:
    1::242     3e-48  40%  242 aa  HIS4_CLOBJ RecName:
    3::243     3e-48  41%  246 aa  HIS4_ACICJ RecName:
    1::228     5e-48  42%  256 aa  HIS4_PELLD RecName:
    1::237     5e-48  41%  239 aa  HIS4_BACCN RecName:
    7::238     6e-48  40%  241 aa  HIS4_PERMH RecName:
    1::243     6e-48  42%  243 aa  HIS4_CARHZ RecName:
    1::235     8e-48  40%  255 aa  HIS4_PROM0 RecName:
    1::236     1e-47  45%  241 aa  HIS4_CHLSY RecName:
    1::236     1e-47  45%  241 aa  HIS4_CHLAA RecName:
    1::235     1e-47  41%  255 aa  HIS4_PROMP RecName:
    1::228     1e-47  42%  257 aa  HIS4_CHLCH RecName:
    1::228     2e-47  42%  256 aa  HIS4_PELPB RecName:
    5::235     2e-47  46%  243 aa  HIS4_HELHP RecName:
    1::228     2e-47  42%  260 aa  HIS4_CHLPB RecName:
    5::236     2e-47  42%  240 aa  HIS4_UNCMA RecName:
    1::237     2e-47  40%  255 aa  HIS4_SYNSC RecName:
    1::232     3e-47  40%  243 aa  HIS4_OPITP RecName:
    1::235     4e-47  41%  255 aa  HIS4_PROM5 RecName:
    1::236     1e-46  41%  255 aa  HIS4_PROM3 RecName:
    5::242     2e-46  45%  249 aa  HIS4_SYMTH RecName:
    1::234     2e-46  41%  237 aa  HIS4_ROSS1 RecName:
    1::234     2e-46  41%  235 aa  HIS4_THEPX RecName:
    1::234     2e-46  39%  242 aa  HIS4_METVO RecName:
    1::241     3e-46  41%  256 aa  HIS4_SYNS3 RecName:
    1::236     3e-46  41%  255 aa  HIS4_SYNS9 RecName:
   10::241     3e-46  43%  261 aa  HIS4_SYNJB RecName:
    1::206     3e-46  46%  237 aa  HIS4_HALOH RecName:
    1::233     6e-46  42%  252 aa  HIS4_SYNR3 RecName:
    1::230     7e-46  41%  244 aa  HIS4_THERP RecName:
    1::228     1e-45  40%  256 aa  HIS4_CHLPD RecName:
    1::238     1e-45  37%  238 aa  HIS4_METM5 RecName:
    1::233     3e-45  42%  240 aa  HIS4_HERA2 RecName:
    1::238     4e-45  37%  238 aa  HIS4_METM7 RecName:
    1::238     4e-45  37%  238 aa  HIS4_METM6 RecName:
    1::236     6e-45  39%  255 aa  HIS4_SYNPX RecName:
    1::234     6e-45  37%  241 aa  HIS4_METMP RecName:
    1::236     6e-45  39%  238 aa  HIS4_ANADE RecName:
    1::233     1e-44  42%  239 aa  HIS4_STRMU RecName:
    1::238     1e-44  38%  238 aa  HIS4_METVS RecName:
    1::233     1e-44  40%  239 aa  HIS4_METTH RecName:
    5::242     1e-44  40%  242 aa  HIS4_METTP RecName:
    5::239     2e-44  41%  245 aa  HIS4_METBF RecName:
    3::232     2e-44  41%  258 aa  HIS4_SALRD RecName:
    3::235     7e-44  41%  242 aa  HIS4_STRSV RecName:
    1::234     9e-44  40%  237 aa  HIS4_CALS8 RecName:
    1::238     2e-43  37%  238 aa  HIS4_METVA RecName:
    1::227     2e-43  40%  238 aa  HIS4_ANASK RecName:
    1::227     2e-43  40%  238 aa  HIS4_ANAD2 RecName:
    7::241     3e-43  39%  244 aa  HIS4_NOCSJ RecName:
    1::232     3e-43  39%  239 aa  HIS4_PELUB RecName:
    1::237     8e-43  38%  237 aa  HIS4_METST RecName:
    1::236     1e-42  40%  237 aa  HIS4_METJA RecName:
    3::235     1e-42  38%  241 aa  HIS4_SALAI RecName:
   10::250     1e-42  38%  258 aa  HIS4_CORJK RecName:
    1::231     2e-42  40%  246 aa  HIS4_LACLS RecName:
    1::234     3e-42  37%  237 aa  HIS4_ANATD RecName:
    1::231     7e-42  39%  239 aa  HIS4_LACLA RecName:
    1::232     9e-42  39%  236 aa  HIS4_METPE RecName:
   10::243     9e-42  38%  245 aa  HIS4_HALWD RecName:
    4::241     2e-41  39%  256 aa  HIS4_PROMA RecName:
    1::231     2e-41  40%  246 aa  HIS4_LACLM RecName:
    1::237     2e-41  37%  240 aa  HIS4_CLOB8 RecName:
    7::238     3e-41  37%  239 aa  HIS4_NATPD RecName:
    1::239     7e-41  39%  241 aa  HIS4_SORC5 RecName:
    1::231     9e-41  42%  239 aa  HIS4_STRTD RecName:
    1::222     9e-41  36%  237 aa  HIS4_GEMAT RecName:
    3::243     1e-40  38%  243 aa  HIS4_NOCFA RecName:
    1::235     1e-40  39%  236 aa  HIS4_METLZ RecName:
    4::236     2e-40  40%  239 aa  HIS4_PARD8 RecName:
    1::237     2e-40  38%  237 aa  HIS4_CLOBA RecName:
    1::232     5e-40  40%  238 aa  HIS4_LEUMM RecName:
    5::245     5e-40  37%  246 aa  HIS4_CORGL RecName:
    6::238     8e-40  38%  245 aa  HIS4_FRAAA RecName:
   10::204     1e-39  44%  261 aa  HIS4_SYNJA RecName:
    3::243     2e-39  36%  244 aa  HIS4_MYCLE RecName: Full=Phosphoribosyl isomerase A;AltName:
    8::208     3e-39  38%  242 aa  HIS4_HALSA RecName:
   21::247     4e-39  38%  248 aa  HIS4_ARTS2 RecName:
   11::246     5e-39  36%  247 aa  HIS4_ARTAT RecName:
    1::239     3e-38  33%  241 aa  HIS4_META3 RecName:
    4::233     3e-38  34%  238 aa  HIS4_ARCFU RecName:
    4::234     3e-38  38%  239 aa  HIS4_BACV8 RecName:
    1::231     4e-38  41%  238 aa  HIS4_LACC3 RecName:
    7::234     4e-38  36%  238 aa  HIS4_AQUAE RecName:
    7::244     6e-38  36%  245 aa  HIS4_THEFY RecName:
    1::238     7e-38  41%  239 aa  HIS4_LEGPH RecName:
    3::240     7e-38  39%  241 aa  HIS4_LACPL RecName:
    1::238     1e-37  40%  239 aa  HIS4_LEGPA RecName:
    5::241     1e-37  35%  255 aa  HIS4_PROAC RecName:
    7::244     1e-37  35%  248 aa  HIS4_MYCSS RecName: Full=Phosphoribosyl isomerase A;AltName:
    7::244     1e-37  35%  248 aa  HIS4_MYCSK RecName: Full=Phosphoribosyl isomerase A;AltName:
    7::244     1e-37  35%  248 aa  HIS4_MYCSJ RecName: Full=Phosphoribosyl isomerase A;AltName:
    3::240     2e-37  36%  244 aa  HIS4_RHOSR RecName:
    1::235     2e-37  35%  236 aa  HIS4_METHJ RecName:
    1::238     2e-37  40%  239 aa  HIS4_LEGPL RecName:
    6::240     2e-37  36%  241 aa  HIS4_ACIC1 RecName:
    1::231     2e-37  38%  235 aa  HIS4_THET8 RecName:
    1::233     2e-37  38%  241 aa  HIS4_GRAFK RecName:
    1::233     2e-37  36%  241 aa  HIS4_FLAPJ RecName:
    5::245     2e-37  35%  246 aa  HIS4_COREF RecName:
    5::243     3e-37  36%  243 aa  HIS4_SACEN RecName:
    3::240     3e-37  36%  244 aa  HIS4_RHOOB RecName:
    1::239     3e-37  37%  241 aa  HIS4_LEPIN RecName:
    1::239     3e-37  37%  241 aa  HIS4_LEPIC RecName:
    3::241     3e-37  36%  241 aa  HIS4_BIFLO RecName:
    3::241     3e-37  36%  241 aa  HIS4_BIFLI RecName:
    1::240     4e-37  41%  240 aa  HIS4_ELUMP RecName:
    3::243     5e-37  35%  244 aa  HIS4_MYCTU RecName: Full=Phosphoribosyl isomerase A;AltName:
    4::244     5e-37  35%  245 aa  HIS4_MYCTA RecName: Full=Phosphoribosyl isomerase A;AltName:
    4::244     5e-37  35%  245 aa  HIS4_MYCBT RecName: Full=Phosphoribosyl isomerase A;AltName:
    4::244     5e-37  35%  245 aa  HIS4_MYCBP RecName: Full=Phosphoribosyl isomerase A;AltName:
    3::243     5e-37  35%  244 aa  HIS4_MYCBO RecName: Full=Phosphoribosyl isomerase A;AltName:
    1::233     5e-37  39%  234 aa  HIS4_CENSY RecName:
    8::243     6e-37  37%  244 aa  HIS4_RENSM RecName:
   10::246     6e-37  34%  248 aa  HIS4_LEIXX RecName:
    1::233     6e-37  36%  240 aa  HIS4_FLAJ1 RecName:
    3::241     6e-37  36%  241 aa  HIS4_BIFLD RecName:
   13::234     6e-37  38%  240 aa  HIS4_AZOPC RecName:
    3::240     8e-37  36%  243 aa  HIS4_MYCA9 RecName: Full=Phosphoribosyl isomerase A;AltName:
    1::232     8e-37  36%  236 aa  HIS4_METB6 RecName:
    1::239     8e-37  40%  241 aa  HIS4_FRAP2 RecName:
    5::240     8e-37  36%  242 aa  HIS4_CORDI RecName:
    2::239     1e-36  35%  243 aa  HIS4_MYCA1 RecName: Full=Phosphoribosyl isomerase A;AltName:
    2::239     2e-36  35%  243 aa  HIS4_MYCPA RecName: Full=Phosphoribosyl isomerase A;AltName:
    1::238     2e-36  39%  239 aa  HIS4_LEGPC RecName:
    4::237     5e-36  39%  239 aa  HIS4_BACFR RecName:
    1::237     7e-36  35%  240 aa  HIS4_THETN RecName:
    3::243     7e-36  35%  244 aa  HIS4_MYCUA RecName: Full=Phosphoribosyl isomerase A;AltName:
    3::241     7e-36  35%  241 aa  HIS4_BIFAA RecName:
    4::237     7e-36  38%  239 aa  HIS4_BACFN RecName:
    4::226     9e-36  39%  234 aa  HIS4_STAAW RecName:
    4::226     9e-36  39%  234 aa  HIS4_STAAT RecName:
    4::226     9e-36  39%  234 aa  HIS4_STAAS RecName:
    4::226     9e-36  39%  234 aa  HIS4_STAAE RecName:
    4::226     9e-36  39%  234 aa  HIS4_STAAC RecName:
    4::226     9e-36  39%  234 aa  HIS4_STAA8 RecName:
    4::226     9e-36  39%  234 aa  HIS4_STAA3 RecName:
    4::226     1e-35  38%  234 aa  HIS4_STAAR RecName:
    1::234     1e-35  34%  238 aa  HIS4_METTL RecName:
    6::236     2e-35  37%  241 aa  HIS4_STRGG RecName: Full=Phosphoribosyl isomerase A;AltName:
   14::250     2e-35  34%  255 aa  HIS4_MYCVP RecName: Full=Phosphoribosyl isomerase A;AltName:
    8::229     2e-35  36%  238 aa  HIS4_DEIRA RecName:
    4::226     3e-35  38%  234 aa  HIS4_STAAN RecName:
    4::226     3e-35  38%  234 aa  HIS4_STAAM RecName:
    4::226     3e-35  38%  234 aa  HIS4_STAA9 RecName:
    4::226     3e-35  38%  234 aa  HIS4_STAA2 RecName:
    4::226     3e-35  38%  234 aa  HIS4_STAA1 RecName:
    1::231     3e-35  40%  238 aa  HIS4_LACCB RecName:
    4::225     5e-35  37%  234 aa  HIS4_STAS1 RecName:
    1::232     6e-35  38%  235 aa  HIS4_THET2 RecName:
    1::240     6e-35  38%  247 aa  HIS4_AERHH RecName:
    1::240     1e-34  39%  245 aa  HIS4_ALTMD RecName:
    1::239     1e-34  38%  245 aa  HIS4_PSYIN RecName:
    3::240     1e-34  34%  242 aa  HIS4_BIFA0 RecName:
   13::234     1e-34  38%  239 aa  HIS4_BACTN RecName:
    3::235     2e-34  36%  241 aa  HIS4_SALTO RecName:
    1::240     2e-34  37%  248 aa  HIS4_AERS4 RecName:
    3::240     3e-34  35%  244 aa  HIS4_RHOE4 RecName:
    1::240     3e-34  37%  245 aa  HIS4_PROMH RecName:
    1::240     3e-34  36%  247 aa  HIS4_LEPBP RecName:
    1::240     3e-34  36%  247 aa  HIS4_LEPBA RecName:
    3::223     3e-34  37%  245 aa  HIS4_FRASN RecName:
    1::239     4e-34  38%  245 aa  HIS41_PHOLL RecName:
    4::226     5e-34  37%  234 aa  HIS4_STAAB RecName:
    1::231     7e-34  35%  236 aa  HIS4_NITMS RecName:
    6::210     9e-34  37%  234 aa  HIS4_STACT RecName:
    6::236     1e-33  36%  240 aa  HIS4_STRCO RecName: Full=Phosphoribosyl isomerase A;AltName:
   13::234     2e-33  37%  240 aa  HIS4_CYTH3 RecName:
    5::230     3e-33  41%  240 aa  HIS4_PYRFU RecName:
    6::244     4e-33  37%  249 aa  HIS4_PASMU RecName:
    5::243     4e-33  37%  249 aa  HIS4_ACTSZ RecName:
    1::230     6e-33  40%  233 aa  HIS4_PYRKO RecName:
    5::243     6e-33  38%  249 aa  HIS4_HAEIN RecName:
    5::243     6e-33  38%  249 aa  HIS4_HAEIG RecName:
    5::243     6e-33  38%  249 aa  HIS4_HAEIE RecName:
    5::243     6e-33  38%  249 aa  HIS4_HAEI8 RecName:
   11::233     6e-33  34%  243 aa  HIS4_DEIGD RecName:
    1::236     6e-33  33%  247 aa  HIS42_SILPO RecName:
    1::205     9e-33  31%  238 aa  HIS4_MYXXD RecName:
   15::251     9e-33  35%  258 aa  HIS42_PHOLL RecName:
    1::239     1e-32  38%  245 aa  HIS4_SHEFN RecName:
    7::242     2e-32  35%  242 aa  HIS4_STRAW RecName: Full=Phosphoribosyl isomerase A;AltName:
    1::239     2e-32  39%  244 aa  HIS4_MARMM RecName:
    7::209     2e-32  34%  246 aa  HIS4_HALMA RecName:
    4::225     3e-32  36%  234 aa  HIS4_STAEQ RecName:
    1::240     6e-32  38%  245 aa  HIS4_TOLAT RecName:
    1::241     6e-32  35%  246 aa  HIS4_SODGM RecName:
    3::233     6e-32  36%  252 aa  HIS4_FRASC RecName:
    1::212     8e-32  42%  229 aa  HIS4_THEON RecName:
    4::225     8e-32  36%  234 aa  HIS4_STAES RecName:
    5::243     8e-32  37%  249 aa  HIS4_MANSM RecName:
    1::240     8e-32  37%  261 aa  HIS4_COLP3 RecName:
    1::243     8e-32  40%  248 aa  HIS4_BAUCH RecName:
    1::240     1e-31  36%  245 aa  HIS4_VIBVU RecName:
    4::238     1e-31  36%  243 aa  HIS4_CAMJJ RecName:
    4::238     1e-31  36%  244 aa  HIS4_CAMJ8 RecName:
    1::238     2e-31  36%  244 aa  HIS4_PHOPR RecName:
    4::238     2e-31  36%  243 aa  HIS4_CAMJE RecName:
    1::240     2e-31  38%  245 aa  HIS4_SHEAM RecName:
    1::240     3e-31  36%  245 aa  HIS4_VIBPA RecName:
    6::244     3e-31  37%  250 aa  HIS4_ACTPJ RecName:
    6::244     3e-31  37%  250 aa  HIS4_ACTP2 RecName:
    1::240     4e-31  36%  245 aa  HIS4_VIBVY RecName:
    1::240     4e-31  36%  245 aa  HIS4_VIBHB RecName:
    1::239     4e-31  36%  241 aa  HIS4_BUCBP RecName:
    1::237     4e-31  33%  247 aa  HIS41_SILST RecName:
    1::238     5e-31  35%  245 aa  HIS4_VIBF1 RecName:
    1::240     5e-31  34%  245 aa  HIS4_ERWCT RecName:
    1::238     5e-31  33%  242 aa  HIS4_DICT6 RecName:
    6::244     5e-31  37%  250 aa  HIS4_ACTP7 RecName:
    4::243     1e-30  36%  244 aa  HIS4_STRMK RecName:
    1::240     1e-30  34%  245 aa  HIS4_PECCP RecName:
    1::240     2e-30  34%  245 aa  HIS4_YERE8 RecName:
    1::242     2e-30  35%  251 aa  HIS4_BLOFL RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERPY RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERPS RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERPP RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERPN RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERPG RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERPE RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERPB RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERPA RecName:
    1::240     3e-30  34%  245 aa  HIS4_YERP3 RecName:
    1::240     3e-30  36%  245 aa  HIS4_SHEPA RecName:
    1::239     3e-30  35%  245 aa  HIS4_SHEPW RecName:
    1::238     4e-30  35%  245 aa  HIS4_VIBFM RecName:
    1::240     4e-30  35%  245 aa  HIS4_VIBCH RecName:
    1::240     4e-30  34%  245 aa  HIS4_SERP5 RecName:
    1::239     4e-30  37%  244 aa  HIS4_PSEA6 RecName:
    1::239     4e-30  34%  241 aa  HIS4_LEPBL RecName:
    1::239     4e-30  34%  241 aa  HIS4_LEPBJ RecName:
    1::238     4e-30  35%  245 aa  HIS4_ALISL RecName:
    1::235     7e-30  31%  242 aa  HIS4_DICTD RecName:
    4::238     7e-30  35%  244 aa  HIS4_CAMJD RecName:
    4::243     1e-29  35%  244 aa  HIS4_STRM5 RecName:
    1::239     1e-29  34%  245 aa  HIS4_SALAR RecName:
    1::240     1e-29  34%  245 aa  HIS4_ERWT9 RecName:
    4::238     2e-29  36%  243 aa  HIS4_CAMJR RecName:
    4::242     2e-29  32%  265 aa  HIS4_XYLFA RecName:
    1::239     2e-29  35%  245 aa  HIS4_SHEWM RecName:
    1::240     4e-29  35%  245 aa  HIS4_SHEHH RecName:
    4::242     6e-29  32%  269 aa  HIS4_XYLFM RecName:
    7::243     6e-29  34%  244 aa  HIS4_XANOR RecName:
    7::243     6e-29  34%  244 aa  HIS4_XANOP RecName:
    7::243     6e-29  34%  244 aa  HIS4_XANOM RecName:
    1::184     6e-29  37%  239 aa  HIS4_METMJ RecName:
    7::243     8e-29  34%  244 aa  HIS4_XANAC RecName:
    1::241     8e-29  35%  246 aa  HIS4_BLOPB RecName:
    1::240     1e-28  37%  245 aa  HIS4_IDILO RecName:
    1::228     1e-28  31%  241 aa  HIS4_THESQ RecName:
    1::228     1e-28  31%  241 aa  HIS4_THEMA RecName:
    8::214     1e-28  36%  243 aa  HIS4_RUBXD RecName:
    1::238     1e-28  37%  245 aa  HIS4_BUCCC RecName:
    1::239     3e-28  35%  246 aa  HIS4_SHESH RecName:
    1::246     7e-28  36%  246 aa  HIS4_BUCAT RecName:
    1::246     1e-27  36%  246 aa  HIS4_BUCAI RecName:
    1::246     1e-27  36%  246 aa  HIS4_BUCA5 RecName:
    1::219     2e-27  38%  250 aa  HIS4_SHEDO RecName:
    1::240     3e-27  33%  245 aa  HIS4_EDWI9 RecName:
    1::228     3e-27  31%  241 aa  HIS4_THEP1 RecName:
    7::207     5e-27  36%  244 aa  HIS4_XANC5 RecName:
    1::240     6e-27  36%  245 aa  HIS4_SHELP RecName:
    1::214     8e-27  35%  245 aa  HIS4_SHESW RecName:
    1::214     8e-27  36%  245 aa  HIS4_SHESM RecName:
    1::214     1e-26  37%  245 aa  HIS4_SHEON RecName:
    4::230     1e-26  32%  242 aa  HIS4_METKA RecName:
    4::242     1e-26  31%  269 aa  HIS4_XYLFT RecName:
    4::242     1e-26  31%  269 aa  HIS4_XYLF2 RecName:
    1::214     2e-26  36%  245 aa  HIS4_SHESR RecName:
    1::214     2e-26  35%  245 aa  HIS4_SHEB9 RecName:
    1::214     2e-26  35%  245 aa  HIS4_SHEB5 RecName:
    1::214     4e-26  35%  245 aa  HIS4_SHEB8 RecName:
    1::214     4e-26  35%  245 aa  HIS4_SHEB2 RecName:
    1::228     9e-26  32%  248 aa  HIS4_THENN RecName:
    1::214     9e-26  35%  245 aa  HIS4_SHEPC RecName:
    1::238     2e-25  34%  244 aa  HIS4_BUCAP RecName:
    4::229     9e-25  35%  252 aa  HIS6_MAGSA RecName: Full=Imidazole glycerol phosphate synthase
    1::214     9e-25  35%  245 aa  HIS4_SHESA RecName:
    1::240     3e-24  31%  245 aa  HIS4_ECO45 RecName:
    6::239     5e-24  33%  256 aa  HIS6_METSB RecName: Full=Imidazole glycerol phosphate synthase
    4::246     1e-23  33%  261 aa  HIS6_AZOBR RecName: Full=Imidazole glycerol phosphate synthase
    7::243     2e-23  31%  244 aa  HIS4_XANCP RecName:
    7::243     2e-23  31%  244 aa  HIS4_XANCB RecName:
    7::243     2e-23  31%  244 aa  HIS4_XANC8 RecName:
    6::221     2e-22  34%  253 aa  HIS6_GEOUR RecName: Full=Imidazole glycerol phosphate synthase
    6::212     2e-22  32%  253 aa  HIS6_GEOSL RecName: Full=Imidazole glycerol phosphate synthase
    6::212     2e-22  32%  253 aa  HIS6_GEOMG RecName: Full=Imidazole glycerol phosphate synthase
    6::212     3e-22  33%  254 aa  HIS6_GEOLS RecName: Full=Imidazole glycerol phosphate synthase
    6::224     3e-22  33%  256 aa  HIS6_PSYWF RecName: Full=Imidazole glycerol phosphate synthase
    6::244     6e-22  31%  251 aa  HIS6_THIDA RecName: Full=Imidazole glycerol phosphate synthase
    6::221     6e-22  34%  253 aa  HIS6_GEOSF RecName: Full=Imidazole glycerol phosphate synthase
    8::213     6e-22  31%  252 aa  HIS6_CAMC5 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     1e-21  33%  257 aa  HIS6_PROM5 RecName: Full=Imidazole glycerol phosphate synthase
    7::225     2e-21  34%  257 aa  HIS6_HAHCH RecName: Full=Imidazole glycerol phosphate synthase
    6::217     2e-21  35%  254 aa  HIS6_CHRVO RecName: Full=Imidazole glycerol phosphate synthase
    1::239     2e-21  31%  245 aa  HIS4_ENT38 RecName:
    6::208     2e-21  31%  253 aa  HIS6_THEPX RecName: Full=Imidazole glycerol phosphate synthase
    9::228     2e-21  32%  252 aa  HIS6_PELTS RecName: Full=Imidazole glycerol phosphate synthase
    7::229     2e-21  29%  252 aa  HIS6_METFK RecName: Full=Imidazole glycerol phosphate synthase
    6::234     2e-21  31%  258 aa  HIS6_MAGSM RecName: Full=Imidazole glycerol phosphate synthase
    1::209     2e-21  34%  242 aa  HIS4_PSEHT RecName:
    6::220     3e-21  31%  254 aa  HIS6_OCEIH RecName: Full=Imidazole glycerol phosphate synthase
    6::217     3e-21  34%  254 aa  HIS6_LARHH RecName: Full=Imidazole glycerol phosphate synthase
    8::212     3e-21  30%  252 aa  HIS6_CAMHC RecName: Full=Imidazole glycerol phosphate synthase
    7::246     5e-21  31%  256 aa  HIS6_PSEPF RecName: Full=Imidazole glycerol phosphate synthase
    6::214     5e-21  33%  255 aa  HIS6_PELCD RecName: Full=Imidazole glycerol phosphate synthase
    1::239     5e-21  30%  245 aa  HIS4_KLEP7 RecName:
    7::220     6e-21  32%  256 aa  HIS6_PSEF5 RecName: Full=Imidazole glycerol phosphate synthase
    1::241     6e-21  30%  246 aa  HIS4_SHIDS RecName:
    1::240     6e-21  30%  245 aa  HIS4_ECO27 RecName:
    6::205     8e-21  31%  253 aa  HIS6_THETN RecName: Full=Imidazole glycerol phosphate synthase
    6::204     8e-21  33%  252 aa  HIS6_PERMH RecName: Full=Imidazole glycerol phosphate synthase
    6::207     8e-21  29%  251 aa  HIS6_FLAPJ RecName: Full=Imidazole glycerol phosphate synthase
    7::234     1e-20  29%  257 aa  HIS6_THICR RecName: Full=Imidazole glycerol phosphate synthase
    7::220     1e-20  32%  256 aa  HIS6_PSEPW RecName: Full=Imidazole glycerol phosphate synthase
    7::220     1e-20  32%  256 aa  HIS6_PSEPK RecName: Full=Imidazole glycerol phosphate synthase
    7::220     1e-20  32%  256 aa  HIS6_PSEPG RecName: Full=Imidazole glycerol phosphate synthase
    7::220     1e-20  32%  256 aa  HIS6_PSEP1 RecName: Full=Imidazole glycerol phosphate synthase
    7::220     1e-20  31%  256 aa  HIS6_PSEMY RecName: Full=Imidazole glycerol phosphate synthase
    7::220     1e-20  31%  256 aa  HIS6_PSEFS RecName: Full=Imidazole glycerol phosphate synthase
    7::220     1e-20  32%  256 aa  HIS6_PSEE4 RecName: Full=Imidazole glycerol phosphate synthase
    6::224     1e-20  29%  253 aa  HIS6_CLOTH RecName: Full=Imidazole glycerol phosphate synthase
    1::239     1e-20  29%  245 aa  HIS4_KLEP3 RecName:
    6::213     1e-20  32%  255 aa  HIS6_PROMP RecName: Full=Imidazole glycerol phosphate synthase
    6::229     1e-20  29%  252 aa  HIS6_DESRM RecName: Full=Imidazole glycerol phosphate synthase
    7::218     1e-20  30%  256 aa  HIS6_AZOVD RecName: Full=Imidazole glycerol phosphate synthase
    1::241     1e-20  30%  246 aa  HIS4_SHISS RecName:
    1::240     1e-20  30%  245 aa  HIS4_ESCF3 RecName:
    6::239     2e-20  30%  252 aa  HIS6_STAEQ RecName: Full=Imidazole glycerol phosphate synthase
    7::218     2e-20  30%  256 aa  HIS6_PSEA7 RecName: Full=Imidazole glycerol phosphate synthase
    7::214     2e-20  32%  255 aa  HIS6_IGNH4 RecName: Full=Imidazole glycerol phosphate synthase
    6::210     2e-20  27%  252 aa  HIS6_ALKMQ RecName: Full=Imidazole glycerol phosphate synthase
    1::240     2e-20  29%  245 aa  HIS4_ECOLC RecName:
    7::218     2e-20  30%  256 aa  HIS6_PSEAB RecName: Full=Imidazole glycerol phosphate synthase
    7::218     2e-20  30%  256 aa  HIS6_PSEA8 RecName: Full=Imidazole glycerol phosphate synthase
    7::218     2e-20  30%  256 aa  HIS61_PSEAE RecName: Full=Imidazole glycerol phosphate synthase
    1::240     2e-20  29%  245 aa  HIS4_SHIBS RecName:
    6::239     3e-20  30%  252 aa  HIS6_STAES RecName: Full=Imidazole glycerol phosphate synthase
    7::215     3e-20  31%  252 aa  HIS6_NITMU RecName: Full=Imidazole glycerol phosphate synthase
    6::229     3e-20  32%  252 aa  HIS6_AZOSB RecName: Full=Imidazole glycerol phosphate synthase
    1::240     3e-20  29%  245 aa  HIS4_SHIB3 RecName:
    1::240     3e-20  29%  245 aa  HIS4_ECOLU RecName:
    1::240     3e-20  29%  245 aa  HIS4_ECOHS RecName:
    1::240     3e-20  29%  245 aa  HIS4_ECO7I RecName:
    1::240     3e-20  29%  245 aa  HIS4_ECO24 RecName:
    6::209     4e-20  30%  249 aa  HIS6_SULAC RecName: Full=Imidazole glycerol phosphate synthase
    7::218     4e-20  30%  256 aa  HIS6_PSEU2 RecName: Full=Imidazole glycerol phosphate synthase
    7::218     4e-20  30%  256 aa  HIS6_PSE14 RecName: Full=Imidazole glycerol phosphate synthase
    7::233     4e-20  31%  257 aa  HIS6_MARMS RecName: Full=Imidazole glycerol phosphate synthase
    6::204     4e-20  31%  252 aa  HIS6_HYDS0 RecName: Full=Imidazole glycerol phosphate synthase
   10::242     4e-20  29%  254 aa  HIS6_DESHY RecName: Full=Imidazole glycerol phosphate synthase
    9::241     4e-20  29%  253 aa  HIS6_DESHD RecName: Full=Imidazole glycerol phosphate synthase
    1::240     4e-20  29%  245 aa  HIS4_SHIFL RecName:
    1::240     4e-20  29%  245 aa  HIS4_SHIF8 RecName:
    1::240     4e-20  29%  245 aa  HIS4_ECO81 RecName:
    1::240     4e-20  29%  245 aa  HIS4_ECO55 RecName:
    6::215     5e-20  30%  256 aa  HIS6_RALME RecName: Full=Imidazole glycerol phosphate synthase
    7::218     5e-20  30%  256 aa  HIS6_PSESM RecName: Full=Imidazole glycerol phosphate synthase
    6::217     5e-20  32%  254 aa  HIS6_METCA RecName: Full=Imidazole glycerol phosphate synthase
    1::240     5e-20  29%  245 aa  HIS4_ECOSM RecName:
    1::214     5e-20  30%  245 aa  HIS4_ECO5E RecName:
    1::214     5e-20  30%  245 aa  HIS4_ECO57 RecName:
    7::234     9e-20  30%  258 aa  HIS6_NITEC RecName: Full=Imidazole glycerol phosphate synthase
    6::252     9e-20  32%  252 aa  HIS6_DESAP RecName: Full=Imidazole glycerol phosphate synthase
    8::208     9e-20  30%  251 aa  HIS6_CAMC1 RecName: Full=Imidazole glycerol phosphate synthase
    6::206     1e-19  28%  252 aa  HIS6_THEON RecName: Full=Imidazole glycerol phosphate synthase
    6::223     1e-19  29%  252 aa  HIS6_SYNWW RecName: Full=Imidazole glycerol phosphate synthase
    6::230     1e-19  30%  253 aa  HIS6_METPP RecName: Full=Imidazole glycerol phosphate synthase
    6::206     1e-19  32%  258 aa  HIS6_METNO RecName: Full=Imidazole glycerol phosphate synthase
    6::224     1e-19  33%  258 aa  HIS6_AZOC5 RecName: Full=Imidazole glycerol phosphate synthase
   31::221     1e-19  34%  253 aa  HIS6_AQUAE RecName: Full=Imidazole glycerol phosphate synthase
    1::240     1e-19  29%  245 aa  HIS4_ECOK1 RecName:
    7::225     2e-19  33%  257 aa  HIS6_TERTT RecName: Full=Imidazole glycerol phosphate synthase
    6::232     2e-19  28%  262 aa  HIS6_RHOBA RecName: Full=Imidazole glycerol phosphate synthase
    6::215     2e-19  30%  256 aa  HIS6_RALEJ RecName: Full=Imidazole glycerol phosphate synthase
    7::220     2e-19  31%  256 aa  HIS6_PSEU5 RecName: Full=Imidazole glycerol phosphate synthase
    6::230     2e-19  28%  253 aa  HIS6_CLOCE RecName: Full=Imidazole glycerol phosphate synthase
    6::209     2e-19  30%  253 aa  HIS6_CLOBL RecName: Full=Imidazole glycerol phosphate synthase
    7::218     2e-19  32%  257 aa  HIS6_CHRSD RecName: Full=Imidazole glycerol phosphate synthase
   16::243     2e-19  31%  267 aa  HIS6_BORA1 RecName: Full=Imidazole glycerol phosphate synthase
    1::214     2e-19  31%  245 aa  HIS4_SALPC RecName:
    1::214     2e-19  31%  245 aa  HIS4_SALCH RecName:
    6::238     2e-19  28%  252 aa  HIS6_SULSY RecName: Full=Imidazole glycerol phosphate synthase
    8::229     2e-19  30%  254 aa  HIS6_NAUPA RecName: Full=Imidazole glycerol phosphate synthase
    6::228     2e-19  30%  252 aa  HIS6_MOOTA RecName: Full=Imidazole glycerol phosphate synthase
    1::214     2e-19  31%  245 aa  HIS4_SALTI RecName:
    1::214     2e-19  31%  245 aa  HIS4_SALG2 RecName:
    1::214     2e-19  31%  245 aa  HIS4_SALEP RecName:
    1::240     2e-19  29%  245 aa  HIS4_ECOUT RecName:
    1::240     2e-19  29%  245 aa  HIS4_ECOL6 RecName:
    1::240     2e-19  29%  245 aa  HIS4_ECOL5 RecName:
    6::219     3e-19  31%  256 aa  HIS6_RALSO RecName: Full=Imidazole glycerol phosphate synthase
    6::215     3e-19  28%  256 aa  HIS6_RALEH RecName: Full=Imidazole glycerol phosphate synthase
    7::225     3e-19  34%  257 aa  HIS6_CELJU RecName: Full=Imidazole glycerol phosphate synthase
    6::232     3e-19  30%  257 aa  HIS6_BRAJA RecName: Full=Imidazole glycerol phosphate synthase
    6::241     3e-19  29%  259 aa  HIS6_ANASP RecName: Full=Imidazole glycerol phosphate synthase
    1::214     3e-19  31%  245 aa  HIS4_SALPK RecName:
    1::214     3e-19  31%  245 aa  HIS4_SALPA RecName:
    1::214     3e-19  31%  245 aa  HIS4_SALNS RecName:
    1::214     3e-19  31%  245 aa  HIS4_SALDC RecName:
    6::227     3e-19  34%  259 aa  HIS6_POLNA RecName: Full=Imidazole glycerol phosphate synthase
    7::234     3e-19  30%  258 aa  HIS6_NITEU RecName: Full=Imidazole glycerol phosphate synthase
    6::209     3e-19  31%  253 aa  HIS6_CLOBK RecName: Full=Imidazole glycerol phosphate synthase
   18::231     3e-19  32%  269 aa  HIS6_BORPE RecName: Full=Imidazole glycerol phosphate synthase
   18::231     3e-19  32%  269 aa  HIS6_BORBR RecName: Full=Imidazole glycerol phosphate synthase
    6::241     3e-19  29%  257 aa  HIS6_ANAVT RecName: Full=Imidazole glycerol phosphate synthase
    1::214     3e-19  31%  245 aa  HIS4_SALTY RecName:
    1::214     3e-19  31%  245 aa  HIS4_SALSV RecName:
    1::214     3e-19  31%  245 aa  HIS4_SALPB RecName:
    1::214     3e-19  31%  245 aa  HIS4_SALHS RecName:
    1::240     3e-19  29%  245 aa  HIS4_ECOSE RecName:
    1::240     3e-19  29%  245 aa  HIS4_ECOLI RecName:
    1::240     3e-19  29%  245 aa  HIS4_ECODH RecName:
    1::240     3e-19  29%  245 aa  HIS4_ECOBW RecName:
    1::240     3e-19  29%  245 aa  HIS4_ECO8A RecName:
    7::239     5e-19  28%  255 aa  HIS6_ZYMMO RecName: Full=Imidazole glycerol phosphate synthase
    6::233     5e-19  30%  263 aa  HIS6_RHILO RecName: Full=Imidazole glycerol phosphate synthase
    6::210     5e-19  28%  251 aa  HIS6_PELUB RecName: Full=Imidazole glycerol phosphate synthase
    7::226     5e-19  33%  268 aa  HIS6_METPE RecName: Full=Imidazole glycerol phosphate synthase
    6::231     5e-19  29%  252 aa  HIS6_HALOH RecName: Full=Imidazole glycerol phosphate synthase
    6::209     5e-19  31%  253 aa  HIS6_CLOBJ RecName: Full=Imidazole glycerol phosphate synthase
    6::209     5e-19  31%  253 aa  HIS6_CLOBH RecName: Full=Imidazole glycerol phosphate synthase
    6::209     5e-19  31%  253 aa  HIS6_CLOB1 RecName: Full=Imidazole glycerol phosphate synthase
   18::231     5e-19  32%  269 aa  HIS6_BORPA RecName: Full=Imidazole glycerol phosphate synthase
    6::207     5e-19  30%  250 aa  HIS6_BACFN RecName: Full=Imidazole glycerol phosphate synthase
    6::219     6e-19  31%  256 aa  HIS6_THISH RecName: Full=Imidazole glycerol phosphate synthase
    6::206     6e-19  29%  250 aa  HIS6_ELUMP RecName: Full=Imidazole glycerol phosphate synthase
    6::215     6e-19  28%  256 aa  HIS6_CUPTR RecName: Full=Imidazole glycerol phosphate synthase
    6::207     6e-19  29%  250 aa  HIS6_BACFR RecName: Full=Imidazole glycerol phosphate synthase
    6::225     8e-19  29%  254 aa  HIS6_THEP3 RecName: Full=Imidazole glycerol phosphate synthase
    6::212     8e-19  32%  255 aa  HIS6_RHOP5 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     8e-19  29%  256 aa  HIS6_PROMS RecName: Full=Imidazole glycerol phosphate synthase
    6::227     8e-19  32%  259 aa  HIS6_POLSJ RecName: Full=Imidazole glycerol phosphate synthase
    6::212     8e-19  31%  253 aa  HIS6_OPITP RecName: Full=Imidazole glycerol phosphate synthase
    7::211     8e-19  32%  258 aa  HIS6_CORGL RecName: Full=Imidazole glycerol phosphate synthase
    7::211     8e-19  32%  258 aa  HIS6_CORGB RecName: Full=Imidazole glycerol phosphate synthase
    6::215     1e-18  31%  252 aa  HIS6_POLNS RecName: Full=Imidazole glycerol phosphate synthase
    7::224     1e-18  31%  268 aa  HIS6_METLZ RecName: Full=Imidazole glycerol phosphate synthase
    6::217     1e-18  28%  261 aa  HIS6_HELMI RecName: Full=Imidazole glycerol phosphate synthase
    6::253     1e-18  30%  253 aa  HIS6_DINSH RecName: Full=Imidazole glycerol phosphate synthase
    8::212     1e-18  28%  252 aa  HIS6_CAMFF RecName: Full=Imidazole glycerol phosphate synthase
   32::260     1e-18  29%  265 aa  HIS6_ALHEH RecName: Full=Imidazole glycerol phosphate synthase
    6::228     1e-18  31%  255 aa  HIS6_AKKM8 RecName: Full=Imidazole glycerol phosphate synthase
    6::237     1e-18  34%  278 aa  HIS6_THEYD RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-18  31%  261 aa  HIS6_OCHA4 RecName: Full=Imidazole glycerol phosphate synthase
    6::212     1e-18  30%  254 aa  HIS6_GLOVI RecName: Full=Imidazole glycerol phosphate synthase
    6::228     1e-18  26%  252 aa  HIS6_CLOD6 RecName: Full=Imidazole glycerol phosphate synthase
    6::209     1e-18  30%  253 aa  HIS6_CLOB6 RecName: Full=Imidazole glycerol phosphate synthase
    6::207     1e-18  30%  251 aa  HIS6_BACV8 RecName: Full=Imidazole glycerol phosphate synthase
    6::228     1e-18  30%  253 aa  HIS6_ACIF5 RecName: Full=Imidazole glycerol phosphate synthase
    6::228     1e-18  30%  253 aa  HIS6_ACIF2 RecName: Full=Imidazole glycerol phosphate synthase
    6::207     2e-18  29%  249 aa  HIS6_SULTO RecName: Full=Imidazole glycerol phosphate synthase
    7::234     2e-18  30%  258 aa  HIS6_RHISN RecName: Full=Imidazole glycerol phosphate synthase
    6::213     2e-18  29%  256 aa  HIS6_PROM9 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     2e-18  31%  256 aa  HIS6_PROM2 RecName: Full=Imidazole glycerol phosphate synthase
    6::241     2e-18  31%  254 aa  HIS6_MICAN RecName: Full=Imidazole glycerol phosphate synthase
    7::225     2e-18  32%  257 aa  HIS6_MARAV RecName: Full=Imidazole glycerol phosphate synthase
    7::223     2e-18  32%  271 aa  HIS6_METHJ RecName: Full=Imidazole glycerol phosphate synthase
    6::212     2e-18  30%  251 aa  HIS6_GRAFK RecName: Full=Imidazole glycerol phosphate synthase
    6::241     2e-18  26%  255 aa  HIS6_EXISA RecName: Full=Imidazole glycerol phosphate synthase
    6::215     2e-18  29%  253 aa  HIS6_CLOAB RecName: Full=Imidazole glycerol phosphate synthase
    7::220     2e-18  32%  257 aa  HIS6_BURP8 RecName: Full=Imidazole glycerol phosphate synthase
    6::208     2e-18  28%  252 aa  HIS6_BACHD RecName: Full=Imidazole glycerol phosphate synthase
    6::204     2e-18  32%  252 aa  HIS6_BACCR RecName: Full=Imidazole glycerol phosphate synthase
    6::220     2e-18  31%  252 aa  HIS6_ACIAD RecName: Full=Imidazole glycerol phosphate synthase
    6::205     3e-18  30%  252 aa  HIS6_STAAR RecName: Full=Imidazole glycerol phosphate synthase
    7::234     3e-18  30%  258 aa  HIS6_SINMW RecName: Full=Imidazole glycerol phosphate synthase
    6::254     3e-18  31%  260 aa  HIS6_PSYA2 RecName: Full=Imidazole glycerol phosphate synthase
    7::234     3e-18  30%  268 aa  HIS6_MESSB RecName: Full=Imidazole glycerol phosphate synthase
    6::210     3e-18  29%  254 aa  HIS6_HALHL RecName: Full=Imidazole glycerol phosphate synthase
    6::211     3e-18  32%  252 aa  HIS6_GEOSM RecName: Full=Imidazole glycerol phosphate synthase
    6::215     3e-18  31%  252 aa  HIS6_DECAR RecName: Full=Imidazole glycerol phosphate synthase
    6::240     3e-18  29%  260 aa  HIS6_CAUCR RecName: Full=Imidazole glycerol phosphate synthase
    6::240     3e-18  29%  260 aa  HIS6_CAUCN RecName: Full=Imidazole glycerol phosphate synthase
    7::214     4e-18  32%  261 aa  HIS6_SYNY3 RecName: Full=Imidazole glycerol phosphate synthase
    6::205     4e-18  31%  252 aa  HIS6_STAS1 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     4e-18  29%  256 aa  HIS6_PROM0 RecName: Full=Imidazole glycerol phosphate synthase
    6::212     4e-18  30%  259 aa  HIS6_LACLM RecName: Full=Imidazole glycerol phosphate synthase
    6::218     4e-18  30%  259 aa  HIS6_LACLA RecName: Full=Imidazole glycerol phosphate synthase
    6::203     4e-18  30%  251 aa  HIS6_BACTN RecName: Full=Imidazole glycerol phosphate synthase
    8::228     5e-18  27%  252 aa  HIS6_SULDN RecName: Full=Imidazole glycerol phosphate synthase
    6::238     5e-18  26%  252 aa  HIS6_STRSV RecName: Full=Imidazole glycerol phosphate synthase
    6::205     5e-18  30%  252 aa  HIS6_STAAN RecName: Full=Imidazole glycerol phosphate synthase
    6::205     5e-18  30%  252 aa  HIS6_STAAM RecName: Full=Imidazole glycerol phosphate synthase
    6::205     5e-18  30%  252 aa  HIS6_STAAB RecName: Full=Imidazole glycerol phosphate synthase
    6::205     5e-18  30%  252 aa  HIS6_STAA9 RecName: Full=Imidazole glycerol phosphate synthase
    6::205     5e-18  30%  252 aa  HIS6_STAA2 RecName: Full=Imidazole glycerol phosphate synthase
    6::205     5e-18  30%  252 aa  HIS6_STAA1 RecName: Full=Imidazole glycerol phosphate synthase
    6::215     5e-18  30%  258 aa  HIS6_RHOPB RecName: Full=Imidazole glycerol phosphate synthase
    6::219     5e-18  31%  258 aa  HIS6_RALPJ RecName: Full=Imidazole glycerol phosphate synthase
    7::206     5e-18  31%  253 aa  HIS6_PYRAE RecName: Full=Imidazole glycerol phosphate synthase
    6::214     5e-18  29%  256 aa  HIS6_PROM1 RecName: Full=Imidazole glycerol phosphate synthase
    9::214     5e-18  30%  254 aa  HIS6_NITSB RecName: Full=Imidazole glycerol phosphate synthase
    7::218     5e-18  30%  257 aa  HIS6_NITOC RecName: Full=Imidazole glycerol phosphate synthase
    7::249     5e-18  32%  255 aa  HIS6_NEIM0 RecName: Full=Imidazole glycerol phosphate synthase
    7::249     5e-18  32%  255 aa  HIS6_NEIG2 RecName: Full=Imidazole glycerol phosphate synthase
    7::249     5e-18  32%  255 aa  HIS6_NEIG1 RecName: Full=Imidazole glycerol phosphate synthase
    6::217     5e-18  28%  261 aa  HIS6_HELMO RecName: Full=Imidazole glycerol phosphate synthase
    6::211     5e-18  32%  252 aa  HIS6_GEOBB RecName: Full=Imidazole glycerol phosphate synthase
    6::236     7e-18  29%  259 aa  HIS6_VARPS RecName: Full=Imidazole glycerol phosphate synthase
    8::214     7e-18  30%  254 aa  HIS6_SULNB RecName: Full=Imidazole glycerol phosphate synthase
    6::254     7e-18  31%  260 aa  HIS6_PSYCK RecName: Full=Imidazole glycerol phosphate synthase
    7::249     7e-18  32%  255 aa  HIS6_NEIMF RecName: Full=Imidazole glycerol phosphate synthase
    7::224     7e-18  32%  268 aa  HIS6_METB6 RecName: Full=Imidazole glycerol phosphate synthase
    6::212     7e-18  29%  259 aa  HIS6_DESVV RecName: Full=Imidazole glycerol phosphate synthase
    6::212     7e-18  29%  259 aa  HIS6_DESVH RecName: Full=Imidazole glycerol phosphate synthase
    7::216     7e-18  30%  260 aa  HIS6_CORJK RecName: Full=Imidazole glycerol phosphate synthase
    7::218     7e-18  29%  257 aa  HIS6_BURTA RecName: Full=Imidazole glycerol phosphate synthase
    6::204     7e-18  31%  252 aa  HIS6_BACC2 RecName: Full=Imidazole glycerol phosphate synthase
    6::205     9e-18  30%  252 aa  HIS6_STAAW RecName: Full=Imidazole glycerol phosphate synthase
    6::205     9e-18  30%  252 aa  HIS6_STAAT RecName: Full=Imidazole glycerol phosphate synthase
    6::205     9e-18  30%  252 aa  HIS6_STAAS RecName: Full=Imidazole glycerol phosphate synthase
    6::205     9e-18  30%  252 aa  HIS6_STAAE RecName: Full=Imidazole glycerol phosphate synthase
    6::205     9e-18  30%  252 aa  HIS6_STAAC RecName: Full=Imidazole glycerol phosphate synthase
    6::205     9e-18  30%  252 aa  HIS6_STAA3 RecName: Full=Imidazole glycerol phosphate synthase
    7::234     9e-18  29%  258 aa  HIS6_RHIME RecName: Full=Imidazole glycerol phosphate synthase
    6::233     9e-18  29%  258 aa  HIS6_NITHX RecName: Full=Imidazole glycerol phosphate synthase
    7::226     9e-18  31%  255 aa  HIS6_NEIMA RecName: Full=Imidazole glycerol phosphate synthase
    6::212     9e-18  30%  259 aa  HIS6_LACLS RecName: Full=Imidazole glycerol phosphate synthase
    7::235     9e-18  27%  251 aa  HIS6_HELHP RecName: Full=Imidazole glycerol phosphate synthase
    6::208     9e-18  28%  258 aa  HIS6_GLUDA RecName: Full=Imidazole glycerol phosphate synthase
    7::234     9e-18  28%  257 aa  HIS6_BURM1 RecName: Full=Imidazole glycerol phosphate synthase
    6::205     9e-18  29%  252 aa  HIS6_ANOFW RecName: Full=Imidazole glycerol phosphate synthase
    7::214     1e-17  27%  256 aa  HIS6_THEFY RecName: Full=Imidazole glycerol phosphate synthase
    7::223     1e-17  31%  272 aa  HIS6_METKA RecName: Full=Imidazole glycerol phosphate synthase
    7::234     1e-17  28%  257 aa  HIS6_BURA4 RecName: Full=Imidazole glycerol phosphate synthase
    6::204     1e-17  30%  252 aa  HIS6_BREBN RecName: Full=Imidazole glycerol phosphate synthase
    6::220     1e-17  31%  252 aa  HIS6_ACIBT RecName: Full=Imidazole glycerol phosphate synthase
    6::220     1e-17  31%  252 aa  HIS6_ACIBC RecName: Full=Imidazole glycerol phosphate synthase
    6::220     1e-17  31%  252 aa  HIS6_ACIB5 RecName: Full=Imidazole glycerol phosphate synthase
    6::220     1e-17  31%  252 aa  HIS6_ACIB3 RecName: Full=Imidazole glycerol phosphate synthase
    7::231     1e-17  31%  255 aa  HIS6_VESOH RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUSU RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUSI RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUO2 RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUME RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUMB RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUC2 RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUAB RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUA2 RecName: Full=Imidazole glycerol phosphate synthase
    7::251     1e-17  30%  261 aa  HIS6_BRUA1 RecName: Full=Imidazole glycerol phosphate synthase
    7::238     2e-17  27%  254 aa  HIS6_LEUMM RecName: Full=Imidazole glycerol phosphate synthase
    6::205     2e-17  29%  252 aa  HIS6_GEOTN RecName: Full=Imidazole glycerol phosphate synthase
    6::209     2e-17  31%  259 aa  HIS6_DESDG RecName: Full=Imidazole glycerol phosphate synthase
    6::204     2e-17  30%  252 aa  HIS6_BACC0 RecName: Full=Imidazole glycerol phosphate synthase
    8::215     2e-17  29%  254 aa  HIS6_WOLSU RecName: Full=Imidazole glycerol phosphate synthase
    6::238     2e-17  26%  251 aa  HIS6_STRMU RecName: Full=Imidazole glycerol phosphate synthase
    6::206     2e-17  30%  258 aa  HIS6_METPB RecName: Full=Imidazole glycerol phosphate synthase
    6::205     2e-17  30%  253 aa  HIS6_LYSSC RecName: Full=Imidazole glycerol phosphate synthase
    6::208     2e-17  28%  252 aa  HIS6_GEOSW RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-17  26%  251 aa  HIS6_FLAJ1 RecName: Full=Imidazole glycerol phosphate synthase
    7::214     2e-17  29%  258 aa  HIS6_COREF RecName: Full=Imidazole glycerol phosphate synthase
    7::211     2e-17  29%  258 aa  HIS6_CORDI RecName: Full=Imidazole glycerol phosphate synthase
    6::233     2e-17  28%  258 aa  HIS6_CLOPH RecName: Full=Imidazole glycerol phosphate synthase
    7::220     2e-17  30%  257 aa  HIS6_BURXL RecName: Full=Imidazole glycerol phosphate synthase
    7::234     2e-17  28%  257 aa  HIS6_BURS3 RecName: Full=Imidazole glycerol phosphate synthase
    7::234     2e-17  28%  257 aa  HIS6_BURCM RecName: Full=Imidazole glycerol phosphate synthase
    7::234     2e-17  28%  257 aa  HIS6_BURCJ RecName: Full=Imidazole glycerol phosphate synthase
    7::234     2e-17  28%  257 aa  HIS6_BURCH RecName: Full=Imidazole glycerol phosphate synthase
    7::234     2e-17  28%  257 aa  HIS6_BURCC RecName: Full=Imidazole glycerol phosphate synthase
    7::234     2e-17  28%  257 aa  HIS6_BURCA RecName: Full=Imidazole glycerol phosphate synthase
    6::233     2e-17  29%  258 aa  HIS6_BRASO RecName: Full=Imidazole glycerol phosphate synthase
    6::229     2e-17  31%  252 aa  HIS6_BACSU RecName: Full=Imidazole glycerol phosphate synthase
    6::204     2e-17  30%  252 aa  HIS6_BACC3 RecName: Full=Imidazole glycerol phosphate synthase
    6::204     2e-17  30%  252 aa  HIS6_BACAH RecName: Full=Imidazole glycerol phosphate synthase
   22::226     2e-17  34%  271 aa  HIS6_ARCFU RecName: Full=Imidazole glycerol phosphate synthase
    6::233     3e-17  28%  258 aa  HIS6_NITWN RecName: Full=Imidazole glycerol phosphate synthase
    6::208     3e-17  29%  253 aa  HIS6_GLUOX RecName: Full=Imidazole glycerol phosphate synthase
    6::204     3e-17  31%  252 aa  HIS6_BACHK RecName: Full=Imidazole glycerol phosphate synthase
    6::204     3e-17  31%  252 aa  HIS6_BACAN RecName: Full=Imidazole glycerol phosphate synthase
    6::204     3e-17  31%  252 aa  HIS6_BACAC RecName: Full=Imidazole glycerol phosphate synthase
    6::204     3e-17  31%  252 aa  HIS6_BACAA RecName: Full=Imidazole glycerol phosphate synthase
    6::206     4e-17  31%  258 aa  HIS6_METEP RecName: Full=Imidazole glycerol phosphate synthase
    6::233     4e-17  27%  252 aa  HIS6_GEOKA RecName: Full=Imidazole glycerol phosphate synthase
    6::212     4e-17  29%  259 aa  HIS6_DESVM RecName: Full=Imidazole glycerol phosphate synthase
    7::233     4e-17  28%  257 aa  HIS6_BURVG RecName: Full=Imidazole glycerol phosphate synthase
    4::229     6e-17  30%  252 aa  HIS6_RHORT RecName: Full=Imidazole glycerol phosphate synthase
   25::203     6e-17  31%  251 aa  HIS6_METS5 RecName: Full=Imidazole glycerol phosphate synthase
    6::206     6e-17  30%  258 aa  HIS6_METS4 RecName: Full=Imidazole glycerol phosphate synthase
    6::204     6e-17  30%  249 aa  HIS6_EXIS2 RecName: Full=Imidazole glycerol phosphate synthase
    7::218     6e-17  28%  257 aa  HIS6_BURPS RecName: Full=Imidazole glycerol phosphate synthase
    7::218     6e-17  28%  257 aa  HIS6_BURP6 RecName: Full=Imidazole glycerol phosphate synthase
    7::218     6e-17  28%  257 aa  HIS6_BURP1 RecName: Full=Imidazole glycerol phosphate synthase
    7::218     6e-17  28%  257 aa  HIS6_BURP0 RecName: Full=Imidazole glycerol phosphate synthase
    6::229     6e-17  30%  252 aa  HIS6_BACP2 RecName: Full=Imidazole glycerol phosphate synthase
    6::204     6e-17  29%  252 aa  HIS6_BACC1 RecName: Full=Imidazole glycerol phosphate synthase
    6::214     7e-17  30%  255 aa  HIS6_SYNP6 RecName: Full=Imidazole glycerol phosphate synthase
    6::207     7e-17  28%  251 aa  HIS6_SULSO RecName: Full=Imidazole glycerol phosphate synthase
    6::238     7e-17  26%  252 aa  HIS6_STRGC RecName: Full=Imidazole glycerol phosphate synthase
    6::214     7e-17  29%  256 aa  HIS6_PROMT RecName: Full=Imidazole glycerol phosphate synthase
    6::206     7e-17  30%  258 aa  HIS6_METC4 RecName: Full=Imidazole glycerol phosphate synthase
    6::225     7e-17  30%  266 aa  HIS6_DELAS RecName: Full=Imidazole glycerol phosphate synthase
    7::220     7e-17  29%  257 aa  HIS6_BURPP RecName: Full=Imidazole glycerol phosphate synthase
    1::190     7e-17  31%  245 aa  HIS4_SALA4 RecName:
    7::219     9e-17  28%  281 aa  HIS6_THEEB RecName: Full=Imidazole glycerol phosphate synthase
    7::209     9e-17  29%  254 aa  HIS6_SPHWW RecName: Full=Imidazole glycerol phosphate synthase
    7::214     9e-17  29%  255 aa  HIS6_SPHAL RecName: Full=Imidazole glycerol phosphate synthase
    6::209     9e-17  29%  259 aa  HIS6_CARHZ RecName: Full=Imidazole glycerol phosphate synthase
    7::218     9e-17  28%  257 aa  HIS6_BURMS RecName: Full=Imidazole glycerol phosphate synthase
    7::218     9e-17  28%  257 aa  HIS6_BURMA RecName: Full=Imidazole glycerol phosphate synthase
    7::218     9e-17  28%  257 aa  HIS6_BURM9 RecName: Full=Imidazole glycerol phosphate synthase
    7::218     9e-17  28%  257 aa  HIS6_BURM7 RecName: Full=Imidazole glycerol phosphate synthase
    6::215     9e-17  30%  258 aa  HIS6_BRASB RecName: Full=Imidazole glycerol phosphate synthase
    6::204     9e-17  29%  252 aa  HIS6_BACCQ RecName: Full=Imidazole glycerol phosphate synthase
    6::204     9e-17  30%  252 aa  HIS6_BACC4 RecName: Full=Imidazole glycerol phosphate synthase
    6::203     1e-16  28%  251 aa  HIS6_PYRFU RecName: Full=Imidazole glycerol phosphate synthase
    7::249     1e-16  30%  255 aa  HIS6_NEIMB RecName: Full=Imidazole glycerol phosphate synthase
    6::228     1e-16  29%  252 aa  HIS6_HYPNA RecName: Full=Imidazole glycerol phosphate synthase
    6::217     1e-16  28%  252 aa  HIS6_BACCN RecName: Full=Imidazole glycerol phosphate synthase
    7::234     1e-16  29%  258 aa  HIS6_AGRT5 RecName: Full=Imidazole glycerol phosphate synthase
    7::231     2e-16  30%  255 aa  HIS6_RUTMC RecName: Full=Imidazole glycerol phosphate synthase
    6::223     2e-16  29%  272 aa  HIS6_METJA RecName: Full=Imidazole glycerol phosphate synthase
    6::204     2e-16  30%  252 aa  HIS6_BACCZ RecName: Full=Imidazole glycerol phosphate synthase
    6::243     2e-16  26%  257 aa  HIS61_VIBVY RecName: Full=Imidazole glycerol phosphate synthase
    7::210     2e-16  28%  254 aa  HIS6_KOCRD RecName: Full=Imidazole glycerol phosphate synthase
    6::236     2e-16  28%  259 aa  HIS6_DIAST RecName: Full=Imidazole glycerol phosphate synthase
    6::226     2e-16  28%  259 aa  HIS6_DESOH RecName: Full=Imidazole glycerol phosphate synthase
    6::211     2e-16  28%  252 aa  HIS6_BACWK RecName: Full=Imidazole glycerol phosphate synthase
    6::236     2e-16  28%  259 aa  HIS6_ACISJ RecName: Full=Imidazole glycerol phosphate synthase
    6::203     3e-16  27%  252 aa  HIS6_THEGJ RecName: Full=Imidazole glycerol phosphate synthase
    6::229     3e-16  27%  253 aa  HIS6_RHOS5 RecName: Full=Imidazole glycerol phosphate synthase
    6::228     3e-16  30%  273 aa  HIS6_METBF RecName: Full=Imidazole glycerol phosphate synthase
    6::230     3e-16  28%  260 aa  HIS6_CAUSK RecName: Full=Imidazole glycerol phosphate synthase
    6::205     3e-16  28%  252 aa  HIS6_BACLD RecName: Full=Imidazole glycerol phosphate synthase
    6::237     4e-16  28%  261 aa  HIS6_JANSC RecName: Full=Imidazole glycerol phosphate synthase
    6::227     4e-16  28%  253 aa  HIS6_DEHSB RecName: Full=Imidazole glycerol phosphate synthase
    6::243     5e-16  25%  257 aa  HIS6_VIBSL RecName: Full=Imidazole glycerol phosphate synthase
    6::243     5e-16  25%  257 aa  HIS6_VIBHB RecName: Full=Imidazole glycerol phosphate synthase
    6::229     5e-16  28%  253 aa  HIS6_PARDP RecName: Full=Imidazole glycerol phosphate synthase
   11::219     5e-16  29%  261 aa  HIS6_MYCUA RecName: Full=Imidazole glycerol phosphate synthase
    6::228     5e-16  31%  273 aa  HIS6_METMA RecName: Full=Imidazole glycerol phosphate synthase
    6::212     5e-16  29%  259 aa  HIS6_DESAH RecName: Full=Imidazole glycerol phosphate synthase
    6::227     5e-16  28%  253 aa  HIS6_DEHSC RecName: Full=Imidazole glycerol phosphate synthase
    6::211     5e-16  28%  253 aa  HIS6_CLOB8 RecName: Full=Imidazole glycerol phosphate synthase
    7::228     6e-16  27%  251 aa  HIS6_STRGG RecName: Full=Imidazole glycerol phosphate synthase
    6::220     6e-16  30%  253 aa  HIS6_SILST RecName: Full=Imidazole glycerol phosphate synthase
    6::228     6e-16  30%  273 aa  HIS6_METAC RecName: Full=Imidazole glycerol phosphate synthase
    7::233     6e-16  25%  256 aa  HIS6_BIFAA RecName: Full=Imidazole glycerol phosphate synthase
    6::211     6e-16  28%  252 aa  HIS6_BACC7 RecName: Full=Imidazole glycerol phosphate synthase
    6::243     8e-16  25%  257 aa  HIS6_VIBVU RecName: Full=Imidazole glycerol phosphate synthase
    7::209     8e-16  27%  251 aa  HIS6_STRCO RecName: Full=Imidazole glycerol phosphate synthase
   11::219     8e-16  29%  261 aa  HIS6_MYCMM RecName: Full=Imidazole glycerol phosphate synthase
    8::255     8e-16  27%  256 aa  HIS6_LEPIC RecName: Full=Imidazole glycerol phosphate synthase
    6::239     8e-16  24%  261 aa  HIS6_LACF3 RecName: Full=Imidazole glycerol phosphate synthase
    6::251     8e-16  28%  253 aa  HIS6_DEHE1 RecName: Full=Imidazole glycerol phosphate synthase
    7::233     8e-16  25%  256 aa  HIS6_BIFLI RecName: Full=Imidazole glycerol phosphate synthase
    8::255     8e-16  27%  256 aa  HIS61_LEPIN RecName: Full=Imidazole glycerol phosphate synthase
    6::243     1e-15  25%  257 aa  HIS6_VIBPA RecName: Full=Imidazole glycerol phosphate synthase
    6::203     1e-15  26%  252 aa  HIS6_PYRKO RecName: Full=Imidazole glycerol phosphate synthase
    6::210     1e-15  30%  212 aa  HIS6_LEGPN RecName: Full=Imidazole glycerol phosphate synthase
    7::221     1e-15  29%  254 aa  HIS6_JANMA RecName: Full=Imidazole glycerol phosphate synthase
    8::239     1e-15  25%  253 aa  HIS6_ARCB4 RecName: Full=Imidazole glycerol phosphate synthase
   14::228     1e-15  30%  273 aa  HIS6_METBU RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-15  27%  258 aa  HIS6_CITK8 RecName: Full=Imidazole glycerol phosphate synthase
    6::243     1e-15  25%  257 aa  HIS6_ALISL RecName: Full=Imidazole glycerol phosphate synthase
    7::225     1e-15  29%  258 aa  HIS6_ALCBS RecName: Full=Imidazole glycerol phosphate synthase
    7::208     2e-15  26%  252 aa  HIS6_THET8 RecName: Full=Imidazole glycerol phosphate synthase
    7::208     2e-15  26%  252 aa  HIS6_THET2 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  27%  258 aa  HIS6_SHIDS RecName: Full=Imidazole glycerol phosphate synthase
    7::225     2e-15  32%  257 aa  HIS6_SACD2 RecName: Full=Imidazole glycerol phosphate synthase
    6::228     2e-15  26%  252 aa  HIS6_RHOCA RecName: Full=Imidazole glycerol phosphate synthase
    6::213     2e-15  27%  258 aa  HIS6_PROM4 RecName: Full=Imidazole glycerol phosphate synthase
   11::219     2e-15  28%  261 aa  HIS6_MYCVP RecName: Full=Imidazole glycerol phosphate synthase
    8::255     2e-15  25%  255 aa  HIS6_LEPBP RecName: Full=Imidazole glycerol phosphate synthase
    8::255     2e-15  25%  255 aa  HIS6_LEPBA RecName: Full=Imidazole glycerol phosphate synthase
    7::233     2e-15  25%  256 aa  HIS6_BIFLD RecName: Full=Imidazole glycerol phosphate synthase
    7::213     2e-15  25%  254 aa  HIS6_SYMTH RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_SHIB3 RecName: Full=Imidazole glycerol phosphate synthase
    6::234     2e-15  28%  258 aa  HIS6_RHOCS RecName: Full=Imidazole glycerol phosphate synthase
   31::237     2e-15  27%  251 aa  HIS6_NATTJ RecName: Full=Imidazole glycerol phosphate synthase
    6::243     2e-15  26%  258 aa  HIS6_KLEOX RecName: Full=Imidazole glycerol phosphate synthase
    6::245     2e-15  29%  263 aa  HIS6_HERA2 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ESCF3 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECOSM RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECOSE RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECOLI RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECODH RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECOBW RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECO8A RecName: Full=Imidazole glycerol phosphate synthase
    6::243     2e-15  26%  258 aa  HIS6_ECO7I RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECO5E RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECO57 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECO45 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECO27 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-15  26%  258 aa  HIS6_ECO24 RecName: Full=Imidazole glycerol phosphate synthase
    6::243     3e-15  25%  257 aa  HIS6_VIBFM RecName: Full=Imidazole glycerol phosphate synthase
    7::209     3e-15  27%  251 aa  HIS6_STRAW RecName: Full=Imidazole glycerol phosphate synthase
    6::246     3e-15  26%  258 aa  HIS6_SHIBS RecName: Full=Imidazole glycerol phosphate synthase
    7::215     3e-15  27%  257 aa  HIS6_MYCA9 RecName: Full=Imidazole glycerol phosphate synthase
    6::206     3e-15  29%  267 aa  HIS6_METRJ RecName: Full=Imidazole glycerol phosphate synthase
    7::224     3e-15  28%  268 aa  HIS6_METMJ RecName: Full=Imidazole glycerol phosphate synthase
    6::246     3e-15  26%  258 aa  HIS6_ECO81 RecName: Full=Imidazole glycerol phosphate synthase
    6::211     3e-15  29%  252 aa  HIS6_DICTD RecName: Full=Imidazole glycerol phosphate synthase
    6::207     3e-15  26%  251 aa  HIS6_CYTH3 RecName: Full=Imidazole glycerol phosphate synthase
    6::211     3e-15  27%  252 aa  HIS6_BACSK RecName: Full=Imidazole glycerol phosphate synthase
    6::247     4e-15  23%  252 aa  HIS6_PETMO RecName: Full=Imidazole glycerol phosphate synthase
    6::209     4e-15  28%  260 aa  HIS6_DESAA RecName: Full=Imidazole glycerol phosphate synthase
    7::210     4e-15  26%  256 aa  HIS6_BIFA0 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     5e-15  30%  258 aa  HIS6_ROSS1 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     5e-15  26%  258 aa  HIS6_ECOK1 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     5e-15  26%  258 aa  HIS6_ECOHS RecName: Full=Imidazole glycerol phosphate synthase
    6::229     5e-15  27%  252 aa  HIS6_AZOSE RecName: Full=Imidazole glycerol phosphate synthase
    1::239     5e-15  29%  245 aa  HIS4_ENTS8 RecName:
    6::207     7e-15  26%  253 aa  HIS6_THEMA RecName: Full=Imidazole glycerol phosphate synthase
    6::246     7e-15  26%  258 aa  HIS6_SHISS RecName: Full=Imidazole glycerol phosphate synthase
   12::239     7e-15  25%  265 aa  HIS6_MYCPA RecName: Full=Imidazole glycerol phosphate synthase
   12::239     7e-15  25%  265 aa  HIS6_MYCA1 RecName: Full=Imidazole glycerol phosphate synthase
    6::203     7e-15  28%  251 aa  HIS6_LISMO RecName: Full=Imidazole glycerol phosphate synthase
    6::243     7e-15  26%  258 aa  HIS6_ENT38 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     7e-15  26%  258 aa  HIS6_ECOUT RecName: Full=Imidazole glycerol phosphate synthase
    6::246     7e-15  26%  258 aa  HIS6_ECOL6 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     7e-15  26%  258 aa  HIS6_ECOL5 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     7e-15  26%  258 aa  HIS6_ECO55 RecName: Full=Imidazole glycerol phosphate synthase
    7::233     7e-15  25%  256 aa  HIS6_BIFLO RecName: Full=Imidazole glycerol phosphate synthase
    6::243     9e-15  25%  257 aa  HIS6_VIBF1 RecName: Full=Imidazole glycerol phosphate synthase
   22::229     9e-15  31%  273 aa  HIS6_UNCMA RecName: Full=Imidazole glycerol phosphate synthase
    6::239     9e-15  27%  260 aa  HIS6_THERP RecName: Full=Imidazole glycerol phosphate synthase
    6::229     9e-15  27%  253 aa  HIS6_RHOSK RecName: Full=Imidazole glycerol phosphate synthase
    6::246     9e-15  25%  258 aa  HIS6_ECOLU RecName: Full=Imidazole glycerol phosphate synthase
    7::207     9e-15  27%  253 aa  HIS6_CORU7 RecName: Full=Imidazole glycerol phosphate synthase
    6::205     1e-14  28%  254 aa  HIS6_STACT RecName: Full=Imidazole glycerol phosphate synthase
    6::243     1e-14  29%  254 aa  HIS6_SOLUE RecName: Full=Imidazole glycerol phosphate synthase
    6::224     1e-14  28%  272 aa  HIS6_METM5 RecName: Full=Imidazole glycerol phosphate synthase
    6::210     1e-14  27%  251 aa  HIS6_LISIN RecName: Full=Imidazole glycerol phosphate synthase
    6::243     1e-14  25%  257 aa  HIS6_ACTP7 RecName: Full=Imidazole glycerol phosphate synthase
    1::214     1e-14  28%  245 aa  HIS4_CITK8 RecName:
    6::207     2e-14  25%  253 aa  HIS6_THESQ RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-14  25%  258 aa  HIS6_SHIFL RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-14  25%  258 aa  HIS6_SHIF8 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-14  25%  258 aa  HIS6_ECOLC RecName: Full=Imidazole glycerol phosphate synthase
    6::229     2e-14  27%  253 aa  HIS6_RHOS4 RecName: Full=Imidazole glycerol phosphate synthase
   11::219     2e-14  27%  261 aa  HIS6_MYCGI RecName: Full=Imidazole glycerol phosphate synthase
    7::215     2e-14  25%  257 aa  HIS6_KINRD RecName: Full=Imidazole glycerol phosphate synthase
    6::212     2e-14  28%  259 aa  HIS6_DESMR RecName: Full=Imidazole glycerol phosphate synthase
    7::232     3e-14  27%  268 aa  HIS6_SALRD RecName: Full=Imidazole glycerol phosphate synthase
    4::227     3e-14  31%  232 aa  HIS4_SULSO RecName:
    6::231     3e-14  27%  272 aa  HIS6_METVS RecName: Full=Imidazole glycerol phosphate synthase
    6::246     3e-14  25%  258 aa  HIS6_KLEP7 RecName: Full=Imidazole glycerol phosphate synthase
    6::229     3e-14  28%  252 aa  HIS6_BACA2 RecName: Full=Imidazole glycerol phosphate synthase
    6::204     3e-14  26%  252 aa  HIS6_AZOPC RecName: Full=Imidazole glycerol phosphate synthase
    6::207     3e-14  28%  254 aa  HIS6_ACICJ RecName: Full=Imidazole glycerol phosphate synthase
    6::243     4e-14  24%  257 aa  HIS6_VIBCM RecName: Full=Imidazole glycerol phosphate synthase
    6::243     4e-14  24%  257 aa  HIS6_VIBCH RecName: Full=Imidazole glycerol phosphate synthase
    6::243     4e-14  24%  257 aa  HIS6_VIBC3 RecName: Full=Imidazole glycerol phosphate synthase
    6::234     4e-14  32%  266 aa  HIS6_VEREI RecName: Full=Imidazole glycerol phosphate synthase
    6::212     4e-14  27%  259 aa  HIS6_SYNFM RecName: Full=Imidazole glycerol phosphate synthase
    6::229     4e-14  27%  253 aa  HIS6_RHOS1 RecName: Full=Imidazole glycerol phosphate synthase
    6::215     4e-14  27%  252 aa  HIS6_POLSQ RecName: Full=Imidazole glycerol phosphate synthase
    7::209     4e-14  25%  256 aa  HIS6_MICLC RecName: Full=Imidazole glycerol phosphate synthase
    6::240     4e-14  29%  275 aa  HIS6_META3 RecName: Full=Imidazole glycerol phosphate synthase
    6::203     4e-14  28%  232 aa  HIS6_LISMH RecName: Full=Imidazole glycerol phosphate synthase
    6::246     4e-14  24%  258 aa  HIS6_KLEP3 RecName: Full=Imidazole glycerol phosphate synthase
   29::243     4e-14  31%  270 aa  HIS6_HALWD RecName: Full=Imidazole glycerol phosphate synthase
    6::211     4e-14  25%  253 aa  HIS6_CLOBA RecName: Full=Imidazole glycerol phosphate synthase
    6::250     6e-14  30%  258 aa  HIS6_XANP2 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     6e-14  25%  258 aa  HIS6_SALAR RecName: Full=Imidazole glycerol phosphate synthase
    6::230     6e-14  28%  255 aa  HIS6_RHOP2 RecName: Full=Imidazole glycerol phosphate synthase
    7::211     6e-14  28%  258 aa  HIS6_ARTAT RecName: Full=Imidazole glycerol phosphate synthase
    6::206     6e-14  27%  253 aa  HIS6_ACIC5 RecName: Full=Imidazole glycerol phosphate synthase
    6::227     8e-14  26%  258 aa  HIS6_SERP5 RecName: Full=Imidazole glycerol phosphate synthase
   30::223     8e-14  29%  273 aa  HIS6_HALSA RecName: Full=Imidazole glycerol phosphate synthase
   30::223     8e-14  29%  273 aa  HIS6_HALS3 RecName: Full=Imidazole glycerol phosphate synthase
    6::211     8e-14  28%  252 aa  HIS6_DICT6 RecName: Full=Imidazole glycerol phosphate synthase
    6::212     8e-14  24%  261 aa  HIS6_DEIRA RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALTY RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALTI RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALPK RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALPB RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALPA RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALNS RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALHS RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALG2 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALEP RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-13  25%  258 aa  HIS6_SALDC RecName: Full=Imidazole glycerol phosphate synthase
    7::215     1e-13  26%  257 aa  HIS6_RHOSR RecName: Full=Imidazole glycerol phosphate synthase
    7::215     1e-13  26%  257 aa  HIS6_RHOOB RecName: Full=Imidazole glycerol phosphate synthase
    7::209     1e-13  27%  256 aa  HIS6_RENSM RecName: Full=Imidazole glycerol phosphate synthase
    6::249     1e-13  25%  257 aa  HIS6_PSYIN RecName: Full=Imidazole glycerol phosphate synthase
    6::224     1e-13  28%  272 aa  HIS6_METM7 RecName: Full=Imidazole glycerol phosphate synthase
    6::217     1e-13  29%  276 aa  HIS6_BEII9 RecName: Full=Imidazole glycerol phosphate synthase
    7::211     1e-13  27%  258 aa  HIS6_ARTS2 RecName: Full=Imidazole glycerol phosphate synthase
    6::230     1e-13  27%  255 aa  HIS6_RHOPT RecName: Full=Imidazole glycerol phosphate synthase
    6::230     1e-13  27%  255 aa  HIS6_RHOPA RecName: Full=Imidazole glycerol phosphate synthase
    7::215     1e-13  26%  257 aa  HIS6_NOCFA RecName: Full=Imidazole glycerol phosphate synthase
    6::231     1e-13  26%  272 aa  HIS6_METMP RecName: Full=Imidazole glycerol phosphate synthase
   25::227     1e-13  28%  254 aa  HIS6_LEPBO RecName: Full=Putative imidazole glycerol phosphate
    7::212     1e-13  27%  254 aa  HIS6_FRASC RecName: Full=Imidazole glycerol phosphate synthase
    4::224     1e-13  28%  230 aa  HIS4_SULTO RecName:
    6::231     2e-13  26%  272 aa  HIS6_METM6 RecName: Full=Imidazole glycerol phosphate synthase
    6::203     2e-13  27%  251 aa  HIS6_LISW6 RecName: Full=Imidazole glycerol phosphate synthase
    8::255     2e-13  27%  256 aa  HIS6_LEPBL RecName: Full=Imidazole glycerol phosphate synthase
    8::255     2e-13  27%  256 aa  HIS6_LEPBJ RecName: Full=Imidazole glycerol phosphate synthase
    7::213     2e-13  26%  254 aa  HIS6_LEIXX RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-13  23%  258 aa  HIS6_ENTS8 RecName: Full=Imidazole glycerol phosphate synthase
    6::233     2e-13  25%  258 aa  HIS6_BAUCH RecName: Full=Imidazole glycerol phosphate synthase
    7::211     2e-13  27%  258 aa  HIS6_ARTCA RecName: Full=Imidazole glycerol phosphate synthase
    6::212     2e-13  30%  256 aa  HIS61_PROMM RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-13  25%  258 aa  HIS6_SALSV RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-13  25%  258 aa  HIS6_SALCH RecName: Full=Imidazole glycerol phosphate synthase
    6::243     2e-13  24%  258 aa  HIS6_PECCP RecName: Full=Imidazole glycerol phosphate synthase
    6::218     2e-13  25%  266 aa  HIS6_NITMS RecName: Full=Imidazole glycerol phosphate synthase
    7::203     2e-13  28%  254 aa  HIS6_HERAR RecName: Full=Imidazole glycerol phosphate synthase
    6::243     2e-13  24%  258 aa  HIS6_ERWCT RecName: Full=Imidazole glycerol phosphate synthase
    6::246     3e-13  25%  258 aa  HIS6_SALPC RecName: Full=Imidazole glycerol phosphate synthase
    6::243     3e-13  23%  257 aa  HIS6_PHOPR RecName: Full=Imidazole glycerol phosphate synthase
    6::246     3e-13  26%  265 aa  HIS6_IDILO RecName: Full=Imidazole glycerol phosphate synthase
    6::209     3e-13  27%  259 aa  HIS6_DESDA RecName: Full=Imidazole glycerol phosphate synthase
    6::235     3e-13  25%  263 aa  HIS6_DEIGD RecName: Full=Imidazole glycerol phosphate synthase
    6::243     3e-13  26%  258 aa  HIS6_COLP3 RecName: Full=Imidazole glycerol phosphate synthase
    6::223     4e-13  25%  251 aa  HIS6_PARD8 RecName: Full=Imidazole glycerol phosphate synthase
    6::243     4e-13  25%  258 aa  HIS6_HAEIE RecName: Full=Imidazole glycerol phosphate synthase
    7::247     5e-13  29%  253 aa  HIS6_PARL1 RecName: Full=Imidazole glycerol phosphate synthase
   17::225     5e-13  28%  267 aa  HIS6_MYCTU RecName: Full=Imidazole glycerol phosphate synthase
   17::225     5e-13  28%  267 aa  HIS6_MYCTA RecName: Full=Imidazole glycerol phosphate synthase
    7::211     6e-13  26%  257 aa  HIS6_RHOE4 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     6e-13  25%  257 aa  HIS6_PROMA RecName: Full=Imidazole glycerol phosphate synthase
    6::216     6e-13  28%  257 aa  HIS6_OLICO RecName: Full=Imidazole glycerol phosphate synthase
    7::216     6e-13  24%  256 aa  HIS6_BEUC1 RecName: Full=Imidazole glycerol phosphate synthase
    6::216     6e-13  28%  266 aa  HIS6_ACIAC RecName: Full=Imidazole glycerol phosphate synthase
   31::211     6e-13  29%  251 aa  HIS62_PSEAE RecName: Full=Putative imidazole glycerol phosphate
    6::242     8e-13  23%  258 aa  HIS6_XANOR RecName: Full=Imidazole glycerol phosphate synthase
    6::242     8e-13  23%  258 aa  HIS6_XANOM RecName: Full=Imidazole glycerol phosphate synthase
    6::221     8e-13  26%  263 aa  HIS6_SYNS3 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     8e-13  25%  258 aa  HIS6_SALA4 RecName: Full=Imidazole glycerol phosphate synthase
    1::218     8e-13  28%  229 aa  HIS4_PYRAE RecName:
    6::242     1e-12  23%  258 aa  HIS6_XANCP RecName: Full=Imidazole glycerol phosphate synthase
    6::242     1e-12  23%  258 aa  HIS6_XANC8 RecName: Full=Imidazole glycerol phosphate synthase
    6::242     1e-12  23%  258 aa  HIS6_XANC5 RecName: Full=Imidazole glycerol phosphate synthase
    6::190     1e-12  28%  258 aa  HIS6_SYNS9 RecName: Full=Imidazole glycerol phosphate synthase
    6::242     1e-12  23%  258 aa  HIS6_XANCB RecName: Full=Imidazole glycerol phosphate synthase
    6::246     1e-12  24%  270 aa  HIS6_ALTMD RecName: Full=Imidazole glycerol phosphate synthase
    6::226     2e-12  29%  274 aa  HIS6_METS3 RecName: Full=Imidazole glycerol phosphate synthase
    6::215     2e-12  25%  252 aa  HIS6_LACCB RecName: Full=Imidazole glycerol phosphate synthase
    6::242     2e-12  23%  258 aa  HIS6_XANAC RecName: Full=Imidazole glycerol phosphate synthase
    6::243     2e-12  25%  256 aa  HIS6_PASMU RecName: Full=Imidazole glycerol phosphate synthase
    6::243     2e-12  24%  257 aa  HIS6_MANSM RecName: Full=Imidazole glycerol phosphate synthase
   17::263     2e-12  25%  263 aa  HIS6_CLAM3 RecName: Full=Imidazole glycerol phosphate synthase
    6::221     2e-12  25%  256 aa  HIS61_SYNPX RecName: Full=Imidazole glycerol phosphate synthase
    6::207     3e-12  24%  254 aa  HIS6_THEP1 RecName: Full=Imidazole glycerol phosphate synthase
    7::226     3e-12  28%  271 aa  HIS6_NATPD RecName: Full=Imidazole glycerol phosphate synthase
   11::219     3e-12  27%  261 aa  HIS6_MYCLE RecName: Full=Imidazole glycerol phosphate synthase
   11::219     3e-12  27%  261 aa  HIS6_MYCLB RecName: Full=Imidazole glycerol phosphate synthase
    6::243     3e-12  24%  258 aa  HIS6_HAEIN RecName: Full=Imidazole glycerol phosphate synthase
    6::243     3e-12  24%  258 aa  HIS6_HAEI8 RecName: Full=Imidazole glycerol phosphate synthase
    9::203     3e-12  25%  248 aa  HIS62_CAMJJ RecName: Full=Putative imidazole glycerol phosphate
    6::241     4e-12  23%  255 aa  HIS6_CAMJR RecName: Full=Imidazole glycerol phosphate synthase
    6::241     4e-12  23%  255 aa  HIS61_CAMJE RecName: Full=Imidazole glycerol phosphate synthase
    1::221     5e-12  31%  226 aa  Y703_METJA RecName: Full=Uncharacterized protein MJ0703;
    6::244     5e-12  24%  270 aa  HIS6_SORC5 RecName: Full=Imidazole glycerol phosphate synthase
    6::246     5e-12  22%  252 aa  HIS6_LACPL RecName: Full=Imidazole glycerol phosphate synthase
    6::246     5e-12  23%  257 aa  HIS6_ACTSZ RecName: Full=Imidazole glycerol phosphate synthase
    6::215     7e-12  27%  256 aa  HIS6_SYNSC RecName: Full=Imidazole glycerol phosphate synthase
    6::234     7e-12  30%  266 aa  HIS6_RHOFD RecName: Full=Imidazole glycerol phosphate synthase
   17::225     7e-12  27%  267 aa  HIS6_MYCBT RecName: Full=Imidazole glycerol phosphate synthase
   17::225     7e-12  27%  267 aa  HIS6_MYCBP RecName: Full=Imidazole glycerol phosphate synthase
   17::225     7e-12  27%  267 aa  HIS6_MYCBO RecName: Full=Imidazole glycerol phosphate synthase
   30::231     7e-12  28%  271 aa  HIS6_HALMA RecName: Full=Imidazole glycerol phosphate synthase
    6::241     7e-12  23%  255 aa  HIS6_CAMJD RecName: Full=Imidazole glycerol phosphate synthase
    6::213     9e-12  26%  257 aa  HIS6_SHEPW RecName: Full=Imidazole glycerol phosphate synthase
    6::215     9e-12  24%  252 aa  HIS6_LACC3 RecName: Full=Imidazole glycerol phosphate synthase
    7::207     9e-12  25%  254 aa  HIS6_CORA7 RecName: Full=Imidazole glycerol phosphate synthase
    6::241     9e-12  23%  255 aa  HIS6_CAMJ8 RecName: Full=Imidazole glycerol phosphate synthase
    6::243     1e-11  23%  258 aa  HIS6_EDWI9 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     1e-11  28%  259 aa  HIS6_CHLSY RecName: Full=Imidazole glycerol phosphate synthase
    6::213     1e-11  28%  259 aa  HIS6_CHLAA RecName: Full=Imidazole glycerol phosphate synthase
   39::212     1e-11  26%  261 aa  HIS62_PROMM RecName: Full=Putative imidazole glycerol phosphate
   31::243     2e-11  25%  257 aa  HIS6_PSEHT RecName: Full=Imidazole glycerol phosphate synthase
   11::219     2e-11  25%  261 aa  HIS6_MYCS2 RecName: Full=Imidazole glycerol phosphate synthase
   32::229     2e-11  29%  274 aa  HIS6_METST RecName: Full=Imidazole glycerol phosphate synthase
   31::241     2e-11  24%  257 aa  HIS6_FRAP2 RecName: Full=Imidazole glycerol phosphate synthase
    6::230     2e-11  26%  253 aa  HIS6_MYXXD RecName: Full=Imidazole glycerol phosphate synthase
   24::225     3e-11  27%  260 aa  HIS63_VIBVY RecName: Full=Putative imidazole glycerol phosphate
    6::243     3e-11  23%  257 aa  HIS6_PROMH RecName: Full=Imidazole glycerol phosphate synthase
    6::246     5e-11  23%  257 aa  HIS6_TOLAT RecName: Full=Imidazole glycerol phosphate synthase
    7::216     5e-11  26%  258 aa  HIS6_NOCSJ RecName: Full=Imidazole glycerol phosphate synthase
    6::241     5e-11  22%  255 aa  HIS6_CAMLR RecName: Full=Imidazole glycerol phosphate synthase
   31::213     6e-11  26%  259 aa  HIS6_SHEAM RecName: Full=Imidazole glycerol phosphate synthase
    7::191     6e-11  27%  255 aa  HIS6_SALTO RecName: Full=Imidazole glycerol phosphate synthase
    6::203     6e-11  27%  255 aa  HIS6_RHOPS RecName: Full=Imidazole glycerol phosphate synthase
   31::251     6e-11  23%  254 aa  HIS62_LEPIN RecName: Full=Putative imidazole glycerol phosphate
    6::213     8e-11  26%  257 aa  HIS6_SHEHH RecName: Full=Imidazole glycerol phosphate synthase
    6::219     8e-11  24%  257 aa  HIS6_SHEFN RecName: Full=Imidazole glycerol phosphate synthase
   32::251     8e-11  28%  274 aa  HIS6_METTH RecName: Full=Imidazole glycerol phosphate synthase
   54::223     8e-11  29%  272 aa  HIS62_VIBVY RecName: Full=Putative imidazole glycerol phosphate
    9::206     1e-10  27%  253 aa  HIS6_ACIBL RecName: Full=Imidazole glycerol phosphate synthase
    6::217     1e-10  25%  257 aa  HIS6_SHESH RecName: Full=Imidazole glycerol phosphate synthase
    6::246     2e-10  23%  257 aa  HIS6_PSEA6 RecName: Full=Imidazole glycerol phosphate synthase
   47::202     2e-10  25%  248 aa  HIS62_CAMJE RecName: Full=Putative imidazole glycerol phosphate
    6::240     2e-10  25%  257 aa  HIS6_XYLFT RecName: Full=Imidazole glycerol phosphate synthase
    6::240     2e-10  25%  257 aa  HIS6_XYLFM RecName: Full=Imidazole glycerol phosphate synthase
    6::240     2e-10  25%  257 aa  HIS6_XYLF2 RecName: Full=Imidazole glycerol phosphate synthase
    6::217     2e-10  24%  257 aa  HIS6_SHEPA RecName: Full=Imidazole glycerol phosphate synthase
    6::212     3e-10  26%  257 aa  HIS6_XYLFA RecName: Full=Imidazole glycerol phosphate synthase
    6::209     3e-10  24%  258 aa  HIS6_BUCBP RecName: Full=Imidazole glycerol phosphate synthase
   31::233     3e-10  26%  258 aa  HIS6_BUCAI RecName: Full=Imidazole glycerol phosphate synthase
    6::243     5e-10  22%  258 aa  HIS6_SODGM RecName: Full=Imidazole glycerol phosphate synthase
   31::241     5e-10  27%  255 aa  HIS6_MARMM RecName: Full=Imidazole glycerol phosphate synthase
    6::223     5e-10  22%  251 aa  HIS6_CHLPB RecName: Full=Imidazole glycerol phosphate synthase
   95::211     7e-10  32%  253 aa  HIS6_ROSDO RecName: Full=Imidazole glycerol phosphate synthase
    6::231     9e-10  24%  260 aa  HIS6_UNCTG RecName: Full=Imidazole glycerol phosphate synthase
    6::243     1e-09  22%  258 aa  HIS6_PHOLL RecName: Full=Imidazole glycerol phosphate synthase
    6::228     1e-09  22%  251 aa  HIS6_PROA2 RecName: Full=Imidazole glycerol phosphate synthase
    6::223     1e-09  21%  251 aa  HIS6_CHLCH RecName: Full=Imidazole glycerol phosphate synthase
    6::210     2e-09  22%  251 aa  HIS6_CHLP8 RecName: Full=Imidazole glycerol phosphate synthase
   33::213     2e-09  24%  257 aa  HIS6_AERS4 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     3e-09  23%  257 aa  HIS6_SHEWM RecName: Full=Imidazole glycerol phosphate synthase
    6::214     3e-09  25%  257 aa  HIS6_SHESA RecName: Full=Imidazole glycerol phosphate synthase
    6::210     3e-09  20%  251 aa  HIS6_CHLT3 RecName: Full=Imidazole glycerol phosphate synthase
    6::187     3e-09  26%  251 aa  HIS6_LISMF RecName: Full=Imidazole glycerol phosphate synthase
    6::187     3e-09  26%  251 aa  HIS6_LISMC RecName: Full=Imidazole glycerol phosphate synthase
    6::243     4e-09  22%  258 aa  HIS6_YERPY RecName: Full=Imidazole glycerol phosphate synthase
    6::210     4e-09  20%  251 aa  HIS6_CHLPD RecName: Full=Imidazole glycerol phosphate synthase
    6::243     6e-09  22%  258 aa  HIS6_YERPS RecName: Full=Imidazole glycerol phosphate synthase
    6::243     6e-09  22%  258 aa  HIS6_YERPN RecName: Full=Imidazole glycerol phosphate synthase
    6::243     6e-09  22%  258 aa  HIS6_YERPE RecName: Full=Imidazole glycerol phosphate synthase
    6::243     6e-09  22%  258 aa  HIS6_YERPB RecName: Full=Imidazole glycerol phosphate synthase
    6::243     6e-09  22%  258 aa  HIS6_YERPA RecName: Full=Imidazole glycerol phosphate synthase
    6::243     6e-09  22%  258 aa  HIS6_YERP3 RecName: Full=Imidazole glycerol phosphate synthase
    6::243     7e-09  22%  258 aa  HIS6_YERPP RecName: Full=Imidazole glycerol phosphate synthase
    6::210     7e-09  20%  251 aa  HIS6_PELLD RecName: Full=Imidazole glycerol phosphate synthase
    6::243     1e-08  22%  258 aa  HIS6_YERE8 RecName: Full=Imidazole glycerol phosphate synthase
    6::213     1e-08  24%  257 aa  HIS6_SHESR RecName: Full=Imidazole glycerol phosphate synthase
    6::213     1e-08  24%  257 aa  HIS6_SHESM RecName: Full=Imidazole glycerol phosphate synthase
    6::213     1e-08  24%  257 aa  HIS6_SHEON RecName: Full=Imidazole glycerol phosphate synthase
    6::210     1e-08  20%  251 aa  HIS6_PROVI RecName: Full=Imidazole glycerol phosphate synthase
    6::210     1e-08  20%  251 aa  HIS6_PELPB RecName: Full=Imidazole glycerol phosphate synthase
    6::213     1e-08  25%  270 aa  HIS6_CHLAD RecName: Full=Imidazole glycerol phosphate synthase
    6::243     1e-08  23%  258 aa  HIS6_BLOFL RecName: Full=Imidazole glycerol phosphate synthase
   33::213     1e-08  23%  257 aa  HIS6_AERHH RecName: Full=Imidazole glycerol phosphate synthase
    6::244     2e-08  24%  257 aa  HIS6_SHELP RecName: Full=Imidazole glycerol phosphate synthase
    6::227     2e-08  26%  258 aa  HIS6_BLOPB RecName: Full=Imidazole glycerol phosphate synthase
   31::243     3e-08  23%  257 aa  HIS6_SHEDO RecName: Full=Imidazole glycerol phosphate synthase
    6::228     4e-08  21%  251 aa  HIS6_CHLTE RecName: Full=Imidazole glycerol phosphate synthase
   11::219     6e-08  23%  261 aa  HIS6_MYCSS RecName: Full=Imidazole glycerol phosphate synthase
   11::219     6e-08  23%  261 aa  HIS6_MYCSK RecName: Full=Imidazole glycerol phosphate synthase
   11::219     6e-08  23%  261 aa  HIS6_MYCSJ RecName: Full=Imidazole glycerol phosphate synthase
    6::233     8e-08  21%  258 aa  HIS6_BUCAP RecName: Full=Imidazole glycerol phosphate synthase
   77::229     1e-07  25%  253 aa  HIS6_SILPO RecName: Full=Imidazole glycerol phosphate synthase
    5::211     1e-07  21%  251 aa  HIS6_PROAC RecName: Full=Imidazole glycerol phosphate synthase
   31::213     2e-07  25%  257 aa  HIS6_SHESW RecName: Full=Imidazole glycerol phosphate synthase
   31::213     2e-07  25%  257 aa  HIS6_SHEPC RecName: Full=Imidazole glycerol phosphate synthase
   31::213     2e-07  25%  257 aa  HIS6_SHEB9 RecName: Full=Imidazole glycerol phosphate synthase
   31::213     2e-07  25%  257 aa  HIS6_SHEB8 RecName: Full=Imidazole glycerol phosphate synthase
   31::213     2e-07  25%  257 aa  HIS6_SHEB5 RecName: Full=Imidazole glycerol phosphate synthase
   31::213     2e-07  25%  257 aa  HIS6_SHEB2 RecName: Full=Imidazole glycerol phosphate synthase
    6::210     1e-06  21%  251 aa  HIS6_CHLL2 RecName: Full=Imidazole glycerol phosphate synthase
    7::191     2e-06  24%  255 aa  HIS6_SALAI RecName: Full=Imidazole glycerol phosphate synthase
  113::199     1e-05  34%  209 aa  THIE_CLOTE RecName: Full=Thiamine-phosphate pyrophosphorylase;     
   48::265     2e-05  26%  304 aa  HIS4_ARATH RecName:
  146::229     2e-05  29%  337 aa  DUSB_PSEPK RecName: Full=tRNA-dihydrouridine synthase B;       
    6::221     5e-05  25%  257 aa  HIS4_NEUCR RecName:
  146::229     5e-05  30%  332 aa  DUSB_PSEAE RecName: Full=tRNA-dihydrouridine synthase B;       
  259::333     8e-05  34%  337 aa  PYRD_DICNV RecName: Full=Dihydroorotate dehydrogenase;       
  148::226     8e-05  37%  239 aa  GGGPS_PYRAR RecName: Full=Geranylgeranylglyceryl phosphate
  175::226     8e-05  37%  247 aa  GGGPS_METMA RecName: Full=Geranylgeranylglyceryl phosphate
  143::226     1e-04  29%  323 aa  DUSB_PROVU RecName: Full=tRNA-dihydrouridine synthase B;       
  154::225     1e-04  35%  250 aa  GGGPS_METS3 RecName: Full=Geranylgeranylglyceryl phosphate
  175::226     1e-04  37%  247 aa  GGGPS_METBU RecName: Full=Geranylgeranylglyceryl phosphate
  143::228     1e-04  28%  320 aa  DUSB_HAEDU RecName: Full=tRNA-dihydrouridine synthase B;       
   31::86      2e-04  25%  258 aa  HIS6_STRMK RecName: Full=Imidazole glycerol phosphate synthase
   31::86      2e-04  25%  258 aa  HIS6_STRM5 RecName: Full=Imidazole glycerol phosphate synthase
  175::226     2e-04  33%  247 aa  GGGPS_METBF RecName: Full=Geranylgeranylglyceryl phosphate
  136::212     4e-04  26%  284 aa  YQI2_CAEEL RecName: Full=Uncharacterized tRNA-dihydrouridine
  183::234     5e-04  33%  255 aa  GGGPS_METTP RecName: Full=Geranylgeranylglyceryl phosphate
  144::188     7e-04  40%  214 aa  THIE_THETN RecName: Full=Thiamine-phosphate pyrophosphorylase;     
  120::193     7e-04  33%  210 aa  THIE_CLOCE RecName: Full=Thiamine-phosphate pyrophosphorylase;     
  439::500     7e-04  31%  553 aa  HIS5_EMENI RecName: Full=Imidazole glycerol phosphate synthase
  146::229     7e-04  29%  337 aa  DUSB_PSESM RecName: Full=tRNA-dihydrouridine synthase B;       
  113::226     7e-04  37%  330 aa  DUSB_HAEIN RecName: Full=tRNA-dihydrouridine synthase B;       
  127::243     7e-04  27%  324 aa  DUS4L_MOUSE RecName: Full=tRNA-dihydrouridine synthase 4-like;     
    1::249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQPVNADIIYHIA
HIS4_NITOC      MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQPVNADIIYHIA
HIS4_THISH      MLVIPAIDLKDGKCVRLRQGRMDDATVFSDDPVEVAGRWVEAGARRLHIVDLDGAISGEPRNAGIISEIV
HIS4_ACIF5      MLLIPAIDLKGGNCVRLRQGRMEDDTVFSDDPVATAQRWVEAGAKRLHIVDLDGAVQGEPVNAHAIAAIC
HIS4_ACIF2      MLLIPAIDLKGGNCVRLRQGRMEDDTVFSDDPVATAQRWVEAGAKRLHIVDLDGAVQGEPVNAHAIAAIC
HIS4_METCA      MLLIPAIDLKDGKCVRLRQGRMEDDTVFSDDPXXXXXXXXXXXXXXLHLVDLDGAFAGKPRNAETIHAIR
HIS4_THICR      MLLIPAIDLKDGECVRLRQGLMDDATVFSGDIVAMAERWVNQGARRLHMVDLNGAFEGKPVNGDAVYQVR
HIS4_ALCBS      MLLIPAIDLKDGKCVRLKQGRMEDDTVFSEDPVAVASHWVERGARRLHLVDLNGAFAGEPVNGDIVKAIA
HIS4_ALHEH      MQLIPAIDLKDGRCVRLRQGRMDDETVFSDDPVAMAGRWVAAGTRRLHLVDLNGAVAGKPVNAEIIHRIA
HIS4_CHRVO      MLLIPAIDLKDGQCVRLRQGAMDDATIFSDDPVKVAAHWRDQGARRLHLVDLNGAFAGKPKNLAVIRDIG
HIS4_AZOSB      MLLIPAIDLKDGQCVRLKQGEMDDATVFSEDPAAMARHWIKQGARRLHLVDLNGAFAGKPKNGGAIRAIT
HIS4_NITMU      MLIIPAIDLKDGHCVRLKQGVMENVTVFSEDPAAMARHWLDQGARRLHLVDLNGAFAGKPKNELAIRDIV
HIS4_SACD2      MIVIPAIDLKDGACVRLRQGLMEDSTVFSDDPAAMARKWVEQGAKRLHLVDLNGAFAGEPVNGEVVKAIA
HIS4_METFK      MLIIPAIDLKDGHCVRLKQGLMEDATVFSEDPGAMARHWVDQGGKRLHLVDLNGAFAGKPVNEGAIKAIV
HIS4_MARAV      MLIIPAIDLKDGKCVRLRQGRMEDSTVFGDDPVDMATKWVDAGARRLHLVDLNGAFAGEPVNGEIVKAIA
HIS4_BORPD      MLLIPAIDLKDGRCVRLRQGDLDEATVFSEDPAAMATHWLDLGARRLHLVDLNGAVAGKPKNDAPIKAIL
HIS4_CHRSD      MLVIPAIDLKDGQCVRLKQGRMDDSTTYGDDPVAMAARWVETGARRLHLVDLNGAFEGKPVNAEAVTAIA
HIS4_BORPE      MLLIPAIDLKDGRCVRLRQGDLDDATVFSEDPAAMASHWLDLGARRLHLVDLNGAVAGKPKNEAPIKAIL
HIS4_BORPA      MLLIPAIDLKDGRCVRLRQGDLDDATVFSEDPAAMASHWLDLGARRLHLVDLNGAVAGKPKNEAPIKAIL
HIS4_BORBR      MLLIPAIDLKDGRCVRLRQGDLDDATVFSEDPAAMASHWLDLGARRLHLVDLNGAVAGKPKNEAPIKAIL
HIS4_PSEU2      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVAMAAKWVEGGCRRLHLVDLNGAFEGQPVNGDVVTAIA
HIS4_PSE14      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVAMAAKWVDGGCRRLHLVDLNGAFEGQPVNGDVVTAIA
HIS4_THIDA      MLIIPAIDLKDGHCVRLEQGEMDKATVFSEDPAAMARRWKEHGARRLHLVDLNGAFAGKPVNDAAIQAIV
HIS4_PSESM      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVAMAAKWVDGGCRRLHLVDLNGAFEGQPVNGDVVTAIA
HIS4_PSEPG      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_HAHCH      MLIIPAIDLKDGKCVRLKQGRMDDSTVFSDDPVSMAAQWVDAGARRLHLVDLNGAFAGKPVNGEIVSAIA
HIS4_PSEPK      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_PSEP1      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_PSEF5      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_PSEPW      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_PSEE4      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_ACISJ      MLLIPAIDLKDGHCVRLKQGDMDQSTTFGEDPAAMARKWADAGARRLHLVDLNGAFAGQPKNKAAIKAIA
HIS4_RHOFD      MLLIPAIDLKDGHCVRLKQGDMDQSTTFSEEPFVMARNWVDKGARRLHLVDLNGAFAGHPKNELAIRKIL
HIS4_BORA1      MLLIPAIDLKDGRCVRLRQGDLDDVTVFSEDPAAIASNWLAQGARRLHLVDLNGAVAGKPKNEAPIKAIL
HIS4_TERTT      MLIIPAIDLKDGNCVRLRQGLMDDSTVFGEDPVAFARQWVDKGARRLHLVDLNGAFAGKPVNGDVVTAIA
HIS4_PSEMY      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_PSEAE      MLIIPAIDLKDGACVRLRQGLMEDATVFSDDPVAMAAKWVDGGCRRLHLVDLNGAFEGKPVNGEVVTAIA
HIS4_PSEAB      MLIIPAIDLKDGACVRLRQGLMEDATVFSDDPVAMAAKWVDGGCRRLHLVDLNGAFEGKPVNGEVVTAIA
HIS4_PSEA8      MLIIPAIDLKDGACVRLRQGLMEDATVFSDDPVAMAAKWVDGGCRRLHLVDLNGAFEGKPVNGEVVTAIA
HIS4_PSEA7      MLIIPAIDLKDGACVRLRQGLMEDATVFSDDPVAMAAKWVDGGCRRLHLVDLNGAFEGKPVNGEVVTAIA
HIS4_NITEC      MLIIPAIDLKDGQCVRLKQGIMEDATVFSETPETVALHWLDNGARQLHLVDLNGAFAGKPKNGEAIRAIV
HIS4_LEPCP      MLLIPAIDLKDGKCVRLKQGDMNDSTTFGEDPAAMARRWVDAGARRLHLVDLNGAFAGKPVNEGAIKSII
HIS4_BURPP      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEEPAAMARHWVDRGARRLHLVDLNGAFAGKPKNEDAIRAII
HIS4_BURXL      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEEPAAMARHWVDRGARRLHLVDLNGAFAGKPKNEDAIRAIA
HIS4_PSEFS      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_DIAST      MLLIPAIDLKDGHCVRLKQGDMDQSTTFGEDPAAMARKWADAGARRLHLVDLNGAFAGQPKNKAAIKAIA
HIS4_PSEU5      MLIIPAIDLKDGACVRLRQGLMDDATVFSDDPVAMAAKWVQAGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_POLNA      MLLIPAIDLKDGHCVRLKQGDMDQSTIFSEDPAAMARNWVDKGARRLHLVDLNGAFAGKPKNEAAIKRIA
HIS4_CELJU      MLIIPAIDLKDGQCVRLRQGLMDDSTVFSDDPVAMARQWVDQGCRRLHLVDLNGAFEGKPVNGGVVTAIA
HIS4_BURS3      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURCJ      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURCC      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURCA      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_VARPS      MLLIPAIDLKDGHCVRLKQGDMDQSTIFSEDPAAMARKWVEAGARRLHLVDLNGAFAGKPQNHAAIKAIL
HIS4_PSEPF      MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQPVNGEVVTAIA
HIS4_NEIMF      MLLIPAIDLKEGRCVRLRQGLMEEATVFSDSPAETALHWFEQGARRLHLVDLNGAFAGVPQNLPAIKDIL
HIS4_BURVG      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURTA      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_AZOVD      MLIIPAIDLKDGACVRLRQGRMDDSTVFSDDPVAMAARWVEAGCRRLHLVDLNGAFEGQPINGEVVTAIA
HIS4_ACIAC      MLLIPAIDLKDGHCVRLKQGDMDQSTTFGEDPAAMARKWVDAGARRLHLVDLNGAFAGAPKNHAAIKAIL
HIS4_HERAR      MLLIPAIDLKDGHCVRLKQGDMDQATVFSEDPADMARHWLEQGARRLHLVDLNGAFAGKPKNEPAVKAIL
HIS4_BURCM      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLDAIEAIL
HIS4_BURA4      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLDAIEAIL
HIS4_NEIMA      MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPAETALHWFEQGARRLHLVDLNGAFAGVPQNLPAIKDIL
HIS4_NEIM0      MLLIPAIDLKEGRCVRLRQGLMEEATVFSDSPAETALHWFKQGARRLHLVDLNGAFAGVPQNLPAIKDIL
HIS4_BURPS      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURP6      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURP1      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURP0      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURMS      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURMA      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURM9      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURM7      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_BURCH      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLEAIEAIL
HIS4_POLSQ      MLLIPAIDLKDGHCVRLEQGDMDKATVFSEDPGAMAAHWISKGARRLHLVDLNGAFAGKLKNESAIKSIL
HIS4_RALPJ      MLLIPAIDLKDGQCVRLKQGDMDQATVFSEDPAAMARHWVEQGARRLHLVDLNGAFAGKPRNEAAVKAIA
HIS4_POLSJ      MLLIPAIDLKDGHCVRLKQGDMDQSTIFSEDPAAMARSWVDKGARRLHLVDLNGAFAGKPKNEAAIKKIA
HIS4_NITEU      MLIIPAIDLKDGHCVRLKQGIMENATVFSENPETVALHWLDNGARQLHLVDLNGAFAGKPKNGEAIRAIV
HIS4_BURP8      MLLIPAIDLKDGQCVRLKQGDMDQATIFHEEPAVMARHWVDRGARRLHLVDLNGAFAGKPKNEDAIRAII
HIS4_JANMA      MLLIPAIDLKDGHCVRLKQGDMDQATVFSEDPAEMARHWLLQGARRLHLVDLNGAFAGKPKNESAVKSIL
HIS4_NEIMB      MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPAETALHWFKQGARRLHLVDLNGAFAGVPQNLPAIKDIL
HIS4_NEIG1      MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPADTALHWFEQGARRLHLVDLNGAFAGVPQNLPAIKDIL
HIS4_RALSO      MLLIPAIDLKDGQCVRLKQGDMDQATVFSEDPAAMARHWVDQGARRLHLVDLNGAFVGKPRNAAIKAIIA
HIS4_POLNS      MLLIPAIDLKDGHCVRLEQGDMDKATVFSEDPGAMAAHWISKGARCLHLVDLNGAFAGKLKNESAIKSIL
HIS4_NEIG2      MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPADTALHWFEQGARRLHLVDLNGAFAGVPQNLPAIKDIL
HIS4_ACIAD      MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGARRLHLVDLNGAFAGTPIHKPVVEAIA
HIS4_VEREI      MLLIPAIDLKDGHCVRLRQGDMDQSTTFGENPAAMARQWIDAGARRLHLVDLNGALAGMPKNYGAIKSIL
HIS4_HALHL      MIVIPAIDLKNGHCVRLRQGRMDDETIFDADPVAVAGRWVEAGAERLHLVDLDGAVRGEPAHEQTIHAIA
HIS4_RALEJ      MLLIPAIDLKDGQCVRLKQGDMDQATVFSEDPAAMARHWVNQGARRLHLVDLNGAFVGKPRNAAIKAIIA
HIS4_AZOSE      MLLIPAIDLKDGHCVRLKQGEMDDATVFSEDPAAMARHWIEQGARRLHLVDLNGAFAGKPKNGAAIRSIV
HIS4_ACIBY      MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGARRLHLVDLNGAFAGTPIHKPVVEAIA
HIS4_ACIBT      MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGARRLHLVDLNGAFAGTPIHKPVVEAIA
HIS4_ACIBC      MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGARRLHLVDLNGAFAGTPIHKPVVEAIA
HIS4_ACIB5      MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGARRLHLVDLNGAFAGTPIHKPVVEAIA
HIS4_ACIB3      MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGARRLHLVDLNGAFAGTPIHKPVVEAIA
HIS4_DECAR      MLIIPAIDLKDGQCVRLKQGLMEQATVFSDSPAEQARHWLNQGARRLHLVDLNGAFAGKPKNAAAIKAIA
HIS4_BURM1      MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGARRLHLVDLNGAFAGKPKNLDAIEAIL
HIS4_RALEH      MLLIPAIDLKDGQCVRLKQGDMDQATVFSEDPAAMARHWVEQGARRLHLVDLNGAFVGKPRNEEAIKAIA
HIS4_ACIBS      MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDLVATAQHWVNEGARRLHLVDLNGAFAGTPIHKPVVEAIA
HIS4_PSYCK      -VIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVAMAARWVKEGARRLHLVDLNGAFDGIPVHKQVVHDIA
HIS4_CUPTR      MLLIPAIDLKDGQCVRLKQGDMDQATVFSEDPAAMARHWVEQGARRLHLVDLNGAFVGKPRNAAIKSIIA
HIS4_DELAS      MLLIPAIDLKDGHCVRLIQGDMDQSTTFGEDPAIIARRWLDAGARRLHLVDLNGAFAGQPKNLVAIKAIL
HIS4_PSYA2      -VIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVAMAARWVKEGARRLHLVDLNGAFDGIPVHKQVVHDIA
HIS4_RALME      MLLIPAIDLKDGQCVRLKQGDMDQATVFSEDPAAMARHWVNQGARRLHLVDLNGAFVGKPRNAAIKAIIA
HIS4_METPP      MLLIPAIDLKDGRCVRLKQGDMNVSTTFGEDPVAMARRWLDAGARRLHLVDLNGAFAGKPVNEPAIKAIL
HIS4_GEOSF      MIVIPAIDLKEGKCVRLEQGLMERDTVYSDDPAAQALVWEAKGAELLHIVDLDGAFAGEPKNRGAIEAIV
HIS4_RUTMC      MIVIPAIDLKNGQCVRLRQGLMEDTTVFSDSPVEMAEQWVKQGARRVHLVDLNGAFEGRPVNVSSVTEVV
HIS4_SYNAS      MVIIPAIDLKGGKCVRLLQGDFERVTVYSDHPVEMAKAWREKGAERLHLVDLDGSIAGNPRNAAIISQIV
HIS4_VESOH      MIVIPAIDLKDGQCVRLRQGLMEDTTVFSSNPIEMATQWVEQGARRLHLVDLNGAFEGRPVNSTSITEIV
HIS4_GEOSL      MIVIPAIDLKEGKCVRLEQGLMEKDTVFCDNPADQAREWERQGAELLHIVDLDGAFAGEPKNRASIEAIV
HIS4_GEOSM      MIIIPAIDLKNGCCVRLEQGLMEKDTVFNDDPGAQAVEWQRQGGEILHIVDLDGAFAGEPKNRSAIEAIV
HIS4_GEOMG      MIVIPAIDLKEGKCVRLEQGLMEKDTVFCDNPADQARAWERQGAELLHIVDLDGAFAGEPKNRASIEAIV
HIS4_GEOBB      MIIIPAIDLKNGCCVRLEQGLMEKDTVFNDDPGAQAAEWQRQGGEILHIVDLDGAFAGEPKNRSAIEAIV
HIS4_GEOUR      MIVIPAIDLKEGKCVRLEQGLMDKDTVFCDNPAEQAREWERQGGELLHIVDLDGAFAGKPANKSAIEAIV
HIS4_PELPD      MLVIPAIDLKDGVCVRLEQGLMDRDTVFNDNPASQALEWQNQGAELLHIVDLDGAFAGTPRNKAAIEAIV
HIS4_GEOLS      MIVIPAIDLKEGNCVRLEQGEMNRDTVFSDNPAEQALKWQEAGAELLHLVDLDGAFAGXXXXXXXXXXXX
HIS4_PELCD      MIVIPAIDLKEGRCVRLEQGLMEKDTVYNDNPGAQARSWQEQGGELLHIVDLDGAFAGVPRNRDAIRAIA
HIS4_DESAA      MIVIPAVDIRQGKCVRLSQGRADAQTVYSDDPAAMAAKWEGMGAARIHVVDLDGAFEKTPKNLGAIKKIL
HIS4_PARL1      MILFPAIDLKDGQCVRLVHGLMDQATVFNDDPAAQARAFEEAGFEYIHLVDLNGAFEGKPVNAAAVESIL
HIS4_RHILW      MILFPAIDLKGGQCVRLKLGDMQQATVYNTDPAAQAKSFEDQGFEWLHVVDLDGAFAGHSANGDAVEAIL
HIS4_BRASO      MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAKSFADQGFEYLHVVDLDGAFAGKPMNAQAVEAML
HIS4_XANP2      VILFPAIDLKDGLAVRLEQGDMARATVFNRDPAAQAAEFETLGFRYLHLVDLDGAFAGKPVNAAAVERIL
HIS4_RHIL3      MILFPAIDLKGGQCVRLKLGDMQQATVYNTDPAAQARSFEDQGFEWLHVVDLDGAFAGHSANGDAVEAIL
HIS4_MAGSM      MRIIPAIDLKDGQCVRLFKGDMDQNTVYSDNPGETAKQWAEQGAERMHVVDLNGAFAGEPVNADAIAAIR
HIS4_BRASB      MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAKSFADQGFDYLHVVDLDGAFAGKPMNAQAVEAML
HIS4_RHOPB      MILFPAIDLKNGQCVRLEQGDMDRATVFNLDPAAQAKSFAAQGFEYLHVVDLDGAFAGKPMNAQAVESML
HIS4_RHIE6      MILFPAIDLKGGQCVRLKLGDMQQATVYNTDPAAQAKSFEEQGFEWLHVVDLDGAFAGHSANGDAVEAIL
HIS4_NITWN      VILFPAIDLKSGQCVRLEQGDMARATVFNLDPVEQARAFAAQGFEYLHVVDLDGAFAGKPVNADAVERVL
HIS4_TRIEI      MNIIPAIDILGGRCVRLYQGDYKQTQIFNDNPVDVAKRWADEGATKLHLVDLDAAKVGQPVNQKTIEAII
HIS4_RHIEC      MILFPAIDLKGGQCVRLKLGDMQQATVYNTDPAAQAKSFEDQGFEWLHVVDLDGAFAGHSANGDAVEAIL
HIS4_HELMI      MLIFPAIDLKGGRCVRLYQGRMEDAIVYNDDPVSQALAWQAKGAQMIHLVDLDGAFEGEPKNLPVIQAIL
HIS4_ACAM1      MDVIPAIDLLEGRCVRLYQGDYDQSQVFSENPVEVAKAWEAQGAQWLHLVDLDGAKTGQPVNLDTIAAVV
HIS4_RHORT      MILFPAIDLKDGQCVRLRKGEMDQATVFNDSPADQAAAFALAGCRWIHVVDLNGAFAGRPVNAPAVEAIL
HIS4_BRAJA      VILFPAIDLKNGQCVRLEQGDMARATVFNLNPAAQAQSFAEQGFEYLHVVDLDGAFAGKPVNAQAVEAML
HIS4_RHOPS      MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQARSFAAQGFQYLHVVDLDGAFAGKPVNAQAVESML
HIS42_SILST     MILYPAIDLKDGQAVRLLHGDMDKTTVFNDNPAAQALEFVAAGCEWLHLVDLNGAFAGEPVNAAPVEEIL
HIS4_OLICO      VILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQARSFQDQGFEYLHVVDLDGAFAGKPQNAQAVEAML
HIS4_AZOC5      MILFPAIDLKDGLAVRLEQGDMDRATVFNRDPASQAGEFEALGFRYLHLVDLNGAFAGHPVNAAAVDRIL
HIS4_RHOP2      MILFPAIDLKNGQCVRLEQGDMARATVFNLDPTAQAKSFAAQGFQYLHVVDLDGAFAGKPMNAQAVESML
HIS4_RHOP5      MILFPAIDLKNGQCVRLEQGDMDRATVFNLDPXXXXXXXXXXGFEYLHVVDLDGAFAGKPMNAQAVEAML
HIS4_SINMW      MILFPAIDLKDGQCVRLKLGDMEQATVYNSDPAAQARAFEEQGFEWLHVVDLNGAFAGETVNGDAVDAIL
HIS4_DESOH      MMVIPAVDIKGGKCVRLLQGDMNAETVFSDDPGAMAERWAEAGAELIHVVDLDGAIEKSPRNLKAISALI
HIS4_DESVV      MIVFPAIDLMNGVCVRLRRGRADDETVFSSDPVATARHWQEQGGRWLHVVDLDGAFSGQPVNAPLIRSIC
HIS4_DESVH      MIVFPAIDLMNGVCVRLRRGRADDETVFSSDPVATARHWQEQGGRWLHVVDLDGAFSGQPVNAPLIRSIC
HIS4_BRUSI      MILFPAIDLKDGQCVRLKLGDMDQATIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_BRUO2      MILFPAIDLKDGQCVRLKLGDMDQATIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_BRUME      MILFPAIDLKDGQCVRLKLGDMDQATIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_BRUMB      MILFPAIDLKDGQCVRLKLGDMDQATIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_BRUC2      MILFPAIDLKDGQCVRLKLGDMDQATIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_BRUAB      MILFPAIDLKDGQCVRLKLGDMDQATIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_BRUA2      MILFPAIDLKDGQCVRLKLGDMDQATIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_BRUA1      MILFPAIDLKDGQCVRLKLGDMDQATIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_ANASP      MDVIPAIDLLAGRCVRLYQGDYDRSQVFSENPVDVAKQWVDEGATRLHIVDLDGAKAGKVVNLGAIEAIA
HIS4_SYNY3      MKILPAIDLLGGKCVRLYQGDYDQSQVYHEDPVEVARQWQAQGASRLHLVDLDGAKEGQPVNLTAIANIV
HIS4_ANAVT      MDVIPAIDLLEGRCVRLYQGDYDRSQVFSENPVDVAKQWVDEGATRLHIVDLDGAKAGKVVNLGAIEAIA
HIS4_ERYLH      MIVFPAIDLKGGEVVRLAEGDMDRATVYGDNPAAQAMLFAEAGAEHLHVVDLDGAFAGESRNREAVEAIV
HIS4_METSB      MILFPAIDLKGGRCVRLVQGDMAQATVFGDDPAAQAERFERQGFSYLHMVDLDGAFAGKPQNAAAVEAVL
HIS4_GRABC      --LYPAIDLKDGQCVRLRRGEMEDATIYGNDPAVRARQWQDAGFAWLHVVDLNGAFAGRSENAEAITAIL
HIS4_BEII9      MILYPAIDLKEGHCVRLLQGDMQKATIFNDDPXXXXXXXXXXXXXXLHVVDLDGAFAGKPMNAAAVDAIL
HIS4_AGRVS      MILFPAIDLKDGQCVRLKLGDMEQATVYNPDPGAQAKAFEDQGFEWLHVVDLNGAFAGESVNGAAVDAIL
HIS4_RHOCS      MNIYPAIDLKDGQAVRLLRGDMDQATVFNXXXXXXXXXXXXXGFRWLHLVDLNGAFAGRPVNADAVSRIL
HIS4_RHILO      MILFPAIDLKDGQCVRLKHGDMATATIYNDDPAAQAKAFEDQGFEWLHVVDLNGAFKGQSVNSAAVGAIL
HIS4_BRUSU      MILFPAIDLKDGQCVRLKLGDMDQAIIYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGTAVEAIL
HIS4_AGRT5      MILFPAIDLKDGECVRLKLGDMEQATVYNEDPGAQAKAFEDQGFEWLHVVDLNGAFAGETVNGAAVDAIL
HIS4_MESSB      MILYPAIDLKDGECVRLKLGEMSEATVYNRDPAAQAKAFEEQGFEWLHVVDLNGAFAGASVNGAAVEAIL
HIS4_DESDG      MIIFPAVDIKGGQAVRLRQGKADQETVFSGDPVAMARHWEEQGGRWLHVIDLDGAFSGTPVNRELIRTIC
HIS4_SPHWW      IIVFPAIDLKGGQVVRLAEGDMDRATVYGDDPADQARRFAEAGAEWLHVVDLDGAFAGRAVNAEAVEAII
HIS4_RHOPT      MILFPAIDLKNGQCVRLEQGDMARATVFNLDPXXXXXXXXXXXXXYLHVVDLDGAFAGKPMNAQAVEAML
HIS4_RHOPA      MILFPAIDLKNGQCVRLEQGDMARATVFNLDPXXXXXXXXXXXXXYLHVVDLDGAFAGKPMNAQAVEAML
HIS4_RHISN      MILFPAIDLKDGQCVRLKLGDMDQATVYNPDPAAQARAFEEQGFEWLHVVDLNGAFAGETVNGAAVDAIL
HIS4_RHIME      MILFPAIDLKDGQCVRLKLGDMEQATVYNPDPAAQARAFEEQGFEWLHVVDLNGAFAGETVNGAAVDAIL
HIS4_SYNP2      MEVIPAIDLLGGQCVRLYQGDYQQAQVFNNDPVQVARTWAEQGATRLHVVDLDGAKQGESVNLGXXXXXX
HIS4_NITHX      MILFPAIDLKDGQCVRLEQGDMARATVFNFDPAEQARAFASQGFEYLHVVDLDGAFAGRPVNADAVERML
HIS4_AZOBR      MIIYPAIDLKDGACVRLLRGEMSQATVFNTEPADQARLFESQGFEWLHLVDLNGAFEGKPVNGKAVESIL
HIS4_RHOS5      MILYPAIDLKDGQCVRLLRGEMEAATVFGDDPXXXXXXXXXXGCEWLHLVDLNGAFAGHPVNGAAVEAIL
HIS4_PARDP      MILYPAIDLKDGNCVRLLRGDMEAATVFGTDPXXXXXXXXXXXXEWLHLVDLNGAFAGKPVNXXXXXXXX
HIS4_NOVAD      MIVFPAIDLKAGQVVRLAEGDMDRATVYGDNPAHQASLFAQAGSQYLHVVDLDGSFAGRAENREAVEGIL
HIS4_OCHA4      MILFPAIDLKDGQCVRLKLGDMDQATVYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGKAVEAIL
HIS4_JANSC      MILYPAIDLKDGNAVRLLRGEMSDATVFNTDPAAQARAFQDAGCDWLHLVDLNGAFAGEPVNGAAVEAIL
HIS4_CLOCE      MIIYPAIDIIDGKCVRLQQGSYSDVTVFGDSPVDMARKWESLGAGYLHVVDLDGARSGKSENAEIIKQIA
HIS41_SILPO     MILYPAIDLKDGQAVRLVHGEMDQATVFNDNPAAQALEFVAAGCEWLHLVDLNGAFAGEPVNAAPVEAIL
HIS4_SYNFM      MIIFPAIDIKDGVCVRLMQGDPDRVTVYGKDPVSVAKRWEGEGAGWLHVVDLDGAFLRRPANRQVVASIV
HIS4_AGRRK      MILFPAIDLKDGQCVRLKLGDMNQATVYNPDPGAQAKAFEDQGFEWLHVVDLNGAFAGETVNGAAVDAIL
HIS4_DESVM      MILFPAVDIKDGRCVRLRQGRADAETVFSDDPAAMARHWQDQGAKWLHVIDLDGAFSGMPANFELIRRIC
HIS4_NOSP7      MDVIPAIDLLEGRCVRLYQGDYDRSQVFSENPVDVAKQWVDQGANRLHIVDLDGAKAGKVVNLGAIEAIA
HIS4_CLOTH      MIIYPAVDIKDGRCVRLVQGEFDKVTVYSDNPVEMGLKWERMGAQYLHVVDLDGARTGQIQNTPIISEMA
HIS4_THEP3      MIIYPAVDIKDGRCVRLVQGEFDKVTVYSDNPVEMGLKWERMGAQYLHVVDLDGARTGQIQNTPIISEMA
HIS4_DESHD      MRLFPAIDLKEGKAVRLLQGRMEDATVYGEQPVEVARKFKEQGADSLHVVDLDGAFAGKPVNDAVILKLI
HIS4_RHOCA      MILYPAIDLKDGNCVRLLHGEMDKATVFGTDPAAQAAKFEAAGCAWVHLVDLNGAFAGEPVNGAAVEAIL
HIS4_DESRM      MILFPAIDLKEGQCVRLVEGRMDSATVYSNDPGSMARLWQDQGAQYIHVVDLDGAFAGQPRNRQSIAXXX
HIS4_THEYD      MQIIPAIDLKDGKCVRLRQGKFSEVTVYYDNPEDAALRWQNEGAEVLHVVDLDGAKEGKIGNLPSIKKIR
HIS4_MOOTA      MLVMPAIDLREGRCVRLYQGRIEAETVYSTDPVAVARGWVERGARWLHVVDLDGAFAGRPRNLEVIAAII
HIS4_ZYMMO      LIIFPAIDLKEGHVVRLSEGDMDRATIYDDDPAARARQFYEAGARYLHVVDLDGXXXXXXXXXXXVDAIV
HIS4_RHOSK      MILYPAIDLKDGQCVRLLRGEMEAATVFGDDPXXXXXXXXXXGCEWVHLVDLNGAFAGRPVNXXXXXXXX
HIS4_RHOS4      MILYPAIDLKDGQCVRLLRGEMEAATVFGDDPXXXXXXXXXXGCEWVHLVDLNGAFAGRPVNXXXXXXXX
HIS4_RHOS1      MILYPAIDLKDGQCVRLLRGEMEAATVFGDDPXXXXXXXXXXGCEWVHLVDLNGAFAGRPVNXXXXXXXX
HIS4_THEEB      MDVIPAIDLLDGKCVRLVQGNYDKVNVFHDDPLKVALYWQRLGAPRLHLVDLDAAKTGEPRNYDLIGKIV
HIS4_DESAP      MLIIPAVDLRGGRCVRLFQGRADQETVYSTDPVAVARTWEEQGARRLHVVDLDGAFTGKPQNSGVVLDIV
HIS4_CYAP7      MEVIPAIDLLDGRCVRLYQGDYQQSQVFSENPVEVARQWVEQGANRLHLVDLDGAKAGKPVNLSAIEAIV
HIS4_MAGSA      MFLFPAIDLKDGACVRLKLGLMEESTVFNTDPGXXXXXXXXXXXEWIHVVDLNGAFAGKPVNGAAVDSIL
HIS4_GLOVI      MDIIPAIDILDGRCVRLYQGNYQLAETYGEDPVAVACNWAKLGAPRLHVVDLDGARQGMPVHLDALEAIV
HIS4_SYNWW      MIIYPAIDLKDGQCVRLVQGRVENKTVYSDAPANVARSFQEQGASFLHIVDLDGAFQGSPQNLKXXXXXX
HIS4_DESAD      MIVFPAVDIKDGVCVRLSQGQADAVTVFSSDPVAQAKYWETQGARYLHVVDLDGAFSGMPKNFELIRDIC
HIS4_PELTS      MLIIPAIDLREGNCVRLVEGRLDRETVYSGDPVAVAGMWQSQGARMLHVVDLDGAFSGAPKNLDVIGEIL
HIS4_ROSDO      MILYPAIDLKDGQAVRLVHGDMDRTTVFNDDPAAQARSFVAAGCTWLHLVDLNGAFAGEPVNAAPVEAIL
HIS4_BREBN      -IVYPAIDIRGGKCVRLFQGDYGQETVYADSPLAMAKRWVEQGASWVHLVDLDGAKEGKPANAAIIKEIA
HIS4_CLOPH      MRLYPAIDIRNGQCVRLRQGQFHDVEVYSHVPANIAMQWEGQGASYIHIVDLDGALAGHSVNDEVIKEIV
HIS4_PROM4      MELIPAIDLLEGNCVRLVQGNYNKVTKFNSDPVSQALRWEDMGASRLHIVDLDAARQGFSSNDDVIKQIA
HIS4_PROM1      MEIIPAIDLLNGKCVRLNQGNYNEVTKFNSDPVKQAQIWESKGAKRLHLVDLDGAKTGEPINDLTIKEIK
HIS4_BACP2      --LYPAIDMRNGKCVRLVQGDYDQETIYGDSPLDMATRFANEGAKWIHLVDLDGAKAGNRVNHEHVLAIA
HIS4_PROMT      MEIIPAIDLLNGKCVRLNQGNYNEVTKFNSDPVKQAEIWESKGAKRLHLVDLDGAKTGEPINDLTIKEIK
HIS4_CAUSK      MILYPAIDLKDGQCVRLLHGDMEKATVFNNSPADQAERFVRDGFSWLHVVDLNGAIEGKSVNTAAVQSIL
HIS4_BACA2      --LYPAIDMRNGKCVRLIQGDYGKETIYGDSPLDMAAQFAQEGAEWIHLVDLDGAKAGRKVNDRHVLDIA
HIS4_CAUCR      MILYPAIDLKDGQCVRLLHGDMDKATVFNTSPADQAQRFVQDGFSWLHVVDLNGAIEGKSVNTAAVEQIL
HIS4_BACLD      ----PAIDIRNGKCVRLIQGDYEKETIYGHSPLEMASRFAEEGASWIHLVDLDGAREGKKVNGGHVISIA
HIS4_CYAA5      MDVIPAIDLLEGRCVRLYQGNYQQSEVYNENPVEVARQWADEGATRLHLVDLDGAKQGHPVNLDTIEAIV
HIS4_BACHD      -IIYPAIDMRDGKCVRLVQGDYNQETVYGDSPFTMAKSFAEQGAEWIHMVDLDGAKAKERMNHEHVVKVA
HIS4_CYAP4      MDIIPAIDLLGGRCVRLYQGDYNQAEVFDTDPVGMARRWLSQGATRLHLVDLDGAKTGEPVNQAAMAAIV
HIS4_ROSCS      MEIIPAIDLKDGRCVRLYQGDFQQVTVYGDDPVAIAQHWFEQGAPRLHLVDLDGARSGQPVHTDIIRAIV
HIS4_LISW6      MQIFPAIDLKNGQCVRLFQGDFSKKMIVNEDPIAQAKAFATGGATYLHIVDLDGALEGRPVNLEIIQKMK
HIS4_GEOKA      --IYPAVDMRGGKCVRLLQGDYNKETVYGDSPVAMAEQFAAQGAEWIHMVDLDGAKEGRRVNDRFVIEAA
HIS4_SPHAL      LTIFPAIDLKAGQVVRLAEGDMDRATVYGXXXXXXXXXXXXXXXTHLHVVDLDGAFAGASVNGAAVESII
HIS4_DESMR      MIIFPAVDIKDGQCVRLRQGVADAVTVFSPDPEAMARHWEGLGAKWLHLIDLDGAFSGKPRNFDLIARIC
HIS4_DESHY      MRLFPAIDLKEGKAVRLLQGRMEDATVYGEQPVEVARKFKEQGADSLHVVDLDGAFAGKPVNDAVILKLI
HIS4_METS4      VILFPAIDLKEGRCVRLVQGDMAQAIVFSDDPXXXXXXXXXXGFSWLHVVDLDGXXXXXXXXXXXXXXXX
HIS4_SULNB      MTILPAIDLKDGKAVRLSKGLMESAKIYSDEPWQVAKRFEELGSEWVHLVDLNGAFAGKPENLEQIKKIR
HIS4_DEHE1      MEIIPAIDILGGRCVRLLQGDYAQETVYSPDPVGTAMRWQSLGAPRLHVVDLDGAADGESVNFELIREIA
HIS4_LISMF      MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFATDGATYLHIVDLDGALEGRPINLEIIQRMK
HIS4_LISMC      MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFATDGATYLHIVDLDGALEGRPINLEIIQRMK
HIS4_MICAN      MEVIPAIDILDGKCVRLYQGDYQQSQVFNDNPAIVAREWVNQGATRLHLVDLDGAKEGKSVNLSTIETIL
HIS4_METNO      VILFPAIDLKEGRCVRLVQGDMAQAIVFSDDPAAQAASFAEQGFSWLHVVDLDGXXXXXXXXXXXXXXXX
HIS4_HYPNA      --LYPAIDLKDGACVRLLRGEMDAATVFNTDPADQARAFHAMGFTHLHVVDLNGAFAGAPVNRAAVEGIL
HIS4_LISMH      MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKGFATDGATYLHIVDLDGALEGRPINLEVIQKM-
HIS4_DEHSC      --IIPAIDILGGRCVRLFQGDYAQETVYSSDPVGTAMRWQSLGAPRLHVVDLDGAADGQSVNFELIKEIA
HIS4_GEOTN      --IYPAIDMRGGKCVRLLQGDYNKETVYGDSPVAMAEQFAAQGAEWIHMVDLDGAKEGRRVNDRFVIEAA
HIS4_SULDN      MTLYPAIDLKDGKAVRLTKGLMDSAKIYSDEPWMLVKKFEEMGAKWVHLVDLNGAFAGEPKNLEQIIKIR
HIS4_BACHK      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_NITSB      MEILPAIDLKDGKAVRLTKGLMESAKIYSDEPWQVAKRFEEMGSRWLHLVDLNGAFAGEPKNLEQIKKI-
HIS4_METBU      --VIPAVDMKGGKCVQLVQGVPGSEMISLDDPVEVALDWVSQGARTLHLIDLDGAIEGNRTNAPIIKKIV
HIS4_BACC0      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_RHOBA      MEIWPAIDLRHGKPVRLRQGDYDQQTTFGDDPVEFAKRWQESGAKRLHLVDLDAARGDSPANRDAVQRII
HIS4_LISMO      MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFATDGATYLHIVDLDGALEGRPINLEVIQKM-
HIS4_BACAN      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_BACAC      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_BACAA      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_ALKMQ      MIIYPAIDIQGGQCVRLTQGKKEERKMYFDSPQAVAQRWQAEGAEFIHVVDLDGAFGKGEENMEAIEAIV
HIS4_SYNPW      MQIIPAIDLLGGSCVRLHQGDYDKVTRFSDDPVAQALQWQEQGAERLHLVDLDGARTGEPANDSAIRAIT
HIS4_CAMHC      MEILPAIDLKNGFAVRLKKGEMNSAKIYSDKPWELAEKFADLGAKWLHIVDLDGAFAGEAKNAKTIEKIV
HIS4_CHLAD      MEIIPAIDIKDGRCVRLYQGDFAQMTVYADDPVAVARRWQAQGATRIHVVDLDGARTGRPQNVDAVLAIT
HIS4_BACSK      --IYPAIDIRAGKCVRLEQGDYNKETIYGESPYKMAKSFQDAGAKWVHVVDLDGAKAKRPVNDEAILTIA
HIS4_LISIN      MQIFPAIDLKNGQCVRLFQGDFSKKIIVNEDPIAQAKSFAKSGATYLHIVDLDGALEGRPVNLEIIQQMK
HIS4_ARCB4      MDILPAIDLKDGKAVRLSKGLMDSAKIYSDEPWQVALRFEELGSKWVHIVDLNGAFAGKPANLEQIKKIR
HIS4_BACC3      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_BACAH      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_SYNP6      MDVIPAIDLLGGQCVRLFQGDYDQAEVYGKDPVGMALRWAEAGAQRLHLVDLDGAKEGSPVNAEAIATIA
HIS4_SYNE7      MDVIPAIDLLGGQCVRLFQGDYDQAEVYGKDPVGMALRWAEAGAQRLHLVDLDGAKEGSPVNAEAIATIA
HIS4_SULSY      --IIPAIDIKGGKVVRLYKGEFDKVKVYNENPIDMAKYFEDAGAEHIHVVDLDGALEGLPKNIKILESIV
HIS4_BACCR      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKLGAEILHIVDLDGAIAGESLNLPVIEKIC
HIS4_CLOK5      MIILPAIDLKGGKCVRLYKGDMNSQEVVARDPFETALKFKSEGAQYLHMVDLDGALKGSGENLDIISKIV
HIS4_CLOK1      MIILPAIDLKGGKCVRLYKGDMNSQEVVARDPFETALKFKSEGAQYLHMVDLDGALKGSGENLDIISKIV
HIS4_CLOAB      MIILPAIDIKQGKCVRLYQGRFEKSSVVAESPALTAKSFENDGAKYIHVVDLDGALEGEIINLDAVKSIV
HIS4_CAMC1      MEIFPAIDLKEGQAVRLSKGLMQSAKIYSSEPSELAKRFEDYGAKWLHVVDLDGAFAGEAINFKTIEKIV
HIS4_OCEIH      MIIFPAIDIRNGKCVRLRQGDYNQETIYSNSPVEMAKEWEASGAEYLHTVDLDGAKSGESNNINIIQDVA
HIS4_CYAP8      MDVIPAIDLLDGRCVRLYQGDYQQSQVYNDNPVEVARQWADQGATYLHLVDLDGAKQGKPVNLASIEAII
HIS4_BACWK      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKLGAKILHVVDLDGAIVGESVNLPVIEKIC
HIS4_CAMFF      MEIIPAIDLKQSKAVRLTKGDMQTAKIYSDKPWELAKEFEDLGAKWLHIVDLDGAFAGDAINLKTIEKIV
HIS4_CAMC5      MEIFPAIDLKEGKAVRLSKGDMRSAKIYSHAPQELAKIFEGYGARWLHVVDLDGAFAGETVNFDAVEKII
HIS4_BACCQ      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFETFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_BACC2      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKLGAEILHIVDLDGAIAGESLNFLVIEKIC
HIS4_CLONN      MIILPAIDLRMGKCVRLYKGDFNKTEIVAESAVDTALMFKECGAEYIHIVDLDGALKGKGINLDIVCELI
HIS4_CHLT3      MLIIPAIDIKGGKCVRLTRGDFEQEKIYLDEPSDMAIIWRKQNAKLIHVVDLDAALTGKPENFDKIKQIV
HIS4_METMA      --VIPAVDMRGGKCVQLVQGVPGSEIVSIDDPLAVALDWVSKGAKTLHLVDLDGAIEGERKNSPIIEKIV
HIS4_BACC1      MEIFPAIDLKKGRCVRLYQGEFSKETVMNEDPVAQAIIFETFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_BACC7      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFETFGAKRLHIVDLDGAVAGESLNLSVIERIC
HIS4_BACC4      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKLGAEILHIVDLDGAIAGESLNLPVIEKIC
HIS4_CHLP8      MLIIPAIDIKEGKCVRLTRGDFAQKKIYLDNPADMAIIWRKQNAKMLHVVDLDAALTGEMVNFEKIREIV
HIS4_BACCZ      MEIFPAIDLKEGRCVRLYQGEFSKETVMNEDPVAQAIIFEKFGAKTLHIVDLDGAIAGESLNLPIIEKIC
HIS4_PROVI      MLIIPAIDIKDGKCVRLTRGDFSQQKIYLDNPLDMAIIWRKQNAKMLHIVDLDAALTGEMVNFDIIANIV
HIS4_NAUPA      MIIFPAIDLKDGQAVRLTKGLMDSAKVYSNEPYELAKRFEEMGAEWLHIVDLNGAFAGEPKNIEQIEKIR
HIS4_CLOBL      MIILPAIDLKEGKCIRLYQGDFKASKVVAEDPIEVALKFKENGAEYIHIVDLDGALTGEIKNLSXXXXXX
HIS4_PROM9      MELIPAIDLMNGKCVRLFKGDFNKRKDFTKEPHEQAKYWESEGAKYIHIVDLDAAKTGSPTNDKSIKDIA
HIS4_CHLTE      MLIIPAIDIKEGKCVRLTRGDFAQKKIYLDNPCDMAVIWRKQNAKMIHVVDLDAALTGETVNFERIREIV
HIS4_UNCTG      MIIIPAVDIRQGNSVRLKQGNIDAETIYSKDPVFIAKLWKSKGAKRLHVVDLDGAFSGTXXXXXXXXXXX
HIS4_CLOD6      MIIFPAIDIKDNKCVRLTQGEFDKVNVYYDNPLEVAYKWKNEGAEYIHIVDLNGARSEFGVNTKIIEDIA
HIS4_CLOBK      MIILPAIDLKEGKCVRLYQGDFKASKVVAEDPIEVALKFKENGAEYIHIVDLDGALTGQXXXXXXXXXXX
HIS4_PROA2      MLIIPAIDIKDGKCVRLTRGDFDQQKIYLDNPRDMAIIWRKQNAKMLHVVDLDAALTGTMVNFEKIREIV
HIS4_METAC      --VIPAVDMRGGKCVQLVQGVPGSEIVSLNDPLAVALDWIGKGAKTLHLVDLDGAIEGERKNAPIIEKIV
HIS4_DESDA      MIIFPAVDIQNGKAVRLKQGRAHESTVFAESPVDXXXXXXXXXXXXLHVVDLDGAFDGAAQSRRIVRDIC
HIS4_CLOBH      MIILPAIDLKEGKCIRLYQGDFKASKVVAEDPIEVALKFKENGAEYIHIVDLDGALTGEXXXXXXXXXXX
HIS4_CLOB1      MIILPAIDLKEGKCIRLYQGDFKASKVVAEDPIEVALKFKENGAEYIHIVDLDGALTGEXXXXXXXXXXX
HIS4_CLOB6      MIILPAIDLKEGKCVRLYQGDFKASKVVAEDPIEVALKFKENGAEYIHIVDLDGALTGQXXXXXXXXXXX
HIS4_ANADF      MLVIPAIDLMGGEAVRLEKGDFATKTVYARHPAEKAEEFARAGATLLHVVDLDGAKAGWPVNLDAVRAIC
HIS4_WOLSU      MEIIPAIDLKEGQAVRLTKGLMESAKIYSDEPWRLAKSFEELGAKWLHIVDLNGAFAGEPKNLESIRKIR
HIS4_BRAHW      MYILPAIDLKNGEVVRLVEGNYDNKTTYFKDPLEVLDFFIESGSSYLHVVDLDGASDGETINFKTIEKVI
HIS4_BACSU      --LYPAIDMRNGKCVRLVQGDYNKETIYGDSPYDMAELFEKEGAEWIHLVDLDGAKEGKRVNDRHVIEIA
HIS4_PROMM      MEIIPAIDLLDSVCVRLHQGDYEKVTRFSEDPVDQALSWQKQGATRLHLVDLDGAKSGEPVNDSCVRAIT
HIS4_PROMS      MDLIPAIDLMNGKCVRLFKGDFNKRKDFAKEPHEQAEFWEREGAKYIHIVDLDAAKTGSPTNDKSIKKIA
HIS4_DINSH      MILYPAIDLKDGQAVRLYKGDMDKATVFNDSPAAQARAFQDAGCAWLHLVDLXXXXXXXXXXXXXXXXXX
HIS4_CLOBJ      MIILPAIDLKEGKCIRLYQGDFKASKVVAEDPIEVALKFKENGAEYIHIVDLDGALTGEXXXXXXXXXXX
HIS4_ACICJ      LTLYPAIDLKDGACVRLRRGEMDQATVYAEDPAAQARTFEAAGFTALHVVDLNGAFAGRPVNGEAVRAIL
HIS4_PELLD      MLIIPAIDIKDGKCVRLTRGDFSQQKIYLDNPLDMAIIWRKQNAKMLHIVDLDAALTGEMVNFERIRQIV
HIS4_BACCN      MEILPAIDLKEGRCVRLYQGEFNKETVVNEHPVAQAMIFEKMGANRLHIVDLDGAVLGKSANLSTIEDIC
HIS4_PERMH      --VIPAVDIKDGKAVRLYKGDPEAVTVYGDDPVSVAKQWEEKGAKHLHIVDLDGAFEGKPKNIDIVKDIV
HIS4_CARHZ      MILIPAIDLMGKKVVRLTQGEKERKTEYPISPVELALKYQEAGARLIHVVDLDRAFTGESENFEVIAEII
HIS4_PROM0      MNLIPAIDLMNGKCVRLFKGDFNKRKDFTKEPHEQAKFWESEGAKCIHIVDLDAAKTGSPTNDKSIKKIA
HIS4_CHLSY      MEIIPAIDIKDGRCVRLYQGDFAQMTVYADDPVAVARSWEAQGATRLHLVDLDGARAGHPQNVDAILAIT
HIS4_CHLAA      MEIIPAIDIKDGRCVRLYQGDFAQMTVYADDPVAVARSWEAQGATRLHLVDLDGARAGHPQNVDAILAIT
HIS4_PROMP      MKLIPAIDLMNGKCVRLFKGDFNKKKDFSREPYEQAKYWENEGAKCIHIVDLDAAKTGIPTNDQSIQKIV
HIS4_CHLCH      MLIIPAIDIKDGKCVRLTRGDFSQKKIYLDNPSDMAIIWRKQNAKMLHIVDLDAALTGEMVNIAAISDIV
HIS4_PELPB      MLIIPAIDIKEGKCVRLTRGDFSQKKIYLDNPNDMAIIWRKQNAKMLHIVDLDAALTGEMVNFEKIREIV
HIS4_HELHP      --IYPAIDLKEGKAVRLFKGDMQSATIYGE-ALEFAKMFEDMGAKWLHIVDLDGAFAGIPQNLKYIEEIL
HIS4_CHLPB      MLIIPAIDIKDGKCVRLTRGEFDKKKIYLDNPRDMAIIWRKQNAKMIHIVDLDAALTGKLVNFEKIREIV
HIS4_UNCMA      --VIPAIDLKGGKCVQLVQGVPGTEMVSIDDAVEVAAGWVGQGAKTLHIIDLDGAFSGSRKNAYIMEDIV
HIS4_SYNSC      MEIIPAIDLLDGACVRLHQGDYDQVTRFSEDPVAQALSWQSQGATRLHLVDLDGAKRGEPINDAAVRAIT
HIS4_OPITP      MTIYPAIDIKGGRCVRLTQGRAEQETIYAQNPADVAMQFRAAGSEWVHVVDLDGAFAGEPQNLAAVQAIV
HIS4_PROM5      MKLIPAIDLMNGKCVRLFKGDFNKRKDFSRKPYEQAKYWEEQGAKCIHIVDLDAAKSGYPSNDQSIKKIA
HIS4_PROM3      MEIIPAIDLLDSACVRLHQGDYAKVTRFSEDPVAQALSWQKQGATRLHLVDLDGAKSGEPVNDSCVRAIT
HIS4_SYMTH      --LYPAIDLKDGQVVRLRQGRMDEATVYGVDPVRIAARWAEAGARWIHVVDLDGALRGRPQNAAAVRAIV
HIS4_ROSS1      MEIIPAIDMQGGRCVRLYQGDFQRVTVYDDDPVAVAHRWVAQGAPRLHLVDLDGARSGHPVHTDIIRAIV
HIS4_THEPX      MVLIPAIDIMEEKCVRLTKGDFNTKEVYYENPVDVAKMWEELGAKRIHVVDLDGAKQGHLVNGNIIEQII
HIS4_METVO      MYIIPAVDMKEGKCVQLIQGDPTKRHVEYDNPDEIAKMWIENGAEMLHLVDLDGAIDGERVNLPCVKKII
HIS4_SYNS3      MEIIPAIDLLQGSCVRLHQGDYDQVTRFSDDPLAQAQQWVKQGATRLHLVDLDGARSGQPINDQAVRLIA
HIS4_SYNS9      MEIIPAIDLLDGACVRLHQGDYDQVTRFSDDPVAQALSWQSQGAKRLHLVDLDGAKRGEP-XXXXXXXXX
HIS4_SYNJB      --VIPAIDLLQGRAVRLYQGDYAQAEQVADDPIQQAEAWAAQGAPRLHVVDLDGAKSGDPVNLPIIERIV
HIS4_HALOH      MEVIPAVDIKDGSCVRLKKGDFNKRRVYSTSPVDVALYWEKHGASRLHIVDLDGAKSGWPTHLKTIREIA
HIS4_SYNR3      MQIIPAIDLLQGSCVRLHQGDYDQVTRFSEDPVAQALEWQRQGASRLHLVDLDGARSGEPTNDSAVRAIT
HIS4_THERP      MIVIPAIDLREGRCVRLFRGDFARATVYSDDPIEMAQRWASAGARWLHVVDLDGARLGQPVQHELIERVI
HIS4_CHLPD      MLIIPAIDIKDGRCVRLTRGDFNQQKIYLDNPCDMAIIWRKQNAKMLHVVDLDAALTGEMVNFLKIEQIV
HIS4_METM5      MLVIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVSEGAEMLHLVDLDGALDGKRVNDEFIEEII
HIS4_HERA2      MQLIPAIDLRDGRCVRLVQGDFEQTTVYGDDPXXXXXXXXXXXXXRIHIVDLDGAKAGRPTQTSTIAAIT
HIS4_METM7      MLVIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVSEGAEMLHLVDLDGALDGKRVNDEFIEDII
HIS4_METM6      MLVIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVNEGAEMLHLVDLDGALDGKRVNDEFIEEII
HIS4_SYNPX      MEILPAIDLLDGACVRLHKGDYEQVTRFSDDPVAQALSWQQQGATRLHLVDLDGAKRGEPVNDSAVQAIT
HIS4_METMP      MLVIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVNEGAEMLHLVDLDGALDGKRVNDEFIEEII
HIS4_ANADE      MLVIPAIDLIGGEVVRLEKGDFAKKTVYARDPAEKAAELVRDGATLIHVVDLDGAKAGWPVNLDAVRAIC
HIS4_STRMU      MQILPAIDIKNGHAVRLVKGDFEQETVVNDNVLDQASIFMEAGIQYIHVVDLDGALEGRAANRDLIAKIK
HIS4_METVS      MLIIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVEQGAEMLHLVDLDGAINGKRVNDEFIEEII
HIS4_METTH      MLIIPAVDIKDGKCVQLVQGKPGTEQVVLDDPAGVAGRWESLGAETIHVVDLDGAL-GLEKNTGILKEIT
HIS4_METTP      --IFPAVDLRGGRCVQLVQGVPGSEVVSLDDPLVQAVRWADMGADHLHIIDLDGAIEGTRLNAPILRRIV
HIS4_METBF      --VIPAVDMRGGKCVQLVQGVPGSEIVSIDDPVEVALDWVRKGAKTLHLVDLDGAIEGERKNAPIIEKIV
HIS4_SALRD      -LVIPAIDIRDGRCVRLHQGDYDNETVYFEDPVKMAKLWRVQNAQTLHVVDLDAARGEGEHNRDVIGKMC
HIS4_STRSV      MKILPAIDIKDGQAVRLFKGDFSQKTVVNPDVLEQARVFKEAGVTMIHVVDLEGALEGRAANRDLIAQI-
HIS4_CALS8      MIVIPAIDIIDGKCVRLTQGDYSRVQEYNLDPVQQAKYFEKEGARYLHVVDLDGAKKGSPVNFEVIKRIK
HIS4_METVA      MLIIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVEQGAEMLHLVNLDGAINGKRVNDEFIEETI
HIS4_ANASK      MLVIPAIDLIGGEVVRLEKGDFARKTVYARDPAEKAAELVRDGASLIHVVDLDGAKAGWPVNLDAVRAIC
HIS4_ANAD2      MLVIPAIDLIGGEVVRLEKGDFARKTVYARDPAEKAAELVRDGASLIHVVDLDGAKAGWPVNLDAVRAIC
HIS4_NOCSJ      --LLPAVDITEGRAVQLAQGVAGSERTYGD-PVAAAMRWQEAGAEWIHLVDLDAAF-GRGSNRELQAEIV
HIS4_PELUB      MKIFPAIDIKDKKCVRLIKGDFNNKTEYEISPVDQAGKYKDHGFKNLHIVDLDGALTGETVNLDIIKEIV
HIS4_METST      MIIIPAVDIKNGKCVQLVQGEPGTEQVVIENPAEVAKQWEQKGAKKLHIVDLDGAL-GSGRNLSIVKEII
HIS4_METJA      MIIIPAVDLKDKKCVQLIQGDPNKKHLELNNPVEVAKKFVDEGAEYLHIIDLDAAF-GTGNNRDVIKNII
HIS4_SALAI      LTLLPAVDVADGQAVRLVQGAAGSETAYGD-PLDAALAWQRDGAEWIHLVDLDAAF-GRGSNADLLADVV
HIS4_CORJK      LTLLPAVDVADGQAVRLVQGAAGTETSYGA-PIEAALAWQNAGAEWIHLVDLDAAF-GRGSNFELLKEVT
HIS4_LACLS      MEIIPAIDLQNGEAVRLYKGDYDKKTVYSKNPLEIAQKFEQMGAKYLHLVDLDGAKLGQTRNLEIVRKIK
HIS4_ANATD      MIVIPAIDLIDGKCVRLTQGDYSQVQLFNSDPIEQAKLFEKSGAKYVHVVDLDGAKVGRPVNFEVIRNI-
HIS4_LACLA      MKIIPAIDLQNGEAVRLYKGDYDKKTVYSKNPLEIAQKFERMGATDLHLVDLDGAKIGQTRNLELVRKIK
HIS4_METPE      MKVFPAVDILGGRCVQLVQGRRESATDFGD-PLSCATQWLEEGATALHVINLDGAFGKAQANAALIRDLV
HIS4_HALWD      --VIPAVDMQDGDVVQLVQGERGTETRYGD-PVVAAKQWVEAGAKTLHLVDLDGAFEGDRMNATXXXXXX
HIS4_PROMA      --IIPAIDLLKGSCVRLVQGDYNEVTEFNDNPSQQALLWQTLGAKRLHLVDLDGAKTGEPLNDSAIRKIK
HIS4_LACLM      MEIIPAIDLQNGEAVRLYKGDYDKKTVYSKNPLEIAQKFEQMEAKYLHLVDLDGAKLGQTRNLEIVRKIK
HIS4_CLOB8      MIILPAIDIIDGKPVRLYQGDYNKKEIVADDVFETAKSFQDMGAEYIHLVDLDGAKSGSNQNHELVIKIA
HIS4_NATPD      --VIPAVDMQDGQVVQLVGGERGTETEYGD-PVAAAQRWVDAGAETLHLVDLDGAFEGERANADAVEAVL
HIS4_SORC5      MQLIPAIDLLGGQAVRLHQGRYDQVTVYDQDPXXXXXXXXXXXXXX-HVVDLEGARAGLPVQADAVRAVI
HIS4_STRTD      MQILPAIDIKDGQAVRLFKGDFNQKTVVNPDIIEQAKTFKNAGIQFIHLVDLDGTLDGRATNRDLITEV-
HIS4_GEMAT      MIAIPAVDLRGGQCVQLVGGDYEQEQVRLADPLSVARDWSRTGFTRMHIVDLDAA-TGRGQNHELIRDLL
HIS4_NOCFA      LVLLPAVDVANGEAVRLVQGEAGSETSYGS-PRDAALAWQEAGAEWVHLVDLDAAF-GRGSNRELLAKVV
HIS4_METLZ      MEVFPAVDILSGNCVQLVGGDRLTATVYGS-PMDNARRWISEGASNLHVVNLDGAFTASTTNAEMIREVV
HIS4_PARD8      --LIPAIDIIDGKCVRLTQGDYATKKVYNEDPLEVAKMFEGNGIRRLHVVDLDGAREGRIINYRILERIA
HIS4_CLOBA      MIILPAIDIIDGQAVRLYQGDYNKKEVVANDIFNIAKEFECLGAEYIHLVDLDGAKSGYCVNEKIILKLA
HIS4_LEUMM      -MIFPAIDLLNGQSVRLYQGDYEKETTINPDPLKQAKQIESAGLKHLHLVDLDGAKEGKPVNLNVIQSLR
HIS4_CORGL      --ILPAVDVVNGQAVRLDQGEAGTEKSYGT-PLESALKWQEQGAKWLHFVDLDAAF-NRGSNHEMMAEIV
HIS4_FRAAA      LTLLPAVDVADGRAVRLVQGEAGSETSYGD-PLEAALTWQRDGAEWIHLVDLDAAF-GRGSNRELIAEVV
HIS4_SYNJA      --VIPAIDLLQGRAVRLYQGDYAQAEQVAADPVQQAEIWATQGAPRLHVVDLDGAKSGDPVNLPIIADIV
HIS4_MYCLE      LILLPAVDVVEGRAVRLVQGKAGSENDYGS-ALDAALCWQRDGADWIHLVDLDAAF-GRGSNRELLSEMV
HIS4_HALSA      --VLPAVDMQDGQVVQLVQGERGTERTYGD-PVDAATDWVAAGAEALHLVDLDGAFEGARANATAVEDIL
HIS4_ARTS2      -----------GQAVRLVQGEAGSETSYGT-PLEAALNWQEQGAEWVHLVDLDAAF-GRGSNAELLREVV
HIS4_ARTAT      --LLPAVDIVDGQAVRLLQGEAGSETSYGT-PLEAALNWQNDGAEWVHMVDLDAAF-GRGNNAALISDVV
HIS4_META3      MIVIPAVDIKNKKCVQLIQGNPDKKHIELDNPLEVAEKWIKCGAEMIHLVDLDSAIYGTDTNKETIKKII
HIS4_ARCFU      --VIPAIDLKDGKVVRLRQGKEDEVTFEATNPIEVAKQWVEIGAKVLHVIDLSGAFQGRLRH---XXXXX
HIS4_BACV8      --LIPAIDIIDGKCVRLSQGDYNTQKVYNENPVEVAKEFEAHGIHRLHIVDLDGAVSRHVVNYRVLDQIA
HIS4_LACC3      MKLYPAIDLLNGKSVRLTQGDY-DQVSLTEDPLYQAQRLTDAGFAHLHLVDLDGARAQRPINRTVITRIR
HIS4_AQUAE      --IIPAIDLMEGKAVRLYKGDFNKVKVYSERPWELAKNFSDLGFKRLHVVDLEGAEGGKPKNLEVIRKIR
HIS4_THEFY      --LLPAVDVAGGQAVQLVQGKDGTGGRYGD-PLNAALTWQNAGAEWIHLVDLDAAF-GRGHNRELLASIV
HIS4_LEGPH      MLVIPAIDLQSGRCVRLKQGRFDQVTQFSVFPIERALHFAKLGAKRLHVVDLDGARSGKMQQLELICSMQ
HIS4_LACPL      -MIFPAIDLRAGQSVRLYQGDFKQATLINPDPVVQAQQINAAGLQQLHMVDLDGAKSGRPENFATITAIR
HIS4_LEGPA      MLVIPAIDLQSGRCVRLKQGRFDQVTQFSVFPIERALHFAKLGAKRLHVVDLDGARSGKMQQLELICSMQ
HIS4_PROAC      LTLLPAVDVQGGRAVQLQQGVASSERAFGD-PLDVAQKWQGLGAQWIHLVDLDAAF-GHGSNTKIISSVV
HIS4_MYCSS      LILLPAVDVVEGRAVRLVQGKAGSETEYGS-ALDAALGWQRDGAEWIHLVDLDAAF-GRGSNRELLADVV
HIS4_MYCSK      LILLPAVDVVEGRAVRLVQGKAGSETEYGS-ALDAALGWQRDGAEWIHLVDLDAAF-GRGSNRELLADVV
HIS4_MYCSJ      LILLPAVDVVEGRAVRLVQGKAGSETEYGS-ALDAALGWQRDGAEWIHLVDLDAAF-GRGSNRELLADVV
HIS4_RHOSR      LVLLPAVDVVNGEAVRLVQGEAGSETGYGS-PRDAALAWQNDGAEWVHIVDLDAAF-GRGSNRELLADVV
HIS4_METHJ      MIVFPAVDILGGRCVQLVQGKRETATSYGD-PLLCAESWINQGAEALHIVNLDGAFGSSKLNAEKITDVI
HIS4_LEGPL      MLVIPAIDLQSGRCVRLKQGRFDQVTQFSVFPIERALHFAKLGAKRLHVVDLDGARSGKMQQLELICSMQ
HIS4_ACIC1      --ILPAVDVAGGQAVRLVQGAAGTETRYGS-PLEXXXXXXXXXXRWIHLVDLDAAF-GRGSNRELLAEIV
HIS4_THET8      MRLIPAVDLKSGKAVRLYEGDPARETPYGD-PVEAALRFQEEGATLLHLVDLDRAL-GTGENREVVRRVA
HIS4_GRAFK      MRIIPAIDIIEGKCVRLSKGDYATKKIYNEDPLEVAKSFEAHGIEYLHLVDLDGAKSSHIVNHKILETIA
HIS4_FLAPJ      MRIIPAIDIIDGKCVRLSKGDYNTKIIYNENPLEVAKKFEAHGVQYLHLVDLDGAKSSQIINYKILEKIA
HIS4_COREF      --ILPAVDVVNGQAVRLDQGEAGTEKSYGT-PLESALRWQEQGAEWLHFVDLDAAF-NRGSNHELMAEIT
HIS4_SACEN      --LLPAVDVADGQAVRLVQGAAGTETSYGD-PLEAALAWQRAGAEWVHLVDLDAAF-GRGSNRELLADVV
HIS4_RHOOB      LVLLPAVDVVNGEAVRLVQGEAGSETGYGS-PRDAALAWQNDGAEWVHIVDLDAAF-GRGSNRELLADVV
HIS4_LEPIN      MIVIPAIDLFDNCAVRLFKGNYEEKKIYSSEPWKLAESFAKNGATLLHLVDLNGARNQLGVNEDSILKIR
HIS4_LEPIC      MIVIPAIDLFDNCAVRLFKGNYEEKKIYSSEPWKLAESFAKNGATLLHLVDLNGARNQLGVNEDSILKIR
HIS4_BIFLO      LTLLPAVDVRDGKAVRLRQGESGSETDYGS-PFEAARTWVEAGAEWIHLVDLDAAF-GTGNNRDQLREIV
HIS4_BIFLI      LTLLPAVDVRDGKAVRLRQGESGSETDYGS-PFEAARTWVEAGAEWIHLVDLDAAF-GTGNNRDQLREIV
HIS4_ELUMP      MIIFPAIDILDGKCVRLFKGDFNKTTVYENDPVKTAKDFESQGSKYLHIVDLDGAKNPLNRQSEIIKRIA
HIS4_MYCTU      LILLPAVDVVEGRAVRLVQGKAGSQTEYGS-AVDAALGWQRDGAEWIHLVDLDAAF-GRGSNHELLAEVV
HIS4_MYCTA      LILLPAVDVVEGRAVRLVQGKAGSQTEYGS-AVDAALGWQRDGAEWIHLVDLDAAF-GRGSNHELLAEVV
HIS4_MYCBT      LILLPAVDVVEGRAVRLVQGKAGSQTEYGS-AVDAALGWQRDGAEWIHLVDLDAAF-GRGSNHELLAEVV
HIS4_MYCBP      LILLPAVDVVEGRAVRLVQGKAGSQTEYGS-AVDAALGWQRDGAEWIHLVDLDAAF-GRGSNHELLAEVV
HIS4_MYCBO      LILLPAVDVVEGRAVRLVQGKAGSQTEYGS-AVDAALGWQRDGAEWIHLVDLDAAF-GRGSNHELLAEVV
HIS4_CENSY      MKVIPAIDLMDGQVVRLRRGKAKDKTVYSDDPVKVALTWEKDGADMLHIVDLD-ATLGRGNNIDMIRNIT
HIS4_RENSM      --LLPAVDVADGQAVRLVQGEAGSETSYGA-PIDAALAWQQDGAEWVHLVDLDAAF-DRGSNLALLRDVV
HIS4_LEIXX      LVLLPAVDVADGKAVRLTQGAAGSETSYGD-PVXXXXXXXXXXXXXIHLVDLDAAF-GRGDNRGLLKRVI
HIS4_FLAJ1      MRIIPAIDIIEGKCVRLSKGDYDTKIIYNENPLEVAKSFEAYGIEYLHLVDLDGAKSSKIVNYKILEQIA
HIS4_BIFLD      LTLLPAVDVRDGKAVRLRQGESGSETDYGS-PFEAARTWVEAGAEWIHLVDLDAAF-GTGNNRDQLREIV
HIS4_AZOPC      -----------GKAVRLTQGDYKQKKIYNQDPLEVAKKFEDYGIRRLHLVDLDGAKANFIVNYKILERIA
HIS4_MYCA9      LVLLPAVDVADGQAVRLVQGKAGSETTYGS-PRDAALAWQNDGAEWVHLVDLDAAF-GRGSNRELLAQVV
HIS4_METB6      MRIFPAVDILGGRCVQLVQGKRESATAYGD-PLTCARRWIDAGADALHVVNLDGAFGDSAKNADLIRGLV
HIS4_FRAP2      MNIFPAIDLINGKCVRLEKGDFNKTTTYELEPKDVAKAYQQAGAEFIHVVDLDGAKKGQTCQFETIQKIR
HIS4_CORDI      --LLPAVDVVDGQAVRLDQGEAGTEKSYGS-PIAAALKWQEQGASWLHFVDLDAAF-NRGSNHELMAEVV
HIS4_MYCA1      LILLPAVDVVDGRAVRLVQGKAGSETEYGS-ALDAALGWQRDGAEWIHLVDLDAAF-GRGSNRELLAEVV
HIS4_MYCPA      LILLPAVDVVDGRAVRLVQGKAGSETEYGS-ALDAALGWQRDGAEWIHLVDLDAAF-GRGSNRELLAEVV
HIS4_LEGPC      MLVIPAIDLQSGRCVRLKQGRFDQVTQFSVFPIERALHFAKLGAKRLHVVDLDGARSGKMQQLELICSMQ
HIS4_BACFR      --LIPAIDIIDGKCVRLSQGDYGSKKVYNENPVEVAKEFEANGIRRLHVVDLDGAASHHVVNYRTLDLIA
HIS4_THETN      MLVIPAIDILDGKCVRLTKGNFDSKEVYYDNPADMAKMWQECGAKRIHVVDLDGARQGHLVNRKVIEKIV
HIS4_MYCUA      LILLPAVDVVEGRAVRLVQGKAGSETEYGS-ALDAALGWQRDGAEWIHLVDLDAAF-GRGSNRELLAEVV
HIS4_BIFAA      LTLLPAVDVRDGKAVRLRQGESGSETDYGS-PLEAARTWVESGAEWIHLVDLDAAF-GTGNNRDQLRAIV
HIS4_BACFN      --LIPAIDIIDGKCVRLSQGDYGSKKVYNENPVEVAKEFEANGIRRLHVVDLDGAASHHVVNYRTL-DLI
HIS4_STAAW      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_STAAT      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_STAAS      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_STAAE      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_STAAC      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_STAA8      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_STAA3      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_STAAR      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_METTL      MIVIPAVDMKNGKCVQLIQGDPNKKHVELENPVEVAEKWVSEGAEMLHLVDLDGAIEGESVNRELIKEII
HIS4_STRGG      --LLPAVDVRDGQAVRLVHGESGSETSYGS-PLEAALAWQSAGAEWLHLVDLDAAF-GTGDNRALIAEVA
HIS4_MYCVP      LILLPAVDVVEGRAVRLVQGQAGSETEYGS-ALDAAMTWQRDGAEWIHLVDLDAAF-GRGSNRELLAEVV
HIS4_DEIRA      --VIPCVDIQSGRAVRLYEGDPDRETVYFDSPRAAARHWVTLGAGFLHLVDLDAA-TGRGENRAVIAEIV
HIS4_STAAN      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQYAREFDYIKSLR
HIS4_STAAM      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQYAREFDYIKSLR
HIS4_STAA9      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQYAREFDYIKSLR
HIS4_STAA2      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQYAREFDYIKSLR
HIS4_STAA1      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQYAREFDYIKSLR
HIS4_LACCB      MKLYPAIDLLNGKSVRLTQGDY-DQVSLTEDPLYQAQRLTDAGFAHLHLVDLDGARA-QXXXXXXXXXXX
HIS4_STAS1      --LWPAIDLINATSVRLTEGKYDSEVKMARSAEESVLFYNQYQCDRIHIVDLIGAKNQVSIESDYINQL-
HIS4_THET2      MRLIPAVDLKSGKAVRLYEGDPARETPYGD-PVEAALRFQEEGATLLHLVDLDRAL-GTGENREAVRRVA
HIS4_AERHH      -MIIPAIDLINGQVVRLYQGDYGQKTAYSDSPQARFDEYVSQGAVQLHLVDLDGAKDAKARQLPLIAQLL
HIS4_ALTMD      -MIIPAIDLIDGHVVRLYQGDYEQKTQYELDPVEVVHDYADQGATWLHIVDLTGAKDTSKRQLELIKSMV
HIS4_PSYIN      -MIIPALDLIDGKVVRLYQGDYAQKTVYSDSPQSQFTIYNQQGADWLHLVDLDGAKDVTKRQLKVIASLI
HIS4_BIFA0      LTLLPAVDVRDGKAVRLRQGESGSETDYGS-PLDAARTWVDAGAQWIHLVDLDAAFGTGDNRAQLREIVR
HIS4_BACTN      -----------GKCVRLSQGDYDSKKVYNENPVEVAKEFEANGVRRLHVVDLDGAASHHVVNHRVLEQIA
HIS4_SALTO      LTLLPAVDVADGQAVRLVQGAAGSETVYGD-PFDAALAWQRDGAEWIHLVDLDAAF-GRGSNAXXXXXXX
HIS4_AERS4      -MIIPAIDLINGQVVRLYQGDYDQKTEYSSSPQARFDEYVSQGAVQLHLVDLDGAKETQARQLPLLTQLL
HIS4_RHOE4      LVLLPAVDVVNGEAVRLVQGEAGSETGYGS-PRDAALAWQNDGAEWVHLVDLDAAF-GRGSNSELLAGVI
HIS4_PROMH      -MIIPALDLIDGKVVRLHQGDYNKQRDYDDDPIRRYQQYQQDGAKLLHLVDLTGAKDPLARQIPLLKQLV
HIS4_LEPBP      MLVLPAIDLLDNEAVRLLQGDYSKKTVYSSSPEKMIQVFEEQGATLIHIVDLNAAKTGXXXXXXXXXXXX
HIS4_LEPBA      MLVLPAIDLLDNEAVRLLQGDYSKKTVYSSSPEKMIQVFEEQGATLIHIVDLNAAKTGXXXXXXXXXXXX
HIS4_FRASN      LTLLPAVDVADGLAVRLVQGEAGTETSYGD-PREAALAWQRDGAEWIHLVDLDAAF-GRGSNRDLIAEVV
HIS41_PHOLL     -MIIPALDLIDGKVVRLHQGDYAQQRDYQHDPLSHFQQYEQQGAKLLHLVDLTGAKDPSARQIPLLRKLL
HIS4_STAAB      --LWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECNRIHIVDLIGAKAQHAREFDYIKSLR
HIS4_NITMS      MKIIPAIDLMDGQVVRLYKGDPKQKTVYSDDPVSVAKKWQKAGADMLHIVDLD-ATIGTGSNLDLIEKIS
HIS4_STACT      ----PAIDLIDSTSVRLTEGDYETKEAMSRTAEAIEFYSRYNCVTRIHVIDLIAAKQQTPLETNYIEQLV
HIS4_STRCO      --LLPAVDVRDGQAVRLVHGESGTETSYGS-PLEAALAWQRSGAEWLHLVDLDAAF-GTGDNRALIAEVA
HIS4_CYTH3      -----------GKCVRLTQGDYNQKKEYHSNPVEVAKMFEDAGIQRLHLVDLDGAKKKQIVNYKVLENIT
HIS4_PYRFU      --IYPAIDIMDGKVVRLYKGKKDEVKVYGD-PLKFAEKFSEY-VDKIHIVDLDGAFSGKPQNLDIVEKII
HIS4_PASMU      --IIPALDLIDGQVVRLYQGDYGQKTLYSDNPIAQFQDYVAQGAKYLHLVDLTGAKDPTKRQTQLIGEII
HIS4_ACTSZ      -IIIPALDLIEGQVVRLYQGDYAQQTLYSDNPIAQFQCYVDQGAQQLHLVDLTGAKDPVKRQTELIGKII
HIS4_PYRKO      MEVYPAIDLMKGRAVRLYRGRRESVKVYGD-PVKIAQGFSEL-VDKIHVVDLDGAFEGRPRNLEVVERII
HIS4_HAEIN      -IIIPALDLINGQVVRLHQGDYAKQTTYSDNPIKQFDNYVRQGAKQLHLVDLTGAKNPQSRQTALIGKIV
HIS4_HAEIG      -IIIPALDLINGQVVRLHQGDYAKQTTYSDNPIKQFDNYVRQGAKQLHLVDLTGAKNPQSRQTALIGKIV
HIS4_HAEIE      -IIIPALDLINGQVVRLHQGDYAKQTTYSDNPIKQFDNYVRQGAKQLHLVDLTGAKNPQSRQTALIGKIV
HIS4_HAEI8      -IIIPALDLINGQVVRLHQGDYAKQTTYSDNPIKQFDNYVRQGAKQLHLVDLTGAKNPQSRQTALIGKIV
HIS4_DEIGD      -LIIPCVDIQSGRAVRLYEGDPDRETVYFESPLEAARHWAALGAGLVHLVDLDAA-TGRGENRAVITQIT
HIS42_SILPO     MIIYPTMELQNGRCVTLERGRLDAPMLWHVDPFETVSGWASAGAEWMHLTDLD-AVAGTSGNAELVEQII
HIS4_MYXXD      MIAIPAIDLREGACVQLVGGSYAAEKVRVEEPLEALKQWRRHGFRAFHVVDLDAAL-GKGSNADAIFQLT
HIS42_PHOLL     --IVDGIAMTSNSAIRLTRGESSTLRRPLGTPAEVALAWQNAGAKWIHVVDLDAA-SGRGSNSHLIADVL
HIS4_SHEFN      -MIIPAIDLIDGQVVRLYQGDYDKQTTFDLSPLAQLQSYQAQGAKLLHIVDLTGAKDPNKRQTKLIAELA
HIS4_STRAW      --LLPAVDVRDGQAVRLVHGESGTETSYGS-PLEAALAWQRSGAEWLHLVDLDAAF-GTGDNRALIAEVA
HIS4_MARMM      MILYPAIDLLDGRVVRLHKGAFDAVTDYGDDPMRVAEQFGEAGAVWVHIVDLSGARDGARRQGALIRSLC
HIS4_HALMA      --VVPAVDMQDGQVVQLVGGERGTEKTYGD-PVEAAQRWVDAGARTLHLVDLDGAFEGERQNXXXXXXXX
HIS4_STAEQ      --LWPAIDLINSTSVRLTEGKYDSEKMEKSVEDSIRFYSQFKCVKRIHIVDLIGAKAKEVKEFDYIRSLR
HIS4_TOLAT      -MIIPAIDLIDGKVVRLYQGDYGQKTEYSADPQGRFDDYVAQGATQLHLVDLDGAKDSTKRQLTVIRKLL
HIS4_SODGM      -MIIPALDLIDGAVVRLHQGDYQTQCHYGADPLPRLQDYLRQGAEVLHLVDLTGARDPQTRQIPLLRRLL
HIS4_FRASC      LTLLPAVDVADGRAVRLVQGEAGSETSYGD-PREAALTWQRDGAEWIHLVDLDAAF-GRGSNRELIXXXX
HIS4_THEON      MRIYPAIDLMGGKAVRLYRGQKEKVKVYGD-PVEIASRFTEL-VDKIHVVDLDGAFTGKPQNLDVVKEII
HIS4_STAES      --LWPAIDLINSTSVRLTEGKYDTEKMEKSVEDSIRFYSQFKCVKRIHIVDLIGAKAKEVKEFDYIRSLR
HIS4_MANSM      -IIIPALDLIDGNVVRLHQGDYAKQTTYSDNPIEQFASYLAQGAEQLHLVDLTGAKDPAKRQTALIGKII
HIS4_COLP3      -MMIPAIDLIGGEVVRLYQGDYAQKTNYQYTVQDRQQAYAESGATVMHFVDLDGAKDSTKRQLKTLKTVV
HIS4_BAUCH      -MIIPALDLINSTVVRLHQGNYQQQRCYSDDPLYYLHNYLRQGAEMLHLVDLTGARDPSARQIKLLTSLL
HIS4_VIBVU      -MIIPALDLIEGQVVRLYQGDYGQVTEYKVDPAEQFNLYHQAGANWLHLVDLTGAKDTTARQLDLIAKLL
HIS4_CAMJJ      --IIPALDLIDGEVVRLVKGDYEQKKVYKYNPLEKFKEYEKAGAKELHLVDLTGAKDPSKRQLALIEKLA
HIS4_CAMJ8      --IIPALDLIDGEVVRLVKGDYEQKKVYKYNPLEKFKEYEKAGAKELHLVDLTGAKDPSKRQLALIEKLA
HIS4_PHOPR      -MIIPALDLINGQVVRLFQGDYGQVTEYKVDPAEQFKLYNQAGANWLHLVDLTGAKDTSARQLDLISQLL
HIS4_CAMJE      --IIPALDLIDGEVVRLVKGDYEQKKVYKYNPLKKFKEYEKAGAKELHLVDLTGAKDPSKRQFALIEKLA
HIS4_SHEAM      -MIIPAIDLIDGQVVRLFQGDYAKKTEFSLDPKNQLLSYQQDGAALLHLVDLTGAKDPDKRQTKLIEEIA
HIS4_VIBPA      -MIIPALDLIEGQVVRLYQGDYGQVTEYKVDPAEQFNLYHQAGADWLHLVDLTGAKDTSARQLDLIAKLL
HIS4_ACTPJ      -IIIPALDLIDGNVVRLHQGDYAKQTTYSDNPIEQFANYLAQGAEQLHLVDLTGAKDPAKRQTALIGKII
HIS4_ACTP2      -IIIPALDLIDGNVVRLHQGDYAKQTTYSDNPIEQFANYLAQGAEQLHLVDLTGAKYPAKRQTALIGKII
HIS4_VIBVY      -MIIPALDLIEGQVVRLYQGDYGQVTEYKVDPAEQFNLYHQAGANWLHLVDLTGAKDTTARQLDLIAKLL
HIS4_VIBHB      -MIIPALDLIEGQVVRLYQGDYGQVTEYKVDPAEQFNLYHQAGANWLHLVDLTGAKDTTARQLDLIAKLL
HIS4_BUCBP      -MIIPSIDLIEGNIVRLYQGNYDTKTFYQNNIYDIALKYYNQGAKIVHLVDLDGALCPNNKQTSLIKNLL
HIS41_SILST     MMIYPTMELLDGRCVTLDKGNLDAPMIWHVDPVETAKGFAEAGAEWMHLTDFN-ALQGDSSNQDLVEELI
HIS4_VIBF1      -MIIPALDLIEGQVVRLFQGDYGQVTEYKVDPAEQFNLYHQAGANWLHLVDLTGAKDTTARQLDLIARLL
HIS4_ERWCT      -MIIPALDLIDGQVVRLHQGDYGQQRQYGSDPLPRLQDYQQQGAGVLHLVDLTGAKNPSARQIPLLTTLL
HIS4_DICT6      MLIIPAIDIYKHKVVRMETGKKEKIVLEFNNPLDLAKYWEEKGAKALHLIDLQSAIDANDESKSIVRDIV
HIS4_ACTP7      -IIIPALDLIDGNVVRLHQGDYAKQTTYSDNPIEQFASYLAQGAEQLHLVDLTGAKDPAKRQTALIGKII
HIS4_STRMK      -IVYPALDIRDGRVVRLRQGDYAQETSYGDDALPRAQALAAQGAQWMHLVDLDAARAGGYTLAPLLASIR
HIS4_PECCP      -MIIPALDLIDGQVVRLHQGDYGQQRQYGSDPLPRLQDYQQQGAGVLHLVDLTGAKDPSARQIPLLTTLL
HIS4_YERE8      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_BLOFL      -MIIPALDIINGDAVRLYQGKYQSQSHYGN-PYSILSTYVQQGATMIHLVDLDGARNPKNRQLSLIKELT
HIS4_YERPY      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_YERPS      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_YERPP      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_YERPN      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_YERPG      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_YERPE      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_YERPB      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_YERPA      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_YERP3      -MIIPALDLIEGKVVRLHQGDYGQQRDYGNHPLPRLQDYQQQGAQVLHLVDLTGAKDPAARQIPLLRELL
HIS4_SHEPA      -MIIPAIDLIDGQVVRLYQGDYAQQTTFNLSPLDQLKSYQQQGASLLHIVDLTGAKEPDRRQTALISELV
HIS4_SHEPW      -MIIPAIDLIEGQVVRLYQGDYNQKTTFNLSPLEQLQSYQEQGADLLHIVDLTGAKDPMKRQTQLIASLV
HIS4_VIBFM      -MIIPALDLIEGQVVRLFQGDYGQVTEYKVDPAEQFNLYHQAGANWLHLVDLTGAKDTTARQLDLIARLL
HIS4_VIBCH      -MIIPALDLIEGQVVRLYQGDYGQVTEYKVDPAEQFNLYHQAGAGWLHLVDLTGAKNTAARQLNLIARLL
HIS4_SERP5      -MIIPALDLIDGNVVRLHQGDYGQQRDYGNDPLLRLQDYQQQGAQVLHLVDLTGAKDPTARQIPLLRKLL
HIS4_PSEA6      -MIIPAIDLIEGSVVRLYQGDYEQKTKYELDPIDVVNNYADQGAKWLHIVDLTGAKDTNKRQLKLIGDMV
HIS4_LEPBL      MIIIPAIDLFDNCAVRLFKGNYKEKKIYSSEPWKLAEGFAKNGATLLHLVDLNGARNQLGINEDSILKIR
HIS4_LEPBJ      MIIIPAIDLFDNCAVRLFKGNYKEKKIYSSEPWKLAEGFAKNGATLLHLVDLNGARNQLGINEDSILKIR
HIS4_ALISL      -MIIPALDLIEGQVVRLFQGDYGQVTEYKVDPAEQFNLYHQAGANWLHLVDLTGAKDTTARQLDLIARLL
HIS4_DICTD      MLIIPAIDIYKSKVVRMETGKKEKIILEFDNPIDLAKYWEKKGAKALHLIDLQSAIDGXXXXXXXXXXXX
HIS4_CAMJD      --IIPALDLIDGEVVRLVKGDYKQKKVYKYNPLKKFKEYEKAGAKELHLVDLTGAKDPSKRQLVLIEKLA
HIS4_STRM5      -IVYPALDIRDGRVVRLRQGDYAQETSYGDDPLPRTQAFAAQGAQWMHLVDLDAARAGGYTLAPLLSSI-
HIS4_SALAR      -MIIPALDLIDGVVVRLHQGDYARQRDYGNDPLPRLQDYVAQGAEVLHLVDLTG--AKDPANRQILIKTL
HIS4_ERWT9      -MIIPALDLIDGNVVRLHQGDYGQQRDYGSDALPRLQDYQDQGAEVLHLVDLTGAKNPAARQTPLLSRLL
HIS4_CAMJR      --IIPALDLIDGEVVRLVKGDYEQKKVYKYNPLKKFKEYEKAGAKELHLVDLTGAKDPSKRQFALIEKLA
HIS4_XYLFA      -IVYPALDIRNGAVVRLQQGDYARQTRYDDQVLPRALAFADSGATWMHLVDLDAAKAGGYTLAPLLRQMT
HIS4_SHEWM      -MIIPAIDLIEGQVVRLYQGDYKQKTTFDLSPLSQLKSYQDQGASWLHIVDLTGAKDPDKRQTNLIADLV
HIS4_SHEHH      -MIIPAIDLIDGQVVRLYQGDYEQQTTFNLSPLDQLKSYQAQGANLLHIVDLTGAKDPTKRQTALISELV
HIS4_XYLFM      -IVYPALDIRNGAVVRLQQGDYARQTRYDDQVLPRAQAFADSGATWMHLVDLDAAKAGGYTLAPLLRQIT
HIS4_XANOR      ----PALDIRNGRVVRLLQGDYARETHYGNDVLPRAQAFADAGAQWMHLVDLDAAKAGGYTLATTLGEIA
HIS4_XANOP      ----PALDIRNGRVVRLLQGDYARETHYGNDVLPRAQAFADAGAQWMHLVDLDAAKAGGYTLATTLGEIA
HIS4_XANOM      ----PALDIRNGRVVRLLQGDYARETHYGNDVLPRAQAFADAGAQWMHLVDLDAAKAGGYTLATTLGEIA
HIS4_METMJ      MEIYPAVDILDGRCVQLVQGRPEAATVYGD-PAAWAHRWLDEGADGLHVVNLDGAFGRARKNADLIRAFT
HIS4_XANAC      ----PALDIRNARVVRLLQGDYARETQYGDDVLPRAQAFADAGAQWMHLVDLDAAKAGGYTLAGTLGEIA
HIS4_BLOPB      -MIIPALDIINGNIVRLYQGSYCMQTNYGE-PISLLKEYIRQGAKMIHLVDLDGAKNPLKRQSLLISQIK
HIS4_IDILO      -MLIPALDLIDGKVVRLYQGDFAQKTEFDLTPXXXXXXXXXXXXEWLHLVDLDGAKDPDKRQQKLLAKLA
HIS4_THESQ      MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS
HIS4_THEMA      MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS
HIS4_RUBXD      -VVFPAIDLKGGRCVRLRQGDFGRERVYDADPVXXXXXXXXXXXXXLHVVDLDGAREGRPVQLALIREIA
HIS4_BUCCC      -MIIPSLDFIHGKIVRLYQGNYNNKISYKKDIFKQIEKYIYQGATYIHLVDLDGC--NNPENRQSMFNIF
HIS4_SHESH      -MIIPAIDLIEGQVVRLYQGDYAQKTTFDLSPLSQLKSYEAQGANWLHIVDLTGAKDPNARQTRLIAGLV
HIS4_BUCAT      -MIIPAFDLINGRTVRLYQGDYSNQKNYNVNLFNSLEVYKSKGIEIVHLVDLDGAKNSANRQIELLKKIV
HIS4_BUCAI      -MIIPAFDLINGRTVRLYQGDYSNQKNYNVNLFNSLEVYKSKGIEIVHLVDLDGAKNSANRQIELFKKIV
HIS4_BUCA5      -MIIPAFDLINGRTVRLYQGDYSNQKNYNVNLFNSLEVYKSKGIEIVHLVDLDGAKNSANRQIELFKKIV
HIS4_SHEDO      -MIIPAIDLIDGQVVRLYQGDYDKQTTFDLSPLAQLKSYQDQGAKLLHIVDLTGAKDPNQRQIKLISELV
HIS4_EDWI9      -MIIPALDFIDGSVVRLHXXXXXXXXXXXXXALARLLEYQRQGAAQLHLVDLSGARDPARRQLPMLTRLL
HIS4_THEP1      MLVVPAIDLFRGKVARMVKGKKENTIFYEKDPAELVKKLIEEGFTLIHVVDLSKAIENSVENFPVLERLS
HIS4_XANC5      ----PALDIRNGRVVRLLQGDYARETQYGDDVLPRAQAFADAGAQWMHLVDLDAAKAGGYTLAGTLGEIA
HIS4_SHELP      -MIIPAIDLIEGQVVRLYQGDYAQQTTFDLSPXXXXXXXXXXXXTWLHIVDLTGAKDPDRRQTRLIGELV
HIS4_SHESW      -MIIPAIDLIDGNVVRLYQGDYGQQTTFDLSPLAQLQSYEARGAKWLHIVDLTGAKDPAKRQTRLISELV
HIS4_SHESM      -MIIPAIDLIDGKVVRLYQGDYGQQTTFDLSPLAQLQSYQDQGANWLHIVDLTGAKEPAKRQTTLIAKLT
HIS4_SHEON      -MIIPAIDLIDGKVVRLYQGDYGQQTTFDLSPLAQLQSYQAQDASWLHIVDLTGAKDPAKRQTALIAALT
HIS4_METKA      -VVIPSVDVVEGKCVQLVEGDPERRTFESDDPVETAHQWSEF-FPWIHVVDVDAA-RGEGDNSDIIGRIC
HIS4_XYLFT      -IVYPALDIRNGAVVRLQQGDYARQTRYDDQVLPRAQAFADSGATWMHLVDLDAAKAGGYTLAPLLRQIT
HIS4_XYLF2      -IVYPALDIRNGAVVRLQQGDYARQTRYDDQVLPRAQAFADSGATWMHLVDLDAAKAGGYTLAPLLRQIT
HIS4_SHESR      -MIIPAIDLIDGKVVRLYQGDYGQQTTFDLSPQAQLQSYQDQGANWLHIVDLTGAKEPAKRQTTLIAELT
HIS4_SHEB9      -MIIPAIDLIDGNVVRLYQGDYGQQTTFDLSPLAQLQSYEAQGAKWLHIVDLTGAKDPAKRQTRLISQIV
HIS4_SHEB5      -MIIPAIDLIDGNVVRLYQGDYGQQTTFDLSPLAQLQSYEAQGAKWLHIVDLTGAKDPGKRQTLLISQLV
HIS4_SHEB8      -MIIPAIDLIDGNVVRLYQGDYGQQTTFDLSPLAQLQSYEAQGAKWLHIVDLTGAKDPAKRQTLLISQLV
HIS4_SHEB2      -MIIPAIDLIDGNVVRLYQGDYGQQTTFDLSPLAQLQSYEAQGAKWLHIVDLTGAKDPAKRQTLLISQLV
HIS4_THENN      MLVIPAIDLYXXXXXXXXXXXXENTIFYEKDPIELVEKLVEEGFSLIHVVDLSRAIEESDENLPVLEKLS
HIS4_SHEPC      -MIIPAIDLIDGNVVRLYQGDYGQQTTFDLSPLAQLQSYEAQGAKWLHIVDLTGAKDPAKRQTRLISELV
HIS4_BUCAP      -MIIPAFDLINGEIVRLYKGNFFNRTKYDINLYKRLKDYEIKGVKKIHLVDLDGAKNIKDRQIKVFRDII
HIS6_MAGSA      MRIIPCLDVKDGRVVK---GVNFVDLIDAGDPVEQAKLYDKAGADELTFLDITASHE----NRDTIYDVV
HIS4_SHESA      -MIIPAIDLIDGQIVRLYQGDYGQQTTFDLSPQTQLQSYQDQGASWLHIVDLTGAKEPAKRQTALIAKLT
HIS4_ECO45      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_METSB      --IIPCLDVKDGRVVK---GVNFVDLTDAGDPVEAAIRYDAAGADELCFLDITASSDDRPILLDVVRRTA
HIS6_AZOBR      MRVIPCLDVKDGRVVK---GVNFVDLIDAGDPVEQARVYDREGADELTFLDITASHENRDTIYDVVRRTA
HIS4_XANCP      ----PALDIRDGRVVRLLQGDYARETRYGDDVLPRAQAFADAGAQWMHLVDLDAAKAGGYTLAALLGQIS
HIS4_XANCB      ----PALDIRDGRVVRLLQGDYARETRYGDDVLPRAQAFADAGAQWMHLVDLDAAKAGGYTLAALLGQIS
HIS4_XANC8      ----PALDIRDGRVVRLLQGDYARETRYGDDVLPRAQAFADAGAQWMHLVDLDAAKAGGYTLAALLGQIS
HIS6_GEOUR      --IIPCLDVKGGRVVKGVQFLELRD---AGDPVEIAEIYDRQGADELTFLDITASSDARDIIIDVVRRTA
HIS6_GEOSL      --IIPCLDVKGGRVVKGVQFLELRD---AGDPVEIAELYDRQGADELTFLDITASSDERSIIIDVVRRTA
HIS6_GEOMG      --IIPCLDVKGGRVVKGVQFLELRD---AGDPVEIAEAYDRQGADELTFLDITASSDERNIIIDVVRRTA
HIS6_GEOLS      --IIPCLDVTGGRVVKGVQFLELRD---AGDPVEIAEAYDLQGADELTFLDITASSDGRDTMVDVVRHTA
HIS6_PSYWF      --IIPCLDVDNGRVVK---GVQFVDIKDAGDPVEVARRYNEQGADEITFLDITATHHGRETTYDMVERIA
HIS6_THIDA      --IIPCLDVTNGRVVK---GVNFVELKDAGDPVEIARGYNEAGADELTFLDITASSD----NRDLILHIV
HIS6_GEOSF      --IIPCLDVKGGRVVKGVQFLELRD---AGDPVEIAEIYDRQGADELTFLDITASSDARDIIIDVVRRTA
HIS6_CAMC5      --IIPCLDVKDGRVVK---GVNFVGLIDAGDPVEVAKRYNEEGADELAFLDITATHLGQETMVETIARVA
HIS6_PROM5      --LIPCLDVANGRVVKVNFVNLRD----SGDPVELACRYSEAGADELVFLDIRASVENRKTLVDLVSRTA
HIS6_HAHCH      --IIPCLDVDKGRVVK---GVQFVDIRDAGDPVEVAKRYDEQGADEITFLDITASHEGRDTTVHTVERMA
HIS6_CHRVO      --IIPCLDVTAGRVVKVNFLGLRD----AGDPVEIARRYNEQGADELTFLDITASSDQR----DIILHVI
HIS4_ENT38      -MIIPALDLIDGTVVRLHQGDYGQQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILLKSL
HIS6_THEPX      --IIPCLDVKDGRVVKVNFLNLKD----AGDPVQIASEYNELGADELVFLDITASYEKRKIMIEVVKRTS
HIS6_PELTS      -------------CLDVTEGRVVKGTNFAGDPVELAAFYDREGADELVFLDITASAEGRKTTVEMVYRTA
HIS6_METFK      --IIPCLDVTNGRVVK---GVNFLELRDAGDPVEIARRYDEQGADELTFLDITASSDNRGLMLGIIEQVA
HIS6_MAGSM      --IIPCLDVKAGRVVK---GVQFEGLVDAGDPVEAAKRYDEEGADELTFLDITATHEDRGIMEDVVRRTA
HIS4_PSEHT      -MIIPALDVLQNQIVRLYQGKYETVQFYPFELGARLKEYADSGAGKLHLVDLEGARDPSKKQWQHIQAAT
HIS6_OCEIH      --IIPCLDVDNGRVVK---GKKFLDIQDVADPVELAKRYNDEGADELVFYDITASNEQRGIFLDVVEKVA
HIS6_LARHH      --IIPCLDVTAGRVVKVNFVGLRD----AGDPVEIARRYNEQGADELTFLDITASSDAR----DIILHVI
HIS6_CAMHC      --IIPCLDVNNGRVVK---GVNFVNLIDAGDPVEVAKIYNDSGADELCFLDITASFENRDTIVEVVRNVA
HIS6_PSEPF      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PELCD      --IIPCLDVKDGRVVKGVQFLELRD---AGDPVEAAEAYDAQGADELTFLDITASSDKRNIILDVVSRTA
HIS4_KLEP7      -MIIPALDLIDGTVVRLHQGDYGQQRDYGSDPLPRLQAYAAQGAKVLHLVDLTGAKDPAKRQIPLLKSLX
HIS6_PSEF5      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS4_SHIDS      MMIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECO27      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_THETN      --IIPCLDVKDGRVVKINFVNLKD----AGDPVEIAERYNELGADELVFLDITASYEKRKIMIDVVKRTS
HIS6_PERMH      --IIPCLDVNKGRVVK---GVNFVNLVDAGDPVEAAKAYDEAGADELVFLDITASAEERDIILDVVKQTA
HIS6_FLAPJ      --IIPCLDIKNGRTVK---GVNFLDLKDAGDPVALAQKYAEEGADELVFLDISATEEDRKTVIDLVRKVS
HIS6_THICR      --IIPCLDVDNGRVVK---GVQFVDIRDAGDPVEVAKRYDEQGADEITFLDITATAHERDTIVHVVEEVA
HIS6_PSEPW      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYNEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PSEPK      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PSEPG      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYNEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PSEP1      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PSEMY      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PSEFS      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PSEE4      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYNEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_CLOTH      --IIPCLDVHNGRVVK---GVNFVNIRDAGDPVEIASYYDKAGADELTFLDITASAEARNIMIDVVRRVA
HIS4_KLEP3      -MIIPALDLIDGTVVRLHQGDYGQQRDYGSDPLPRLQSYAAQGAEVLHLVDLTGAKDPAKRQIPLLKSLX
HIS6_PROMP      --LIPCLDVANGRVVKVNFVNLRD----SGDPVELACKYSEAGADELVFLDIRASVENRKTLVDLVSRTA
HIS6_DESRM      --VIPCLDVTAGRVVK---GTNFVNLRDAGDPVELAAFYDKEGADELVFLDITASSDGRVTMLDVVRRTA
HIS6_AZOVD      --IIPCLDVDNGRVVK---GVRFENIRDAGDPVEIAQRYDEQGADEITFLDITASHEGRDTTLHTVERMA
HIS4_SHISS      MMIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ESCF3      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_STAEQ      --VIPCLDVKDGRVVKGIQFQSLRDI---GNPVDLALYYNEAGADELVFLDISKTEAGHDLMIEVIEATA
HIS6_PSEA7      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_IGNH4      --IIPCLDVKDGRVVK---GVSFQNLRDAGDPVELAAYYQEQGADEIVFLDISATPEGRETMIEVVRRTA
HIS6_ALKMQ      --IIPCLDVRKGRVVK---GVNFVDIKDAGDPVALARAYNDQGADEIVFLDITASHEERYILLDVVKKTS
HIS4_ECOLC      -MIIPALDLINGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_PSEAB      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PSEA8      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS61_PSEAE     --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS4_SHIBS      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYATQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_STAES      --VIPCLDVKDGRVVKGIQFQSLRDI---GNPVDLALYYNEAGADELVFLDISKTEAGHDLMIEVIEATA
HIS6_NITMU      --IIPCLDVTNGRVVKVKFVSLRD----AGDPIEIARRYDDQGADELTFLDITASSDDRDLILHIIEEVA
HIS6_AZOSB      --IIPCLDVSAGRVVK---GVNFVDLRDAGDPVEVARRYDAQGADEITFLDITASSDDR----DIILHVV
HIS4_SHIB3      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECOLU      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECOHS      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECO7I      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECO24      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_SULAC      --IIPCLDVKDGRVVK---GVNFLNLVDKGDPVELAARYEEEGADEIVFLDITATIEGRKTMMNVVKDTA
HIS6_PSEU2      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_PSE14      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_MARMS      --IIPCLDVDNGRVVK---GVQFVDIRDAGDPVEVAKRYNEQGADEITFLDITASSDDRETTVHMVEAIA
HIS6_HYDS0      --IIPCLDIKDGRVVK---GINFVDLKDAGDPVENAIVYEEQKADEIVFLDITASYEKRNTVIDLAKRVA
HIS6_DESHY      -------------CLDVHEGRVVKGTNFAGDPVELAALYDREGADELVFLDISASAEGRETMVEVVRRTA
HIS6_DESHD      -------------CLDVHEGRVVKGTNFAGDPVELAALYDREGADELVFLDISASAEGRETMVEVVRRTA
HIS4_SHIFL      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SHIF8      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECO81      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECO55      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_RALME      --IIPCLDVTNGRVVK---GVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGR----DLILHII
HIS6_PSESM      --IIPCLDVDNGRVVK---GVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERMA
HIS6_METCA      --IIPCLDVDNGRVVK---GVRFVDIRDAGDPVEIARRYDREGADELAFLDITASSDDRETMVHVVEQVA
HIS4_ECOSM      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECO5E      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECO57      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_NITEC      --IIPCLDIKDGRVVKVNFVSLRD----AGDPVEIARSYNEQGADELVFLDITASVE----NRDLILHIV
HIS6_DESAP      --IIPCLDVNRGRVVKVNFVNLRD----AGDPVELAAVYDREGADEVVFLDITASAEGRDIVLDMVRRTA
HIS6_CAMC1      --IIPCLDVKDGRVVK---GVNFVGLVDAGDPVEIAKRYNDEGADELCFLDITASHLGRDTIVDVVKKVA
HIS6_THEON      --IIAALDIKEGRVVK---GIKFQNIRDAGDPIELARRYEEEGIDEIVFLDITASFEKRKILLDLVKRIA
HIS6_SYNWW      --IIPCLDVHGGRVVK---GTNFINLRDAGDPVEFAAFYDKEGADELVFLDISATSEERQTMVEVVRQTA
HIS6_METPP      --IIPCLDVTGGRVVK---GVNFVELRDAGDPVEIAARYNEQGADELTFLDITATSDGRDLILPIIEAVA
HIS6_METNO      --VIPCLDVKDGRVVK---GVQFLDLRDAGDPVEAAKAYDRAGADELCFLDITASHEARGILLDVVQRTA
HIS6_AZOC5      --VIPCLDVKDGRVVK---GVQFVDLRDAGDPVESARAYDAAGADELTFLDITASHENRGTILDVVRRTA
HIS6_AQUAE      ------------------------------DPVEVAKRYEEEGADELVFLDITASAEDREIMIDVVKKVA
HIS4_ECOK1      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNNPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_TERTT      --IIPCLDVDKGRVVK---GVQFVDIRDAGDPVEVAKKYNEQGADEITFLDITASHEARETTINTVEKIA
HIS6_RHOBA      --VIPCLDVHGGRVVK---GTNFVNLRDAGDPVEVARRYEAEGADELVFLDITASHEERAILLDVVRRTA
HIS6_RALEJ      --IIPCLDVTNGRVVK---GVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGR----DLILHII
HIS6_PSEU5      --IIPCLDVDNGRVVK---GVQFENIRDAGDPVEIARRYDEQGADEITFLDITASVDNRDTTLHTVERMA
HIS6_CLOCE      --IIPCLDVHAGRVVK---GVQFVNIIDAGDPVEAAAFYDKAGADELTFLDITASSDARSIMLDVVSRVA
HIS6_CLOBL      --IIPCLDVDMGRVVKVNFVNLKD----VGDPVEIAEFYNKEGADEIVFLDISATHEGRAIMIDVVRKTA
HIS6_CHRSD      --IIPCLDVDAGRVVK---GVNFVGIRDAGDPVEVAKRYNQQGADEITFLDITASVEDRGTTVEMVERIA
HIS6_BORA1      --IIPCLDVTAGRVVK---GVNFVNLTDAGDPVEIARRYNEQGADELTFLDITATSDGRDLILPIIEQVA
HIS4_SALPC      -MIIPALDLIDGTVVRLHQGDYARQREYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALCH      -MIIPALDLIDGTVVRLHQGDYARQREYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS6_SULSY      --IIPCLDVDKGRVVK---GVNFVNLIDAGDPVEIASVYDKEGADELVFLDITASSEDRNIILDVVKKTA
HIS6_NAUPA      --IIPCLDVKDGRVVKVNFVGLRD----AGDPVEAAIRYNEEGADELTFLDITASHEGRKPIVDIVKEVA
HIS6_MOOTA      --IIPCLDVDHGRVVK---GTNFLNLRDAGDPVELAAAYDREGADELVFLDISASVEGRDIMIDVARRTA
HIS4_SALTI      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALG2      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALEP      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECOUT      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNNPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECOL6      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNNPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECOL5      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNNPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_RALSO      --IIPCLDVTNGRVVK---GVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGR----DLILHII
HIS6_RALEH      --IIPCLDVTNGRVVK---GVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRDLMLHIIEDVA
HIS6_CELJU      --IIPCLDVDNGRVVK---GVKFLDIRDAGDPVEIAKRYNQEGADEITFLDITATHEGRDTTVHTVEKIA
HIS6_BRAJA      --VIPCLDVKDGRVVK---GVNFVDLRDAGDPVEXXXXXXXXXXDELTFLDITATHENRGIMLDVVRRTA
HIS6_ANASP      --ILPCLDVKAGRVVK---GVNFVDLKDAGDPVELAKVYNDAGADELVFLDITATHEDRDTIIDVVYRTA
HIS4_SALPK      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALPA      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALNS      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALDC      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS6_POLNA      --IIPCLDVTGGRVVK---GVNFVELRDAGDPVEIAARYNDQGADELTFLDITATSDGR----DLILHII
HIS6_NITEU      --IIPCLDIKDGRVVKVNFVSLRD----AGDPVEIARSYNEQGADELVFLDITASSE----NRDLILHIV
HIS6_CLOBK      --IIPCLDVDMGRVVKVNFVNLKD----VGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKTA
HIS6_BORPE      --IIPCLDVTAGRVVK---GVNFVNLTDAGDPVEIARRYNEQGADELTFLDITATSDGRDLILPIIEQVA
HIS6_BORBR      --IIPCLDVTAGRVVK---GVNFVNLTDAGDPVEIARRYNEQGADELTFLDITATSDGRDLILPIIEQVA
HIS6_ANAVT      --ILPCLDVKAGRVVK---GVNFVDLKDAGDPVELAKVYNDAGADELVFLDITATHEDRDTIIDVVYRTA
HIS4_SALTY      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALSV      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALPB      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_SALHS      -MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECOSE      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECOLI      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECODH      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECOBW      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS4_ECO8A      -MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTG--AKDPAKRQILIKTL
HIS6_ZYMMO      --IIPCLDVADGRVVK---GVNFTDLMDAGDPVEQAKVYDAAGADELCFLDISASHEGRGTMLDVVARTA
HIS6_RHILO      --VIPCLDVKDGRVVK---GVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVIARTA
HIS6_PELUB      --IIPCLDVKNGRVVK---GINFVDLKDAGDPVEQAKIYSDGGADEICFLDITAS----KENRDTIYDVV
HIS6_METPE      --IIPCLDLKDGRVVK---GTHFVDLRDAGDPVELAERYNEQGADEVVFLDITASKEQRGAILSVISRAA
HIS6_HALOH      --IIPCLDVKGGRVVK---GVNFKDLRDEGDPVELARYYDREGADELVFLDITASAENRGIVIDMVEKTA
HIS6_CLOBJ      --IIPCLDVDMGRVVKVNFVNLKD----VGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKTA
HIS6_CLOBH      --IIPCLDVDMGRVVKVNFVNLKD----VGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKTA
HIS6_CLOB1      --IIPCLDVDMGRVVKVNFVNLKD----VGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKTA
HIS6_BORPA      --IIPCLDVTAGRVVK---GVNFVNLTDAGDPVEIARRYNEQGADELTFLDITATSDGHDLILPIIEQVA
HIS6_BACFN      --IIPCLDIKDGQTVK---GTNFVNLRQAGDPVELGRAYSEQGADELVFLDITASHEGRKTFAELVRRIA
HIS6_THISH      --IIPCLDVDNGRVVK---GVNFVEIRDAGDPVEIARRYDAEGADEITFLDITASHDERETMVHVVEQVA
HIS6_ELUMP      --IIPCLDVKDGKTVK---GVNFINFRDAGDPVALAAEYSRKGADEIVFLDITASHEKRKTLTDLARRVA
HIS6_CUPTR      --IIPCLDVTNGRVVK---GVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRDLMLHIIEDVA
HIS6_BACFR      --IIPCLDIKDGQTVK---GTNFVNLRQAGDPVELGRAYSEQGADELVFLDITASHEGRKTFAELVRRIA
HIS6_THEP3      --IIPCLDVHNGRVVK---GVNFVNIRDAGDPVEIASYYDKAGADELTFLDITASAELRNIMIDVVRRVA
HIS6_RHOP5      --VIPCLDVKDGRVVK---GINFVDLRDAGDPVEXXXXXXXXXXDELTFLDITATHENRGIMLDVVRRTA
HIS6_PROMS      --LIPCLDVAHGRVVKVNFVNLRD----SGDPVELACRYSDEGADELVFLDIRASVENRNTLVDLVSRTA
HIS6_POLSJ      --IIPCLDVTGGRVVK---GVNFVELRDAGDPVEIAARYNEQGADELTFLDITATSDGR----DLILHII
HIS6_OPITP      --IIPCLDVNAGRVVKVRFQQLRD----AGDPVACARAYDAQGADELIFLDITASSDERKIMHDVVAATA
HIS6_CORGL      --VIPCLDVDNGRVVK---GVNFENLRDAGDPVELAKRYDEEGADELTFLDVTASKHGRGTMLDVVRRTA
HIS6_CORGB      --VIPCLDVDNGRVVK---GVNFENLRDAGDPVELAKRYDEEGADELTFLDVTASKHGRGTMLDVVRRTA
HIS6_POLNS      --IIPCLDVTAGRVVKVNFVGLRD----AGDPVEIAKRYDTQGADELTFLDITATSDGR----DLILHII
HIS6_METLZ      --IIPCLDLKAGRVVK---GVNFEGLRDAGDPVELASRYNEQGADEVVFLDIAASKDNRDTMIDVIGRAA
HIS6_HELMI      --IIPCLDVHGGRVVK---GTNFVNLRDAGDPVELAAVYDKEGADEVVFLDITASSDGRAIMLDVVRRTA
HIS6_DINSH      --VIPCLDVADGRVVK---GVNFVDLVDAGDPVESAKAYDAAGADELCFLDIHATNENRGTMYDLATRTA
HIS6_CAMFF      --IIPCLDVNNGRVVKINFVGLRD----AGDPVEVAKRYNDEGADELCFLDITASSDGRDTIVHVVEEVA
HIS6_ALHEH      ------------------------------DPVEIARRYDAMGADEITFLDITASHERRDTMVQVVEKVA
HIS6_AKKM8      --IIPCLDVTDGRVVK---GTNFINLRDAGDPVECARAYDAQQADELVFLDITASSDGRATMADVVRRTA
HIS6_THEYD      --IIPCLDVKDGRVVKVNFLNLRD----AGDPVENALYYNEEEADELVFLDVTASHEKRKIIIDVVERTA
HIS6_OCHA4      --VIPCLDVKDGRVVK---GVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVIARTA
HIS6_GLOVI      --IVPCLDVKAGRVVKVNFVGLRD----AGDPVELAKLYNDQGADELVFLDIAATHEERAILIDVVYRTA
HIS6_CLOD6      --IIPCLDVRNGRVVK---GKKFKDIVDVDSPEVLGKFYSDCGADELVFYDITASNEERKTSLEFVTKVA
HIS6_CLOB6      --IIPCLDVDMGRVVKVNFVNLKD----VGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKTA
HIS6_BACV8      --IIPCLDIKDGQTVK---GTNFVNLRQAGDPVELGRTYSEQGADELVFLDITASHEGRKTFTDLVKRVA
HIS6_ACIF5      --VIPCLDIDHGRVVKGVQFVALRD---AGDPVEVAKRYNDEGADEITFLDISASYEERGTLADMVSAVA
HIS6_ACIF2      --VIPCLDIDHGRVVKGVQFVALRD---AGDPVEVAKRYNDEGADEITFLDISASYEERGTLADMVSAVA
HIS6_SULTO      --IIACLDVKNGRVVKVNFLNLKD----KGDPVELASRYEEEGADEIVFLDITATIEGRKALLEVVKNTA
HIS6_RHISN      --VIPCLDVKDGRVVK---GVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVARTA
HIS6_PROM9      --LIPCLDVAHGRVVKVNFVNLRD----SGDPVELACRYSDEGADELVFLDIRASVENRNTLVDLVSRTA
HIS6_PROM2      --LIPCLDVANGRVVKVNFVNLRD----SGDPVELACRYSDEGADELVFLDIRASVENRNTLVNLVSRTA
HIS6_MICAN      --ILPCLDVNKGRVVKVNFVNLQD----AGDPVELARLYNQAGADELVFLDITATHEDRDTIIDVVYRTA
HIS6_MARAV      --IIPCLDVDKGRVVK---GVNFVDIRDAGDPVEVA</