[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA59517.1

[Show Plain Result]


## Summary of Sequence Search
    1::515
    1::515       0.0 100%  515 aa  ATPA_NITOC RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  83%  513 aa  ATPA1_METCA RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  79%  513 aa  ATPA_THISH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  78%  513 aa  ATPA_ALHEH RecName: Full=ATP synthase subunit alpha;       
    3::513       0.0  77%  513 aa  ATPA_SACD2 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  76%  513 aa  ATPA_HALHL RecName: Full=ATP synthase subunit alpha;       
    4::517       0.0  76%  517 aa  ATPA2_LEGPH RecName: Full=ATP synthase subunit alpha 2;       
    4::517       0.0  76%  517 aa  ATPA2_LEGPA RecName: Full=ATP synthase subunit alpha 2;       
    4::517       0.0  76%  517 aa  ATPA_LEGPL RecName: Full=ATP synthase subunit alpha;       
    4::517       0.0  75%  517 aa  ATPA2_LEGPC RecName: Full=ATP synthase subunit alpha 2;       
    3::513       0.0  77%  513 aa  ATPA_TERTT RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_CHRSD RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  76%  513 aa  ATPA1_NITMU RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  76%  513 aa  ATPA_METFK RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  78%  513 aa  ATPA_RALPJ RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA_RUTMC RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  78%  513 aa  ATPA_RALSO RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA_ALTMD RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  76%  514 aa  ATPA_MARAV RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  77%  513 aa  ATPA_RALEH RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  74%  514 aa  ATPA2_HAHCH RecName: Full=ATP synthase subunit alpha 2;       
    1::513       0.0  76%  513 aa  ATPA_IDILO RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  74%  514 aa  ATPA_ALCBS RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  75%  513 aa  ATPA_RALME RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA_BURM1 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  77%  513 aa  ATPA_THIDA RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  76%  513 aa  ATPA_BURCM RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  76%  513 aa  ATPA_BURA4 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  76%  513 aa  ATPA1_BURTA RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  75%  513 aa  ATPA_BURVG RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  76%  513 aa  ATPA1_BURPS RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  76%  513 aa  ATPA1_BURP6 RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  76%  513 aa  ATPA1_BURP1 RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  76%  513 aa  ATPA1_BURP0 RecName: Full=ATP synthase subunit alpha 1;       
    1::508       0.0  77%  513 aa  ATPA_RALEJ RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA_BURM9 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA1_BURMS RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  75%  513 aa  ATPA1_BURMA RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  75%  513 aa  ATPA1_BURM7 RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  75%  513 aa  ATPA_BURCJ RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  73%  513 aa  ATPA_VESOH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA_BURCH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA_BURCC RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA_BURCA RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  73%  513 aa  ATPA_THICR RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA_BURS3 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  513 aa  ATPA2_BURXL RecName: Full=ATP synthase subunit alpha 2;       
    1::510       0.0  75%  512 aa  ATPA_DECAR RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  512 aa  ATPA_AZOSE RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEAE RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEAB RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEA8 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEA7 RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  512 aa  ATPA_AZOSB RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEMY RecName: Full=ATP synthase subunit alpha;       
    1::510       0.0  76%  515 aa  ATPA_NEIMF RecName: Full=ATP synthase subunit alpha;       
    1::510       0.0  76%  515 aa  ATPA_NEIM0 RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  511 aa  ATPA_HERAR RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  71%  514 aa  ATPA_CELJU RecName: Full=ATP synthase subunit alpha;       
    1::510       0.0  76%  515 aa  ATPA_NEIMB RecName: Full=ATP synthase subunit alpha;       
    1::510       0.0  75%  515 aa  ATPA_NEIMA RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  76%  514 aa  ATPA_CHRVO RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  511 aa  ATPA_JANMA RecName: Full=ATP synthase subunit alpha;       
    1::510       0.0  75%  515 aa  ATPA_NEIG1 RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  72%  515 aa  ATPA_STRMK RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  513 aa  ATPA_BORA1 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEE4 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  72%  513 aa  ATPA_FRAP2 RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  73%  514 aa  ATPA_LARHH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_SHESH RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  75%  513 aa  ATPA_POLNS RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  513 aa  ATPA_BORPD RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEU5 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEPG RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  74%  514 aa  ATPA_PSEF5 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  74%  514 aa  ATPA_PSESM RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  74%  514 aa  ATPA_PSEPW RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_FRATM RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEPK RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  75%  514 aa  ATPA_PSEP1 RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  75%  513 aa  ATPA_POLSQ RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  74%  513 aa  ATPA_NITEU RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  74%  514 aa  ATPA_PSEU2 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  72%  514 aa  ATPA_PSEFS RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  74%  514 aa  ATPA_PSE14 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_FRATN RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  74%  517 aa  ATPA_DELAS RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  74%  514 aa  ATPA_PSEPF RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  513 aa  ATPA1_NITEC RecName: Full=ATP synthase subunit alpha 1;       
    1::515       0.0  72%  515 aa  ATPA_XYLFM RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_FRATT RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_FRAT1 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_FRATW RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  76%  519 aa  ATPA_DIAST RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  76%  519 aa  ATPA_ACISJ RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  71%  515 aa  ATPA_XYLFA RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  75%  512 aa  ATPA_LEPCP RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  72%  514 aa  ATPA2_MARMS RecName: Full=ATP synthase subunit alpha 2;       
    1::513       0.0  73%  513 aa  ATPA1_VIBHB RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  71%  513 aa  ATPA_FRATO RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_FRATH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_FRATF RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  71%  515 aa  ATPA_COXBU RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  71%  515 aa  ATPA_COXBR RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  71%  515 aa  ATPA_COXBN RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  71%  515 aa  ATPA_COXB2 RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  71%  515 aa  ATPA_COXB1 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  72%  513 aa  ATPA_HAEI8 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  73%  513 aa  ATPA_AERS4 RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  513 aa  ATPA_BORPA RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  74%  513 aa  ATPA_BORBR RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  72%  515 aa  ATPA_XANOR RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  72%  515 aa  ATPA_XANOP RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  72%  515 aa  ATPA_XANOM RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  73%  515 aa  ATPA_XANC5 RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  73%  515 aa  ATPA_XANAC RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  73%  513 aa  ATPA_AERHH RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  71%  515 aa  ATPA_XYLFT RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  71%  515 aa  ATPA_XYLF2 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  517 aa  ATPA_POLSJ RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  72%  515 aa  ATPA_XANCP RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  72%  515 aa  ATPA_XANCB RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  72%  515 aa  ATPA_XANC8 RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  75%  519 aa  ATPA_ACIAC RecName: Full=ATP synthase subunit alpha;       
    1::515       0.0  72%  515 aa  ATPA_STRM5 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  74%  517 aa  ATPA1_POLNA RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  70%  513 aa  ATPA_SHEDO RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  72%  513 aa  ATPA_PSEHT RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  73%  513 aa  ATPA_BORPE RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  75%  517 aa  ATPA_METPP RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  72%  513 aa  ATPA2_PSEA6 RecName: Full=ATP synthase subunit alpha 2;       
    1::513       0.0  72%  513 aa  ATPA_HAEDU RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  70%  513 aa  ATPA2_PSYIN RecName: Full=ATP synthase subunit alpha 2;       
    1::513       0.0  72%  513 aa  ATPA1_PHOPR RecName: Full=ATP synthase subunit alpha 1;       
   11::523       0.0  72%  523 aa  ATPA_VIBVY RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  72%  513 aa  ATPA_VIBVU RecName: Full=ATP synthase subunit alpha;       
   11::523       0.0  72%  523 aa  ATPA_VIBPA RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  72%  513 aa  ATPA_VIBAL RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  70%  514 aa  ATPA_PSYA2 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  69%  514 aa  ATPA_PSYCK RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_VIBCH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_VIBC3 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_ALISL RecName: Full=ATP synthase subunit alpha;       
    1::479       0.0  77%  517 aa  ATPA1_RHOFD RecName: Full=ATP synthase subunit alpha 1;       
    1::513       0.0  68%  513 aa  ATPA_PHOLL RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  72%  514 aa  ATPA_ACIBY RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  72%  514 aa  ATPA_ACIBT RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  72%  514 aa  ATPA_ACIBC RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  72%  514 aa  ATPA_ACIB5 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  72%  514 aa  ATPA_ACIB3 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEWM RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ENTS8 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  69%  514 aa  ATPA_ACIF5 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  69%  514 aa  ATPA_ACIF2 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEPW RecName: Full=ATP synthase subunit alpha;       
    1::507       0.0  71%  512 aa  ATPA2_VIBHB RecName: Full=ATP synthase subunit alpha 2;       
    1::507       0.0  72%  513 aa  ATPA_DICNV RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_VIBFM RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_VIBF1 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEHH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ENT38 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEPA RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  69%  514 aa  ATPA_THIFE RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SERP5 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  73%  517 aa  ATPA_VARPS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_SHISS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_SHIFL RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_SHIF8 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_SHIDS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_SHIBS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_SHESW RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_SHEPC RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ESCF3 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOUT RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOSM RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOSE RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOLU RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOLI RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOLC RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOL6 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOL5 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOHS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECODH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECOBW RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO8A RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO81 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO7I RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO5E RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO57 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO55 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO45 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO27 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ECO24 RecName: Full=ATP synthase subunit alpha;       
    3::514       0.0  68%  514 aa  ATPA_PSYWF RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  71%  513 aa  ATPA_TOLAT RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  70%  513 aa  ATPA_PROMH RecName: Full=ATP synthase subunit alpha;       
    8::519       0.0  71%  519 aa  ATPA_ACIAD RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHIB3 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_CITK8 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEB9 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEB8 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEB5 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEB2 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_PECCP RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_KLEP3 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_KLEP7 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERE8 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_ERWCT RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_EDWI9 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALTY RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALTI RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALSV RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALPK RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALPB RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALPA RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALNS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALHS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALG2 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALEP RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALDC RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALA4 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALAR RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEON RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALPC RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SALCH RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHESR RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHESM RecName: Full=ATP synthase subunit alpha;       
    1::495       0.0  74%  537 aa  ATPA_VEREI RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SODGM RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHESA RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERPY RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERPS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERPP RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERPN RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERPG RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERPE RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERPB RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERPA RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_YERP3 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_HAEIN RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_HAEIE RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_HAEIG RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_SHELP RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ACTSZ RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_MANSM RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  70%  513 aa  ATPA_ACTP2 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_HAES2 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_HAES1 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  70%  513 aa  ATPA_ACTP7 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  69%  513 aa  ATPA_ACTPJ RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_ERWT9 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_PASMU RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA2_SHEFN RecName: Full=ATP synthase subunit alpha 2;       
    1::513       0.0  67%  513 aa  ATPA2_PHOPR RecName: Full=ATP synthase subunit alpha 2;       
    1::513       0.0  68%  513 aa  ATPA_HAEPS RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_SHEAM RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  68%  513 aa  ATPA_COLP3 RecName: Full=ATP synthase subunit alpha;       
    1::513       0.0  64%  513 aa  ATPA_BLOPB RecName: Full=ATP synthase subunit alpha;       
    1::510       0.0  65%  510 aa  ATPA_BUCAP RecName: Full=ATP synthase subunit alpha;       
    1::509       0.0  64%  513 aa  ATPA_BAUCH RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  64%  513 aa  ATPA_BLOFL RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  63%  512 aa  ATPA_BUCAI RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  63%  512 aa  ATPA_BUCA5 RecName: Full=ATP synthase subunit alpha;       
    1::508       0.0  62%  512 aa  ATPA_BUCAT RecName: Full=ATP synthase subunit alpha;       
    1::499     e-179  64%  501 aa  ATPA_DESRM RecName: Full=ATP synthase subunit alpha;       
    1::499     e-178  64%  502 aa  ATPA_HELMI RecName: Full=ATP synthase subunit alpha;       
    1::499     e-178  61%  501 aa  ATPA_CARHZ RecName: Full=ATP synthase subunit alpha;       
    1::495     e-174  62%  506 aa  ATPA_SYMTH RecName: Full=ATP synthase subunit alpha;       
    1::513     e-174  59%  514 aa  ATPA_BUCBP RecName: Full=ATP synthase subunit alpha;       
    1::504     e-173  62%  509 aa  ATPA_ZYMMO RecName: Full=ATP synthase subunit alpha;       
    1::508     e-173  58%  510 aa  ATPA_WIGBR RecName: Full=ATP synthase subunit alpha;       
    1::502     e-173  62%  507 aa  ATPA_MOOTA RecName: Full=ATP synthase subunit alpha;       
    1::497     e-173  61%  502 aa  ATPA_CLOPH RecName: Full=ATP synthase subunit alpha;       
    1::501     e-172  61%  505 aa  ATPA_SULDN RecName: Full=ATP synthase subunit alpha;       
    1::497     e-172  61%  502 aa  ATPA_GEOLS RecName: Full=ATP synthase subunit alpha;       
    7::498     e-172  60%  503 aa  ATPA_DEHE1 RecName: Full=ATP synthase subunit alpha;       
    1::504     e-172  61%  509 aa  ATPA_ERYLH RecName: Full=ATP synthase subunit alpha;       
    1::497     e-171  60%  502 aa  ATPA_PELPD RecName: Full=ATP synthase subunit alpha;       
    7::498     e-171  59%  503 aa  ATPA_DEHSC RecName: Full=ATP synthase subunit alpha;       
    7::498     e-171  59%  503 aa  ATPA_DEHSB RecName: Full=ATP synthase subunit alpha;       
   19::497     e-171  63%  502 aa  ATPA_DESHD RecName: Full=ATP synthase subunit alpha;       
    1::501     e-170  61%  505 aa  ATPA_NITSB RecName: Full=ATP synthase subunit alpha;       
   19::497     e-170  63%  502 aa  ATPA_DESHY RecName: Full=ATP synthase subunit alpha;       
    4::498     e-170  60%  512 aa  ATPA_SOLUE RecName: Full=ATP synthase subunit alpha;       
    1::497     e-170  61%  502 aa  ATPA_GEOBB RecName: Full=ATP synthase subunit alpha;       
    1::501     e-170  60%  504 aa  ATPA_SYNWW RecName: Full=ATP synthase subunit alpha;       
    1::497     e-169  60%  502 aa  ATPA_GEOSM RecName: Full=ATP synthase subunit alpha;       
    4::497     e-169  60%  504 aa  ATPA1_SYNAS RecName: Full=ATP synthase subunit alpha 1;       
   19::497     e-168  62%  505 aa  ATPA_ALKOO RecName: Full=ATP synthase subunit alpha;       
   19::496     e-168  62%  502 aa  ATPA1_PELCD RecName: Full=ATP synthase subunit alpha 1;       
    1::501     e-168  60%  505 aa  ATPA_CAMFF RecName: Full=ATP synthase subunit alpha;       
    1::495     e-168  61%  502 aa  ATPA_BACHD RecName: Full=ATP synthase subunit alpha;       
    1::501     e-167  59%  505 aa  ATPA_CAMC5 RecName: Full=ATP synthase subunit alpha;       
    1::504     e-167  61%  509 aa  ATPA_NOVAD RecName: Full=ATP synthase subunit alpha;       
    1::516     e-167  58%  526 aa  ATPA_CHLPD RecName: Full=ATP synthase subunit alpha;       
    1::497     e-166  59%  504 aa  ATPA_CLOK1 RecName: Full=ATP synthase subunit alpha;       
    1::501     e-166  59%  504 aa  ATPA_SULNB RecName: Full=ATP synthase subunit alpha;       
    1::501     e-166  59%  505 aa  ATPA_CAMC1 RecName: Full=ATP synthase subunit alpha;       
    1::500     e-166  58%  501 aa  ATPA_CAMJJ RecName: Full=ATP synthase subunit alpha;       
    1::496     e-166  59%  500 aa  ATPA_WOLSU RecName: Full=ATP synthase subunit alpha;       
    1::500     e-166  58%  501 aa  ATPA_CAMJR RecName: Full=ATP synthase subunit alpha;       
    1::500     e-166  58%  501 aa  ATPA_CAMJE RecName: Full=ATP synthase subunit alpha;       
    1::500     e-166  58%  501 aa  ATPA_CAMJ8 RecName: Full=ATP synthase subunit alpha;       
    1::519     e-166  58%  526 aa  ATPA2_PELLD RecName: Full=ATP synthase subunit alpha 2;       
    1::500     e-166  58%  501 aa  ATPA_CAMJD RecName: Full=ATP synthase subunit alpha;       
    1::497     e-166  60%  502 aa  ATPA_BACLD RecName: Full=ATP synthase subunit alpha;       
    1::497     e-166  59%  502 aa  ATPA_KOSOT RecName: Full=ATP synthase subunit alpha;       
    8::496     e-166  60%  503 aa  ATPA_BREBN RecName: Full=ATP synthase subunit alpha;       
    1::497     e-166  58%  504 aa  ATPA_CLOK5 RecName: Full=ATP synthase subunit alpha;       
    1::519     e-165  57%  526 aa  ATPA_CHLPB RecName: Full=ATP synthase subunit alpha;       
    1::467     e-165  63%  505 aa  ATPA_SYNFM RecName: Full=ATP synthase subunit alpha;       
    1::499     e-165  59%  507 aa  ATPA_THEM4 RecName: Full=ATP synthase subunit alpha;       
    1::499     e-165  60%  504 aa  ATPA_PETMO RecName: Full=ATP synthase subunit alpha;       
    1::497     e-165  58%  502 aa  ATPA_CLONN RecName: Full=ATP synthase subunit alpha;       
    1::516     e-165  57%  526 aa  ATPA_CHLTE RecName: Full=ATP synthase subunit alpha;       
    4::502     e-165  60%  507 aa  ATPA_ANOFW RecName: Full=ATP synthase subunit alpha;       
    1::497     e-165  60%  503 aa  ATPA_OCEIH RecName: Full=ATP synthase subunit alpha;       
   14::498     e-165  61%  503 aa  ATPA_GEOMG RecName: Full=ATP synthase subunit alpha;       
    1::500     e-165  58%  505 aa  ATPA_ARCB4 RecName: Full=ATP synthase subunit alpha;       
    1::499     e-165  59%  507 aa  ATPA_THEAB RecName: Full=ATP synthase subunit alpha;       
    1::503     e-165  60%  505 aa  ATPA_DESOH RecName: Full=ATP synthase subunit alpha;       
    1::497     e-165  58%  504 aa  ATPA_CLOBJ RecName: Full=ATP synthase subunit alpha;       
    1::497     e-165  58%  504 aa  ATPA_CLOBH RecName: Full=ATP synthase subunit alpha;       
    1::497     e-165  58%  504 aa  ATPA_CLOB6 RecName: Full=ATP synthase subunit alpha;       
    1::497     e-165  58%  504 aa  ATPA_CLOB1 RecName: Full=ATP synthase subunit alpha;       
    1::483     e-164  59%  506 aa  ATPA_PELTS RecName: Full=ATP synthase subunit alpha;       
    1::497     e-164  59%  502 aa  ATPA_GEOTN RecName: Full=ATP synthase subunit alpha;       
    1::516     e-164  58%  526 aa  ATPA_CHLL2 RecName: Full=ATP synthase subunit alpha;       
    3::501     e-164  58%  526 aa  ATPA_RUBXD RecName: Full=ATP synthase subunit alpha;       
    1::498     e-164  59%  507 aa  ATPA_FERNB RecName: Full=ATP synthase subunit alpha;       
    1::497     e-164  58%  504 aa  ATPA_CLOBM RecName: Full=ATP synthase subunit alpha;       
    1::497     e-164  58%  504 aa  ATPA_CLOBK RecName: Full=ATP synthase subunit alpha;       
    1::518     e-164  58%  526 aa  ATPA_PELPB RecName: Full=ATP synthase subunit alpha;       
    4::496     e-164  60%  504 aa  ATPA_BACSK RecName: Full=ATP synthase subunit alpha;       
    4::499     e-164  59%  504 aa  ATPA_SULSY RecName: Full=ATP synthase subunit alpha;       
    1::508     e-164  59%  510 aa  ATPA_RHOPS RecName: Full=ATP synthase subunit alpha;       
   14::497     e-164  60%  502 aa  ATPA_GEOSF RecName: Full=ATP synthase subunit alpha;       
    1::497     e-164  59%  502 aa  ATPA_BACA2 RecName: Full=ATP synthase subunit alpha;       
    1::497     e-164  59%  502 aa  ATPA_GEOKA RecName: Full=ATP synthase subunit alpha;       
    1::497     e-164  59%  502 aa  ATPA_BACSU RecName: Full=ATP synthase subunit alpha;       
    1::504     e-164  60%  509 aa  ATPA_SPHAL RecName: Full=ATP synthase subunit alpha;       
    1::497     e-164  58%  504 aa  ATPA_CLOBL RecName: Full=ATP synthase subunit alpha;       
    1::507     e-163  59%  509 aa  ATPA_MAGSA RecName: Full=ATP synthase subunit alpha;       
   13::511     e-163  61%  527 aa  ATPA_ROSS1 RecName: Full=ATP synthase subunit alpha;       
   14::472     e-163  63%  502 aa  ATPA_GEOUR RecName: Full=ATP synthase subunit alpha;       
    1::497     e-163  59%  502 aa  ATPA_DESDA RecName: Full=ATP synthase subunit alpha;       
    1::507     e-163  58%  509 aa  ATPA_BRASO RecName: Full=ATP synthase subunit alpha;       
    1::497     e-163  59%  502 aa  ATPA_BACP2 RecName: Full=ATP synthase subunit alpha;       
    8::498     e-163  58%  506 aa  ATPA_SYNJA RecName: Full=ATP synthase subunit alpha;       
    1::497     e-163  57%  505 aa  ATPA_CLOAB RecName: Full=ATP synthase subunit alpha;       
    1::508     e-163  58%  510 aa  ATPA_RHOPB RecName: Full=ATP synthase subunit alpha;       
    1::504     e-163  58%  509 aa  ATPA_PARL1 RecName: Full=ATP synthase subunit alpha;       
    1::508     e-163  58%  510 aa  ATPA_NITHX RecName: Full=ATP synthase subunit alpha;       
    1::497     e-163  59%  502 aa  ATPA_GEOSW RecName: Full=ATP synthase subunit alpha;       
   19::497     e-163  60%  502 aa  ATPA_DESMR RecName: Full=ATP synthase subunit alpha;       
    1::497     e-163  59%  502 aa  ATPA_BACME RecName: Full=ATP synthase subunit alpha;       
    1::501     e-163  58%  505 aa  ATPA_CAMHC RecName: Full=ATP synthase subunit alpha;       
    1::498     e-163  56%  507 aa  ATPA2_RHOBA RecName: Full=ATP synthase subunit alpha 2;       
    1::508     e-162  58%  510 aa  ATPA_RHOP2 RecName: Full=ATP synthase subunit alpha;       
    1::507     e-162  58%  509 aa  ATPA_BRASB RecName: Full=ATP synthase subunit alpha;       
    1::504     e-162  58%  509 aa  ATPA_RHISN RecName: Full=ATP synthase subunit alpha;       
   14::476     e-162  63%  503 aa  ATPA_GEOSL RecName: Full=ATP synthase subunit alpha;       
    1::519     e-162  57%  526 aa  ATPA_CHLCH RecName: Full=ATP synthase subunit alpha;       
    1::504     e-162  59%  509 aa  ATPA_SINMW RecName: Full=ATP synthase subunit alpha;       
    3::507     e-162  60%  509 aa  ATPA_RHOCA RecName: Full=ATP synthase subunit alpha;       
    1::504     e-162  58%  509 aa  ATPA_METNO RecName: Full=ATP synthase subunit alpha;       
    3::510     e-162  59%  512 aa  ATPA2_DINSH RecName: Full=ATP synthase subunit alpha 2;       
    8::498     e-162  57%  506 aa  ATPA_SYNJB RecName: Full=ATP synthase subunit alpha;       
    1::495     e-162  60%  503 aa  ATPA_STAES RecName: Full=ATP synthase subunit alpha;       
    1::495     e-162  60%  503 aa  ATPA_STAEQ RecName: Full=ATP synthase subunit alpha;       
    1::496     e-162  58%  500 aa  ATPA_FUSNN RecName: Full=ATP synthase subunit alpha;       
    1::497     e-162  59%  502 aa  ATPA_EXISA RecName: Full=ATP synthase subunit alpha;       
    1::497     e-161  57%  508 aa  ATPA_NATTJ RecName: Full=ATP synthase subunit alpha;       
    1::503     e-161  58%  509 aa  ATPA_METPB RecName: Full=ATP synthase subunit alpha;       
   24::497     e-161  60%  502 aa  ATPA_DESDG RecName: Full=ATP synthase subunit alpha;       
    1::497     e-161  59%  502 aa  ATPA_BACST RecName: Full=ATP synthase subunit alpha;       
    1::504     e-161  59%  510 aa  ATPA_METRJ RecName: Full=ATP synthase subunit alpha;       
    1::504     e-161  58%  509 aa  ATPA_METS4 RecName: Full=ATP synthase subunit alpha;       
    3::498     e-161  58%  512 aa  ATPA_ACIBL RecName: Full=ATP synthase subunit alpha;       
    1::500     e-161  58%  503 aa  ATPA_THESQ RecName: Full=ATP synthase subunit alpha;       
    1::500     e-161  58%  503 aa  ATPA_THEP1 RecName: Full=ATP synthase subunit alpha;       
    1::500     e-161  58%  503 aa  ATPA_THEMA RecName: Full=ATP synthase subunit alpha;       
    1::504     e-161  58%  509 aa  ATPA_RHIME RecName: Full=ATP synthase subunit alpha;       
    1::508     e-161  57%  510 aa  ATPA_RHOPA RecName: Full=ATP synthase subunit alpha;       
    1::508     e-161  58%  510 aa  ATPA_RHOP5 RecName: Full=ATP synthase subunit alpha;       
   14::523     e-161  60%  526 aa  ATPA_ROSCS RecName: Full=ATP synthase subunit alpha;       
    1::504     e-161  58%  509 aa  ATPA_RHIEC RecName: Full=ATP synthase subunit alpha;       
   20::500     e-161  60%  503 aa  ATPA_HELPY RecName: Full=ATP synthase subunit alpha;       
   20::500     e-161  59%  503 aa  ATPA_HELPH RecName: Full=ATP synthase subunit alpha;       
   20::500     e-161  60%  503 aa  ATPA_HELP2 RecName: Full=ATP synthase subunit alpha;       
   19::496     e-161  60%  505 aa  ATPA_DESAA RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAAW RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAAT RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAAS RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAAR RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAAN RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAAM RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAAB RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAA9 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAA8 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAA3 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAA2 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-161  59%  502 aa  ATPA_STAA1 RecName: Full=ATP synthase subunit alpha;       
    1::507     e-161  59%  512 aa  ATPA_JANSC RecName: Full=ATP synthase subunit alpha;       
   20::500     e-161  60%  503 aa  ATPA_HELPS RecName: Full=ATP synthase subunit alpha;       
   20::500     e-161  59%  503 aa  ATPA_HELPG RecName: Full=ATP synthase subunit alpha;       
    1::503     e-161  57%  508 aa  ATPA_AGRVS RecName: Full=ATP synthase subunit alpha;       
    1::504     e-161  58%  509 aa  ATPA_AGRT5 RecName: Full=ATP synthase subunit alpha;       
    3::507     e-161  60%  512 aa  ATPA_ROSDO RecName: Full=ATP synthase subunit alpha;       
    1::497     e-161  59%  502 aa  ATPA_BACP3 RecName: Full=ATP synthase subunit alpha;       
    1::496     e-161  57%  500 aa  ATPA_PROMO RecName: Full=ATP synthase subunit alpha, sodium ion
    1::508     e-161  57%  510 aa  ATPA_OLICO RecName: Full=ATP synthase subunit alpha;       
    3::510     e-160  59%  512 aa  ATPA_SILPO RecName: Full=ATP synthase subunit alpha;       
    1::504     e-160  58%  510 aa  ATPA_RICFE RecName: Full=ATP synthase subunit alpha;       
    1::504     e-160  58%  509 aa  ATPA_RHILW RecName: Full=ATP synthase subunit alpha;       
    1::504     e-160  58%  509 aa  ATPA_RHIE6 RecName: Full=ATP synthase subunit alpha;       
   20::500     e-160  60%  503 aa  ATPA_HELPJ RecName: Full=ATP synthase subunit alpha;       
    1::504     e-160  57%  509 aa  ATPA_BRAJA RecName: Full=ATP synthase subunit alpha;       
    1::530     e-160  58%  537 aa  ATPA_CHLT3 RecName: Full=ATP synthase subunit alpha;       
   19::497     e-160  60%  505 aa  ATPA_ALKMQ RecName: Full=ATP synthase subunit alpha;       
    1::495     e-160  59%  502 aa  ATPA_STAAE RecName: Full=ATP synthase subunit alpha;       
    1::495     e-160  59%  502 aa  ATPA_STAAC RecName: Full=ATP synthase subunit alpha;       
    1::498     e-160  58%  503 aa  ATPA_THENN RecName: Full=ATP synthase subunit alpha;       
    1::506     e-160  59%  511 aa  ATPA_PELUB RecName: Full=ATP synthase subunit alpha;       
    1::498     e-160  56%  541 aa  ATPA_HALOH RecName: Full=ATP synthase subunit alpha;       
    1::504     e-160  58%  509 aa  ATPA_RHIL3 RecName: Full=ATP synthase subunit alpha;       
    8::500     e-160  58%  505 aa  ATPA_TRIEI RecName: Full=ATP synthase subunit alpha;       
    1::508     e-160  57%  510 aa  ATPA_NITWN RecName: Full=ATP synthase subunit alpha;       
    1::498     e-160  58%  511 aa  ATPA_LACSS RecName: Full=ATP synthase subunit alpha;       
    1::495     e-160  58%  502 aa  ATPA_STAHJ RecName: Full=ATP synthase subunit alpha;       
    1::519     e-160  57%  526 aa  ATPA_PROVI RecName: Full=ATP synthase subunit alpha;       
   49::547     e-160  60%  553 aa  ATPA_BOVIN RecName: Full=ATP synthase subunit alpha,
    1::504     e-160  57%  510 aa  ATPA_RICM5 RecName: Full=ATP synthase subunit alpha;       
    1::504     e-160  57%  510 aa  ATPA_RICCN RecName: Full=ATP synthase subunit alpha;       
    1::504     e-160  58%  512 aa  ATPA_RICAH RecName: Full=ATP synthase subunit alpha;       
   24::497     e-160  59%  502 aa  ATPA_DESVM RecName: Full=ATP synthase subunit alpha;       
    3::507     e-160  59%  512 aa  ATPA_RHOSK RecName: Full=ATP synthase subunit alpha;       
    3::507     e-160  59%  512 aa  ATPA_RHOS4 RecName: Full=ATP synthase subunit alpha;       
    1::497     e-160  59%  502 aa  ATPA_EXIS2 RecName: Full=ATP synthase subunit alpha;       
    3::507     e-160  59%  512 aa  ATPA1_RHOS1 RecName: Full=ATP synthase subunit alpha 1;       
    1::504     e-159  57%  510 aa  ATPA_RICRS RecName: Full=ATP synthase subunit alpha;       
    1::504     e-159  57%  510 aa  ATPA_RICRO RecName: Full=ATP synthase subunit alpha;       
    3::507     e-159  59%  512 aa  ATPA_RHOS5 RecName: Full=ATP synthase subunit alpha;       
    1::502     e-159  57%  509 aa  ATPA_METEP RecName: Full=ATP synthase subunit alpha;       
    1::502     e-159  57%  509 aa  ATPA_METC4 RecName: Full=ATP synthase subunit alpha;       
   20::500     e-159  62%  503 aa  ATPA_HELAH RecName: Full=ATP synthase subunit alpha;       
    1::507     e-159  60%  509 aa  ATPA_SPHWW RecName: Full=ATP synthase subunit alpha;       
    1::494     e-159  59%  518 aa  ATPA_ENTFA RecName: Full=ATP synthase subunit alpha;       
    1::495     e-159  59%  503 aa  ATPA_STAS1 RecName: Full=ATP synthase subunit alpha;       
    1::505     e-159  58%  510 aa  ATPA_RHORU RecName: Full=ATP synthase subunit alpha;       
    1::505     e-159  58%  510 aa  ATPA_RHORT RecName: Full=ATP synthase subunit alpha;       
    8::510     e-159  58%  513 aa  ATPA_GLOVI RecName: Full=ATP synthase subunit alpha;       
    1::504     e-159  57%  510 aa  ATPA_RICPU RecName: Full=ATP synthase subunit alpha;       
    2::498     e-159  58%  503 aa  ATPA_GRATL RecName: Full=ATP synthase subunit alpha, chloroplastic;
   29::497     e-159  59%  504 aa  ATPA_CLOBB RecName: Full=ATP synthase subunit alpha;       
   29::497     e-159  59%  504 aa  ATPA_CLOBA RecName: Full=ATP synthase subunit alpha;       
   29::497     e-159  59%  504 aa  ATPA_CLOB8 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-158  60%  501 aa  ATPA_STRA5 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-158  60%  501 aa  ATPA_STRA1 RecName: Full=ATP synthase subunit alpha;       
    4::497     e-158  58%  506 aa  ATPA_LACGA RecName: Full=ATP synthase subunit alpha;       
    2::495     e-158  57%  504 aa  ATPA_JASNU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::495     e-158  58%  502 aa  ATPA_BACPF RecName: Full=ATP synthase subunit alpha;       
   21::501     e-158  58%  506 aa  ATPA_ANASP RecName: Full=ATP synthase subunit alpha;       
   49::547     e-158  59%  553 aa  ATPA_MOUSE RecName: Full=ATP synthase subunit alpha,
    1::495     e-158  59%  501 aa  ATPA_STRA3 RecName: Full=ATP synthase subunit alpha;       
   49::547     e-158  59%  553 aa  ATPA_RAT RecName: Full=ATP synthase subunit alpha,
   48::545     e-158  57%  551 aa  ATPA_NEUCR RecName: Full=ATP synthase subunit alpha,
    1::499     e-158  56%  506 aa  ATPA_LAWIP RecName: Full=ATP synthase subunit alpha;       
   24::497     e-158  59%  502 aa  ATPA_DESVV RecName: Full=ATP synthase subunit alpha;       
   24::497     e-158  59%  502 aa  ATPA_DESVH RecName: Full=ATP synthase subunit alpha;       
    1::499     e-158  56%  507 aa  ATPA_DESPS RecName: Full=ATP synthase subunit alpha;       
    3::509     e-158  59%  511 aa  ATPA_PARDP RecName: Full=ATP synthase subunit alpha;       
    1::478     e-158  59%  502 aa  ATPA_BACCN RecName: Full=ATP synthase subunit alpha;       
    3::486     e-158  60%  513 aa  ATPA_SILST RecName: Full=ATP synthase subunit alpha;       
   49::547     e-158  59%  553 aa  ATPA_PONAB RecName: Full=ATP synthase subunit alpha,
    3::497     e-158  57%  502 aa  ATPA_LYSSC RecName: Full=ATP synthase subunit alpha;       
    1::497     e-158  58%  509 aa  ATPA_LACRJ RecName: Full=ATP synthase subunit alpha;       
    1::497     e-158  58%  509 aa  ATPA_LACRD RecName: Full=ATP synthase subunit alpha;       
    1::494     e-158  58%  503 aa  ATPA_LACJO RecName: Full=ATP synthase subunit alpha;       
    1::506     e-158  58%  511 aa  ATPA_HYPNA RecName: Full=ATP synthase subunit alpha;       
    8::498     e-158  57%  502 aa  ATPA_GUITH RecName: Full=ATP synthase subunit alpha, chloroplastic;
    2::498     e-158  57%  499 aa  ATPA_EMIHU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::497     e-157  57%  503 aa  ATPA_THELT RecName: Full=ATP synthase subunit alpha;       
    8::498     e-157  57%  502 aa  ATPA_RHDSA RecName: Full=ATP synthase subunit alpha, chloroplastic;
   49::547     e-157  59%  553 aa  ATPA_PANTR RecName: Full=ATP synthase subunit alpha,
   49::547     e-157  59%  553 aa  ATPA_HUMAN RecName: Full=ATP synthase subunit alpha,
    1::506     e-157  57%  511 aa  ATPA_BARBK RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACHK RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACCZ RecName: Full=ATP synthase subunit alpha;       
    4::481     e-157  59%  505 aa  ATPA_BACCR RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACCQ RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACC7 RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACC3 RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACC1 RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACC0 RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACAN RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACAH RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACAC RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACAA RecName: Full=ATP synthase subunit alpha;       
    1::504     e-157  58%  509 aa  ATPA_XANP2 RecName: Full=ATP synthase subunit alpha;       
    2::498     e-157  57%  504 aa  ATPA_OSTTA RecName: Full=ATP synthase subunit alpha, chloroplastic;
   23::516     e-157  61%  517 aa  ATPA_HERA2 RecName: Full=ATP synthase subunit alpha;       
    1::496     e-157  56%  500 aa  ATPA_CLOD6 RecName: Full=ATP synthase subunit alpha;       
    4::498     e-157  57%  507 aa  ATPA_MANES RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::495     e-157  57%  518 aa  ATPA_ENTHR RecName: Full=ATP synthase subunit alpha;       
    1::506     e-157  57%  511 aa  ATPA_BART1 RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACC4 RecName: Full=ATP synthase subunit alpha;       
    1::478     e-157  59%  502 aa  ATPA_BACC2 RecName: Full=ATP synthase subunit alpha;       
    2::498     e-157  56%  506 aa  ATPA_CHLAT RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::506     e-157  57%  511 aa  ATPA_BARQU RecName: Full=ATP synthase subunit alpha;       
    1::510     e-157  58%  511 aa  ATPA_BARHE RecName: Full=ATP synthase subunit alpha;       
    1::499     e-157  56%  502 aa  ATPA_THEYD RecName: Full=ATP synthase subunit alpha;       
    1::497     e-157  59%  499 aa  ATPA_BRAHW RecName: Full=ATP synthase subunit alpha;       
    1::495     e-157  58%  503 aa  ATPA_MACCJ RecName: Full=ATP synthase subunit alpha;       
   17::499     e-157  58%  504 aa  ATPA_HELHP RecName: Full=ATP synthase subunit alpha;       
   23::476     e-156  60%  505 aa  ATPA_SYNP6 RecName: Full=ATP synthase subunit alpha;       
   23::476     e-156  60%  505 aa  ATPA_SYNE7 RecName: Full=ATP synthase subunit alpha;       
    1::478     e-156  59%  502 aa  ATPA_BACWK RecName: Full=ATP synthase subunit alpha;       
    8::500     e-156  57%  506 aa  ATPA_SYNS9 RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  59%  509 aa  ATPA_BRUSI RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  59%  509 aa  ATPA_BRUME RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  59%  509 aa  ATPA_BRUMB RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  59%  509 aa  ATPA_BRUC2 RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  59%  509 aa  ATPA_BRUAB RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  59%  509 aa  ATPA_BRUA2 RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  59%  509 aa  ATPA_BRUA1 RecName: Full=ATP synthase subunit alpha;       
    1::504     e-156  57%  512 aa  ATPA_RICB8 RecName: Full=ATP synthase subunit alpha;       
    2::505     e-156  56%  505 aa  ATPA_PHATR RecName: Full=ATP synthase subunit alpha, chloroplastic;
   20::500     e-156  57%  505 aa  ATPA_CYAP4 RecName: Full=ATP synthase subunit alpha;       
    1::497     e-156  56%  502 aa  ATPA_CLOPS RecName: Full=ATP synthase subunit alpha;       
    7::521     e-156  59%  522 aa  ATPA_CHLAA RecName: Full=ATP synthase subunit alpha;       
    8::495     e-156  57%  505 aa  ATPA_ZYGCR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::499     e-156  57%  503 aa  ATPA_LACAC RecName: Full=ATP synthase subunit alpha;       
   19::497     e-156  57%  507 aa  ATPA_DESAP RecName: Full=ATP synthase subunit alpha;       
    1::497     e-156  56%  502 aa  ATPA_CLOPE RecName: Full=ATP synthase subunit alpha;       
    1::497     e-156  56%  502 aa  ATPA_CLOP1 RecName: Full=ATP synthase subunit alpha;       
    9::521     e-156  58%  522 aa  ATPA_CHLAD RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  58%  509 aa  ATPA_BRUSU RecName: Full=ATP synthase subunit alpha;       
    1::500     e-156  55%  512 aa  ATPA_ELUMP RecName: Full=ATP synthase subunit alpha;       
    1::483     e-156  58%  509 aa  ATPA_BRUO2 RecName: Full=ATP synthase subunit alpha;       
    1::503     e-156  57%  512 aa  ATPA_ANADF RecName: Full=ATP synthase subunit alpha;       
   19::497     e-156  58%  504 aa  ATPA2_LISMF RecName: Full=ATP synthase subunit alpha 2;       
   19::497     e-156  58%  504 aa  ATPA2_LISIN RecName: Full=ATP synthase subunit alpha 2;       
    8::498     e-155  58%  505 aa  ATPA_ANTSP RecName: Full=ATP synthase subunit alpha, chloroplastic;
   21::468     e-155  61%  506 aa  ATPA_ANAVT RecName: Full=ATP synthase subunit alpha;       
   19::497     e-155  58%  504 aa  ATPA2_LISMO RecName: Full=ATP synthase subunit alpha 2;       
    1::503     e-155  58%  515 aa  ATPA_MYXXD RecName: Full=ATP synthase subunit alpha;       
    1::503     e-155  58%  515 aa  ATPA_MYXXA RecName: Full=ATP synthase subunit alpha;       
   21::468     e-155  61%  506 aa  ATPA_NOSP7 RecName: Full=ATP synthase subunit alpha;       
    1::478     e-155  57%  507 aa  ATPA_BDEBA RecName: Full=ATP synthase subunit alpha;       
    8::495     e-155  57%  512 aa  ATPA_STAPU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::509     e-155  58%  510 aa  ATPA_PHEZH RecName: Full=ATP synthase subunit alpha;       
   47::547     e-155  56%  548 aa  ATPA_KLULA RecName: Full=ATP synthase subunit alpha,
    4::495     e-155  56%  507 aa  ATPA_DRANE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    2::497     e-155  55%  512 aa  ATPA_CHAGL RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::502     e-155  56%  510 aa  ATPA_ANADE RecName: Full=ATP synthase subunit alpha;       
   10::499     e-155  55%  502 aa  ATPA_HYDS0 RecName: Full=ATP synthase subunit alpha;       
    4::495     e-155  56%  507 aa  ATPA_ARATH RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::498     e-155  59%  534 aa  ATPA_ACIC5 RecName: Full=ATP synthase subunit alpha;       
    8::497     e-155  57%  507 aa  ATPA_SCEOB RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::498     e-155  57%  504 aa  ATPA_PORYE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    7::475     e-155  59%  506 aa  ATPA_THETN RecName: Full=ATP synthase subunit alpha;       
    1::504     e-155  57%  512 aa  ATPA_RICPR RecName: Full=ATP synthase subunit alpha;       
    3::503     e-155  58%  513 aa  ATPAM_MARPO RecName: Full=ATP synthase subunit alpha,
   19::497     e-155  58%  504 aa  ATPA2_LISW6 RecName: Full=ATP synthase subunit alpha 2;       
    8::500     e-154  56%  506 aa  ATPA_SYNS3 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-154  58%  501 aa  ATPA_STRTD RecName: Full=ATP synthase subunit alpha;       
    1::495     e-154  58%  501 aa  ATPA_STRT2 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-154  58%  501 aa  ATPA_STRT1 RecName: Full=ATP synthase subunit alpha;       
   35::532     e-154  56%  536 aa  ATPA_SCHPO RecName: Full=ATP synthase subunit alpha,
    1::504     e-154  58%  512 aa  ATPA_RICCK RecName: Full=ATP synthase subunit alpha;       
    1::500     e-154  56%  500 aa  ATPA_LACLM RecName: Full=ATP synthase subunit alpha;       
    1::495     e-154  58%  512 aa  ATPA_LACF3 RecName: Full=ATP synthase subunit alpha;       
    1::494     e-154  56%  503 aa  ATPA_LACH4 RecName: Full=ATP synthase subunit alpha;       
    1::505     e-154  56%  510 aa  ATPA_MARMM RecName: Full=ATP synthase subunit alpha;       
    2::505     e-154  55%  507 aa  ATPA_EHRRW RecName: Full=ATP synthase subunit alpha;       
    2::505     e-154  55%  507 aa  ATPA_EHRRG RecName: Full=ATP synthase subunit alpha;       
    1::505     e-154  57%  510 aa  ATPA_AZOC5 RecName: Full=ATP synthase subunit alpha;       
    1::502     e-154  56%  510 aa  ATPA_ANAD2 RecName: Full=ATP synthase subunit alpha;       
   30::498     e-154  58%  503 aa  ATPA_SYNP1 RecName: Full=ATP synthase subunit alpha;       
    4::495     e-154  56%  507 aa  ATPA_PELHO RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::511     e-154  59%  512 aa  ATPA_RHOBL RecName: Full=ATP synthase subunit alpha;       
    8::498     e-154  57%  504 aa  ATPA_PORPU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::500     e-154  54%  508 aa  ATPA_PARUW RecName: Full=ATP synthase subunit alpha;       
    1::501     e-154  55%  509 aa  ATPA_LACCB RecName: Full=ATP synthase subunit alpha;       
    1::501     e-154  55%  509 aa  ATPA_LACC3 RecName: Full=ATP synthase subunit alpha;       
    2::498     e-153  54%  506 aa  ATPA_EUGGR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::501     e-153  55%  505 aa  ATPA_PEDPA RecName: Full=ATP synthase subunit alpha;       
    1::502     e-153  56%  510 aa  ATPA_ANASK RecName: Full=ATP synthase subunit alpha;       
    1::500     e-153  57%  501 aa  ATPA_STRS7 RecName: Full=ATP synthase subunit alpha;       
    1::500     e-153  57%  501 aa  ATPA_STREM RecName: Full=ATP synthase subunit alpha;       
   47::549     e-153  57%  552 aa  ATPA_DROME RecName: Full=ATP synthase subunit alpha,
   30::498     e-153  58%  503 aa  ATPA_CYAP8 RecName: Full=ATP synthase subunit alpha;       
    2::519     e-153  56%  532 aa  ATPA_AMOA5 RecName: Full=ATP synthase subunit alpha;       
   20::498     e-153  57%  503 aa  ATPA_CYAP7 RecName: Full=ATP synthase subunit alpha;       
    8::503     e-153  56%  508 aa  ATPA_CHLRE RecName: Full=ATP synthase subunit alpha, chloroplastic;
   30::494     e-153  58%  498 aa  ATPA_OLTVI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::508     e-153  56%  510 aa  ATPA_CAUSK RecName: Full=ATP synthase subunit alpha;       
   32::535     e-153  57%  538 aa  ATPA_CAEEL RecName: Full=ATP synthase subunit alpha,
    1::504     e-153  56%  509 aa  ATPA_MESSB RecName: Full=ATP synthase subunit alpha;       
    1::502     e-153  58%  509 aa  ATPAM_ORYSJ RecName: Full=ATP synthase subunit alpha,
    1::502     e-153  58%  509 aa  ATPAM_ORYSI RecName: Full=ATP synthase subunit alpha,
    1::502     e-153  58%  509 aa  ATPAM_ORYSA RecName: Full=ATP synthase subunit alpha,
    8::500     e-153  56%  505 aa  ATPA_GALSU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::516     e-153  56%  525 aa  ATPA_FLAJ1 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRPZ RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRPM RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  501 aa  ATPA_STRPG RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRPF RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  501 aa  ATPA_STRPD RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRPC RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRPB RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRP8 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRP6 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRP3 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-153  58%  502 aa  ATPA_STRP1 RecName: Full=ATP synthase subunit alpha;       
    1::507     e-152  55%  509 aa  ATPA_RHILO RecName: Full=ATP synthase subunit alpha;       
   50::542     e-152  59%  545 aa  ATPA_XENLA RecName: Full=ATP synthase subunit alpha,
   20::498     e-152  57%  503 aa  ATPA_THAPS RecName: Full=ATP synthase subunit alpha, chloroplastic;
    2::499     e-152  55%  501 aa  ATPA_NEPOL RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::509     e-152  55%  509 aa  ATPA_EHRCJ RecName: Full=ATP synthase subunit alpha;       
    1::508     e-152  56%  510 aa  ATPA_ACICJ RecName: Full=ATP synthase subunit alpha;       
    2::494     e-152  55%  502 aa  ATPA_PSEAK RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::504     e-152  55%  509 aa  ATPA_METSB RecName: Full=ATP synthase subunit alpha;       
    3::526     e-152  56%  526 aa  ATPA_GRAFK RecName: Full=ATP synthase subunit alpha;       
    1::508     e-152  56%  510 aa  ATPA_CAUCR RecName: Full=ATP synthase subunit alpha;       
    1::508     e-152  56%  510 aa  ATPA_CAUCN RecName: Full=ATP synthase subunit alpha;       
    1::500     e-152  57%  501 aa  ATPA_STRE4 RecName: Full=ATP synthase subunit alpha;       
    1::504     e-152  56%  512 aa  ATPA_RICTY RecName: Full=ATP synthase subunit alpha;       
    8::500     e-152  55%  505 aa  ATPA_PROMA RecName: Full=ATP synthase subunit alpha;       
    1::509     e-152  55%  509 aa  ATPA_EHRCR RecName: Full=ATP synthase subunit alpha;       
    1::506     e-152  57%  511 aa  ATPAM_OENBI RecName: Full=ATP synthase subunit alpha,
    1::499     e-152  55%  503 aa  ATPA_LEPBL RecName: Full=ATP synthase subunit alpha;       
    1::499     e-152  55%  503 aa  ATPA_LEPBJ RecName: Full=ATP synthase subunit alpha;       
    8::498     e-152  56%  505 aa  ATPA1_ACAM1 RecName: Full=ATP synthase subunit alpha 1;       
    1::495     e-151  56%  501 aa  ATPA_STRMU RecName: Full=ATP synthase subunit alpha;       
    8::500     e-151  55%  504 aa  ATPA_PROM4 RecName: Full=ATP synthase subunit alpha;       
    5::489     e-151  55%  507 aa  ATPA_LEPIN RecName: Full=ATP synthase subunit alpha;       
    5::489     e-151  55%  507 aa  ATPA_LEPIC RecName: Full=ATP synthase subunit alpha;       
    1::504     e-151  55%  509 aa  ATPA_OCHA4 RecName: Full=ATP synthase subunit alpha;       
    1::468     e-151  60%  508 aa  ATPAM_SOYBN RecName: Full=ATP synthase subunit alpha,
    1::511     e-151  55%  525 aa  ATPA_PARD8 RecName: Full=ATP synthase subunit alpha;       
    3::515     e-151  55%  525 aa  ATPA_FLAPJ RecName: Full=ATP synthase subunit alpha;       
    1::503     e-151  53%  504 aa  ATPA_LEPBP RecName: Full=ATP synthase subunit alpha;       
    1::503     e-151  53%  504 aa  ATPA_LEPBA RecName: Full=ATP synthase subunit alpha;       
    1::511     e-151  55%  527 aa  ATPA_BACTN RecName: Full=ATP synthase subunit alpha;       
    1::468     e-151  60%  507 aa  ATPAM_PEA RecName: Full=ATP synthase subunit alpha, mitochondrial;
   30::476     e-151  60%  503 aa  ATPA_THEEB RecName: Full=ATP synthase subunit alpha;       
    4::495     e-151  55%  507 aa  ATPA_SPIOL RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::498     e-151  56%  502 aa  ATPA_MICAN RecName: Full=ATP synthase subunit alpha;       
   31::496     e-151  58%  508 aa  ATPA_GNEPA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::505     e-151  55%  511 aa  ATPA_GRABC RecName: Full=ATP synthase subunit alpha;       
    3::511     e-151  56%  554 aa  ATPA_ACIC1 RecName: Full=ATP synthase subunit alpha;       
    1::495     e-151  58%  506 aa  ATPAM_BETVU RecName: Full=ATP synthase subunit alpha,
    8::500     e-150  56%  506 aa  ATPA_SYNSC RecName: Full=ATP synthase subunit alpha;       
    1::495     e-150  57%  501 aa  ATPA_STRU0 RecName: Full=ATP synthase subunit alpha;       
    1::502     e-150  57%  508 aa  ATPAM_MAIZE RecName: Full=ATP synthase subunit alpha,
   20::468     e-150  59%  507 aa  ATPA_WELMI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::468     e-150  60%  508 aa  ATPAM_PHAVU RecName: Full=ATP synthase subunit alpha,
    3::511     e-150  55%  547 aa  ATPA_THEFY RecName: Full=ATP synthase subunit alpha;       
    1::500     e-150  55%  500 aa  ATPA_LACLA RecName: Full=ATP synthase subunit alpha;       
    3::509     e-150  56%  553 aa  ATPA_FRASN RecName: Full=ATP synthase subunit alpha;       
    1::492     e-150  58%  509 aa  ATPAM_NICPL RecName: Full=ATP synthase subunit alpha,
    8::498     e-150  56%  504 aa  ATPA_CYACA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::502     e-150  57%  509 aa  ATPAM_WHEAT RecName: Full=ATP synthase subunit alpha,
    1::496     e-150  53%  504 aa  ATPA_STIHE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::500     e-150  54%  505 aa  ATPA_PROMM RecName: Full=ATP synthase subunit alpha;       
    2::495     e-150  54%  497 aa  ATPA_BIGNA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::503     e-150  54%  507 aa  ATPA_ANAMM RecName: Full=ATP synthase subunit alpha;       
    4::503     e-150  54%  507 aa  ATPA_ANAMF RecName: Full=ATP synthase subunit alpha;       
    1::492     e-150  57%  510 aa  ATPAM_HELAN RecName: Full=ATP synthase subunit alpha,
   19::475     e-150  59%  501 aa  ATPA_CAMLR RecName: Full=ATP synthase subunit alpha;       
    8::495     e-149  55%  505 aa  ATPA_SYNR3 RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRZT RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRR6 RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRPN RecName: Full=ATP synthase subunit alpha;       
    8::500     e-149  55%  505 aa  ATPA_PROM9 RecName: Full=ATP synthase subunit alpha;       
    1::500     e-149  57%  507 aa  ATPAM_ARATH RecName: Full=ATP synthase subunit alpha,
    1::585     e-149  57%  630 aa  ATPA_SORC5 RecName: Full=ATP synthase subunit alpha;       
    4::495     e-149  55%  507 aa  ATPA_SOLTU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-149  55%  507 aa  ATPA_SOLLC RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-149  55%  507 aa  ATPA_SOLBU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::498     e-149  57%  507 aa  ATPA_MAGSM RecName: Full=ATP synthase subunit alpha;       
    8::500     e-149  55%  505 aa  ATPA_PROM2 RecName: Full=ATP synthase subunit alpha;       
    2::494     e-149  57%  500 aa  ATPA_STRSY RecName: Full=ATP synthase subunit alpha;       
    2::494     e-149  57%  500 aa  ATPA_STRS2 RecName: Full=ATP synthase subunit alpha;       
    2::431     e-149  62%  438 aa  ATPA_OCHNE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    2::498     e-149  53%  505 aa  ATPA_MESVI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::460     e-149  57%  525 aa  ATPA_MESFL RecName: Full=ATP synthase subunit alpha;       
    1::513     e-149  56%  530 aa  ATPA_BACV8 RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRZJ RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRPS RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRPJ RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRPI RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRP7 RecName: Full=ATP synthase subunit alpha;       
    8::500     e-149  55%  505 aa  ATPA_PROMS RecName: Full=ATP synthase subunit alpha;       
    8::500     e-149  55%  505 aa  ATPA_PROM0 RecName: Full=ATP synthase subunit alpha;       
   20::498     e-149  56%  503 aa  ATPA_ODOSI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-149  55%  507 aa  ATPA_ATRBE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::465     e-149  56%  503 aa  ATPA_AQUAE RecName: Full=ATP synthase subunit alpha;       
    3::507     e-149  55%  550 aa  ATPA_SALAI RecName: Full=ATP synthase subunit alpha;       
    8::500     e-149  56%  505 aa  ATPA_PROM3 RecName: Full=ATP synthase subunit alpha;       
    1::471     e-149  58%  507 aa  ATPAM_RAPSA RecName: Full=ATP synthase subunit alpha,
    1::471     e-149  58%  507 aa  ATPAM_BRANA RecName: Full=ATP synthase subunit alpha,
    1::471     e-149  58%  507 aa  ATPAM_BRACM RecName: Full=ATP synthase subunit alpha,
    1::494     e-149  56%  501 aa  ATPA_STRZP RecName: Full=ATP synthase subunit alpha;       
    1::494     e-149  56%  501 aa  ATPA_STRP4 RecName: Full=ATP synthase subunit alpha;       
    4::495     e-149  55%  507 aa  ATPA_RANMC RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::500     e-149  55%  500 aa  ATPA_LACLS RecName: Full=ATP synthase subunit alpha;       
    1::498     e-149  54%  506 aa  ATPA_CLOTH RecName: Full=ATP synthase subunit alpha;       
    4::494     e-149  55%  507 aa  ATPA_CALFG RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::508     e-149  54%  513 aa  ATPA_WOLPP RecName: Full=ATP synthase subunit alpha;       
    4::498     e-149  55%  507 aa  ATPA_EUCGG RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::497     e-148  54%  520 aa  ATPA_OENOB RecName: Full=ATP synthase subunit alpha;       
    4::495     e-148  55%  507 aa  ATPA_NICTO RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::511     e-148  54%  527 aa  ATPA_BACFR RecName: Full=ATP synthase subunit alpha;       
    1::511     e-148  54%  527 aa  ATPA_BACFN RecName: Full=ATP synthase subunit alpha;       
    4::495     e-148  54%  507 aa  ATPA_POPTR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-148  54%  507 aa  ATPA_POPAL RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-148  55%  507 aa  ATPA_NICSY RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-148  54%  507 aa  ATPA_AETGR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::494     e-148  55%  510 aa  ATPA_SOYBN RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::495     e-148  56%  505 aa  ATPA_LEUMM RecName: Full=ATP synthase subunit alpha;       
    2::486     e-148  57%  513 aa  ATPA_GLUDA RecName: Full=ATP synthase subunit alpha;       
    2::509     e-148  56%  526 aa  ATPA_CYTH3 RecName: Full=ATP synthase subunit alpha;       
    3::510     e-148  54%  546 aa  ATPA_COREF RecName: Full=ATP synthase subunit alpha;       
    4::494     e-148  55%  507 aa  ATPA_ACOCL RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::494     e-148  55%  507 aa  ATPA_ACOAM RecName: Full=ATP synthase subunit alpha, chloroplastic;
    2::495     e-148  55%  507 aa  ATPA_PHYPA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-148  55%  507 aa  ATPA_TOBAC RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::494     e-148  56%  501 aa  ATPA_STRGC RecName: Full=ATP synthase subunit alpha;       
    1::494     e-148  55%  513 aa  ATPA_LACBA RecName: Full=ATP synthase subunit alpha;       
    4::495     e-148  54%  507 aa  ATPA_SILLA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-148  55%  507 aa  ATPA_NANDO RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::494     e-148  55%  507 aa  ATPA_DIOEL RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::500     e-148  54%  506 aa  ATPA_SYNPW RecName: Full=ATP synthase subunit alpha;       
    4::495     e-148  54%  510 aa  ATPA_PHAVU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::501     e-148  56%  504 aa  ATPA_LACPL RecName: Full=ATP synthase subunit alpha;       
    4::496     e-148  54%  507 aa  ATPA_GOSHI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-148  54%  507 aa  ATPA_AETCO RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::496     e-148  55%  507 aa  ATPA_IPOPU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-148  54%  507 aa  ATPA_VITVI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-148  54%  507 aa  ATPA_COFAR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-147  54%  507 aa  ATPA_PLAOC RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::496     e-147  54%  507 aa  ATPA_GOSBA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-147  54%  507 aa  ATPA_BUXMI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::507     e-147  54%  550 aa  ATPA_SALTO RecName: Full=ATP synthase subunit alpha;       
    4::494     e-147  55%  507 aa  ATPA_PIPCE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-147  54%  504 aa  ATPA_NASOF RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::495     e-147  55%  504 aa  ATPA_LEUCK RecName: Full=ATP synthase subunit alpha;       
    4::495     e-147  54%  508 aa  ATPA_HELAN RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::497     e-147  53%  510 aa  ATPA_THERP RecName: Full=ATP synthase subunit alpha;       
    2::499     e-147  54%  508 aa  ATPA_PSINU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::500     e-147  54%  504 aa  ATPA_PROM1 RecName: Full=ATP synthase subunit alpha;       
    8::500     e-147  53%  504 aa  ATPA_PROMT RecName: Full=ATP synthase subunit alpha;       
    4::495     e-147  54%  507 aa  ATPA_LOBMA RecName: Full=ATP synthase subunit alpha, chloroplastic;
   20::476     e-147  57%  505 aa  ATPA_CYAPA RecName: Full=ATP synthase subunit alpha, cyanelle;     
    4::495     e-147  54%  507 aa  ATPA_LEPVR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::497     e-147  56%  503 aa  ATPA_LACS1 RecName: Full=ATP synthase subunit alpha;       
    4::495     e-147  54%  507 aa  ATPA_BARVE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-147  54%  507 aa  ATPA_ARAHI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::508     e-147  53%  513 aa  ATPA_WOLWR RecName: Full=ATP synthase subunit alpha;       
    6::495     e-147  55%  501 aa  ATPA_PEA RecName: Full=ATP synthase subunit alpha, chloroplastic;  
    4::495     e-147  54%  507 aa  ATPA_PANGI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::494     e-147  55%  507 aa  ATPA_LIRTU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-147  54%  507 aa  ATPA_CRUWA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-147  54%  507 aa  ATPA_CAPBU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::495     e-147  55%  507 aa  ATPA_ANTFO RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::505     e-147  54%  511 aa  ATPA1_GLUOX RecName: Full=ATP synthase subunit alpha 1;       
   10::482     e-147  57%  551 aa  ATPA_SALRD RecName: Full=ATP synthase subunit alpha;       
    8::494     e-147  56%  507 aa  ATPA_MARPO RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::508     e-147  53%  545 aa  ATPA_CORJK RecName: Full=ATP synthase subunit alpha;       
    4::495     e-147  54%  505 aa  ATPA_CARPA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::498     e-146  54%  505 aa  ATPA_OENBI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::508     e-146  54%  509 aa  ATPA_NEOSM RecName: Full=ATP synthase subunit alpha;       
    3::513     e-146  55%  552 aa  ATPA_FRAAA RecName: Full=ATP synthase subunit alpha;       
    1::494     e-146  53%  503 aa  ATPA_LACDB RecName: Full=ATP synthase subunit alpha;       
   39::499     e-146  56%  506 aa  ATPA_LEPTE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::494     e-146  53%  503 aa  ATPA_LACDA RecName: Full=ATP synthase subunit alpha;       
    8::473     e-146  58%  505 aa  ATPA_PROM5 RecName: Full=ATP synthase subunit alpha;       
    4::495     e-146  54%  506 aa  ATPA_OLIPU RecName: Full=ATP synthase subunit alpha, chloroplastic;
   10::497     e-146  55%  508 aa  ATPA_ANGEV RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::496     e-146  54%  507 aa  ATPA_ADICA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::508     e-146  53%  513 aa  ATPA_WOLPM RecName: Full=ATP synthase subunit alpha;       
    2::469     e-146  57%  495 aa  ATPA_CYAME RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::485     e-146  55%  507 aa  ATPA_CHLSC RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::494     e-146  54%  507 aa  ATPA_CERDE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::466     e-146  59%  505 aa  ATPA_PROMP RecName: Full=ATP synthase subunit alpha;       
    3::509     e-146  54%  552 aa  ATPA_KINRD RecName: Full=ATP synthase subunit alpha;       
    3::508     e-146  54%  548 aa  ATPA_SACEN RecName: Full=ATP synthase subunit alpha;       
    4::494     e-146  54%  507 aa  ATPA_DRIGR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::495     e-146  55%  507 aa  ATPA_CYCTA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    6::508     e-146  54%  541 aa  ATPA_KOCRD RecName: Full=ATP synthase subunit alpha;       
    4::495     e-145  54%  507 aa  ATPA_CUCSA RecName: Full=ATP synthase subunit alpha, chloroplastic;
   33::500     e-145  55%  508 aa  ATPA_CHAVU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::508     e-145  53%  554 aa  ATPA_MYCPA RecName: Full=ATP synthase subunit alpha;       
    3::508     e-145  53%  554 aa  ATPA_MYCA1 RecName: Full=ATP synthase subunit alpha;       
   28::495     e-145  57%  506 aa  ATPA_PROWI RecName: Full=ATP synthase subunit alpha, plastid;      
    1::491     e-145  53%  525 aa  ATPA_MYCMS RecName: Full=ATP synthase subunit alpha;       
    1::491     e-145  52%  525 aa  ATPA_MYCCT RecName: Full=ATP synthase subunit alpha;       
    3::508     e-145  54%  545 aa  ATPA_RENSM RecName: Full=ATP synthase subunit alpha;       
    4::491     e-145  55%  507 aa  ATPA_ILLOL RecName: Full=ATP synthase subunit alpha, chloroplastic;
   20::497     e-144  54%  503 aa  ATPA_SYNY3 RecName: Full=ATP synthase subunit alpha;       
    4::479     e-144  55%  507 aa  ATPA_CITSI RecName: Full=ATP synthase subunit alpha, chloroplastic;
   30::497     e-144  54%  506 aa  ATPA_CHLVU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::510     e-144  53%  544 aa  ATPA_BEUC1 RecName: Full=ATP synthase subunit alpha;       
    3::510     e-144  52%  542 aa  ATPA_CORDI RecName: Full=ATP synthase subunit alpha;       
    4::483     e-144  54%  508 aa  ATPA_LACSA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::507     e-144  52%  546 aa  ATPA_CORA7 RecName: Full=ATP synthase subunit alpha;       
    3::509     e-144  54%  552 aa  ATPA_FRASC RecName: Full=ATP synthase subunit alpha;       
    4::526     e-144  52%  526 aa  ATPA_AZOPC RecName: Full=ATP synthase subunit alpha;       
   30::494     e-144  56%  507 aa  ATPA_NYMAL RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::494     e-144  53%  510 aa  ATPA_LOTJA RecName: Full=ATP synthase subunit alpha, chloroplastic;
   13::499     e-143  54%  799 aa  ATPA_UREPA RecName: Full=ATP synthase subunit alpha;       
   13::499     e-143  54%  799 aa  ATPA_UREP2 RecName: Full=ATP synthase subunit alpha;       
    4::498     e-143  54%  507 aa  ATPA_CUSOB RecName: Full=ATP synthase subunit alpha, plastid;      
    4::498     e-143  53%  505 aa  ATPA_OENPA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::498     e-143  53%  505 aa  ATPA_OENAR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::498     e-143  54%  507 aa  ATPA_CUSGR RecName: Full=ATP synthase subunit alpha, plastid;      
    4::498     e-143  53%  507 aa  ATPA_OENGL RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::498     e-143  53%  505 aa  ATPA_OENEH RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::508     e-143  53%  548 aa  ATPA_MYCSS RecName: Full=ATP synthase subunit alpha;       
    3::508     e-143  53%  548 aa  ATPA_MYCSK RecName: Full=ATP synthase subunit alpha;       
    3::508     e-143  53%  548 aa  ATPA_MYCSJ RecName: Full=ATP synthase subunit alpha;       
    3::508     e-143  52%  545 aa  ATPA_CORU7 RecName: Full=ATP synthase subunit alpha;       
    4::493     e-143  54%  507 aa  ATPA_AMBTC RecName: Full=ATP synthase subunit alpha, chloroplastic;
   30::491     e-143  56%  507 aa  ATPA_NUPAD RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::509     e-143  52%  547 aa  ATPA_CORGL RecName: Full=ATP synthase subunit alpha;       
   44::520     e-142  55%  545 aa  ATPA_YEAST RecName: Full=ATP synthase subunit alpha,
    4::483     e-142  55%  494 aa  ATPA_PINKO RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::508     e-142  52%  558 aa  ATPA_MYCLE RecName: Full=ATP synthase subunit alpha;       
    3::508     e-142  52%  558 aa  ATPA_MYCLB RecName: Full=ATP synthase subunit alpha;       
   30::495     e-142  55%  507 aa  ATPA_LEMMI RecName: Full=ATP synthase subunit alpha, chloroplastic;
   30::495     e-142  56%  507 aa  ATPA_DAUCA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::508     e-142  53%  545 aa  ATPA_CLAM3 RecName: Full=ATP synthase subunit alpha;       
    3::509     e-142  52%  547 aa  ATPA_CORGB RecName: Full=ATP synthase subunit alpha;       
    3::509     e-142  54%  529 aa  ATPA_STRCO RecName: Full=ATP synthase subunit alpha;       
    3::486     e-142  54%  549 aa  ATPA_MYCMM RecName: Full=ATP synthase subunit alpha;       
   20::495     e-142  54%  507 aa  ATPA_MORIN RecName: Full=ATP synthase subunit alpha, chloroplastic;
    8::494     e-142  55%  507 aa  ATPA_ANEMR RecName: Full=ATP synthase subunit alpha, plastid;      
    3::508     e-142  53%  545 aa  ATPA_CLAMS RecName: Full=ATP synthase subunit alpha;       
    2::495     e-142  53%  507 aa  ATPA_HUPLU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::508     e-142  52%  548 aa  ATPA_MYCS2 RecName: Full=ATP synthase subunit alpha;       
    4::491     e-142  54%  507 aa  ATPA_PHAAO RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::508     e-142  54%  545 aa  ATPA_LEIXX RecName: Full=ATP synthase subunit alpha;       
    3::509     e-142  54%  529 aa  ATPA_STRLI RecName: Full=ATP synthase subunit alpha;       
    3::486     e-142  54%  549 aa  ATPA_MYCUA RecName: Full=ATP synthase subunit alpha;       
    4::495     e-141  52%  507 aa  ATPA_SACHY RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::483     e-141  53%  513 aa  ATPA_WOLTR RecName: Full=ATP synthase subunit alpha;       
    4::495     e-141  52%  507 aa  ATPA_SORBI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-141  52%  507 aa  ATPA_SACOF RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::508     e-141  52%  548 aa  ATPA_MYCA9 RecName: Full=ATP synthase subunit alpha;       
    8::483     e-141  54%  494 aa  ATPA_PINTH RecName: Full=ATP synthase subunit alpha, chloroplastic;
   20::496     e-141  54%  507 aa  ATPA_CUSEX RecName: Full=ATP synthase subunit alpha, plastid;      
    3::510     e-141  53%  546 aa  ATPA_BIFA0 RecName: Full=ATP synthase subunit alpha;       
    4::495     e-141  53%  504 aa  ATPA_WHEAT RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-141  53%  507 aa  ATPA_ORYSJ RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-141  53%  507 aa  ATPA_ORYSI RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-141  53%  507 aa  ATPA_ORYSA RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-141  53%  507 aa  ATPA_ORYNI RecName: Full=ATP synthase subunit alpha, chloroplastic;
   29::496     e-140  55%  511 aa  ATPA_CUSRE RecName: Full=ATP synthase subunit alpha, plastid;      
    1::494     e-140  54%  501 aa  ATPA_STRP2 RecName: Full=ATP synthase subunit alpha;       
    4::465     e-140  55%  530 aa  ATPA_MYCS5 RecName: Full=ATP synthase subunit alpha;       
    4::495     e-140  52%  504 aa  ATPA_HORVU RecName: Full=ATP synthase subunit alpha, chloroplastic;
    3::491     e-140  55%  545 aa  ATPA_PROAC RecName: Full=ATP synthase subunit alpha;       
    4::495     e-140  52%  505 aa  ATPA_AGRST RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::495     e-140  52%  507 aa  ATPA_MAIZE RecName: Full=ATP synthase subunit alpha, chloroplastic;
    1::490     e-140  52%  518 aa  ATPA_MYCGA RecName: Full=ATP synthase subunit alpha;       
    4::495     e-140  52%  507 aa  ATPA_LOLPR RecName: Full=ATP synthase subunit alpha, chloroplastic;
    4::502     e-140  53%  506 aa  ATPA_ANAPZ RecName: Full=ATP synthase subunit alpha;       
    8::500     e-139  52%  506 aa  ATPA_SYNPX RecName: Full=ATP synthase subunit alpha;       
    3::510     e-139  52%  542 aa  ATPA_BIFAA RecName: Full=ATP synthase subunit alpha;       
    3::487     e-139  54%  529 aa  ATPA_STRAW RecName: Full=ATP synthase subunit alpha;       
    3::510     e-139  52%  547 aa  ATPA_RHOSR RecName: Full=ATP synthase subunit alpha;       
    3::509     e-138  52%  523 aa  ATPA_STRGG RecName: Full=ATP synthase subunit alpha;       
    3::471     e-138  55%  547 aa  ATPA_RHOE4 RecName: Full=ATP synthase subunit alpha;       
    3::508     e-138  52%  545 aa  ATPA_ARTAT RecName: Full=ATP synthase subunit alpha;       
    3::510     e-138  52%  547 aa  ATPA_RHOOB RecName: Full=ATP synthase subunit alpha;       
    7::493     e-138  50%  518 aa  ATPA_MYCPN RecName: Full=ATP synthase subunit alpha;       
    1::494     e-137  51%  501 aa  ATPA_ACEWO RecName: Full=ATP synthase subunit alpha, sodium ion
   48::509     e-137  54%  542 aa  ATPA_TROWT RecName: Full=ATP synthase subunit alpha;       
   48::509     e-137  54%  542 aa  ATPA_TROW8 RecName: Full=ATP synthase subunit alpha;       
   32::470     e-137  57%  522 aa  ATPAM_ACACA RecName: Full=ATP synthase subunit alpha,
    3::508     e-137  52%  545 aa  ATPA_ARTCA RecName: Full=ATP synthase subunit alpha;       
    2::509     e-137  50%  526 aa  ATPA_SULMW RecName: Full=ATP synthase subunit alpha;       
    1::481     e-136  54%  512 aa  ATPA_ORITI RecName: Full=ATP synthase subunit alpha;       
    7::504     e-136  50%  518 aa  ATPA_MYCGE RecName: Full=ATP synthase subunit alpha;       
    3::508     e-136  52%  545 aa  ATPA_NOCFA RecName: Full=ATP synthase subunit alpha;       
    1::460     e-136  53%  528 aa  ATPA1_MYCPU RecName: Full=ATP synthase subunit alpha 1;       
    3::476     e-136  50%  501 aa  ATPA_ACHLI RecName: Full=ATP synthase subunit alpha;       
    3::508     e-136  50%  548 aa  ATPA_MYCVP RecName: Full=ATP synthase subunit alpha;       
    3::486     e-135  52%  548 aa  ATPA_MYCGI RecName: Full=ATP synthase subunit alpha;       
   11::498     e-135  49%  510 aa  ATPA_DICT6 RecName: Full=ATP synthase subunit alpha;       
    3::508     e-135  51%  545 aa  ATPA_ARTS2 RecName: Full=ATP synthase subunit alpha;       
   30::498     e-134  50%  508 aa  ATPA_DICTD RecName: Full=ATP synthase subunit alpha;       
    1::480     e-134  53%  512 aa  ATPA_ORITB RecName: Full=ATP synthase subunit alpha;       
    1::498     e-133  48%  513 aa  ATPA_MYCPE RecName: Full=ATP synthase subunit alpha;       
    3::508     e-133  49%  549 aa  ATPA_MYCTU RecName: Full=ATP synthase subunit alpha;       
    3::508     e-133  49%  549 aa  ATPA_MYCTA RecName: Full=ATP synthase subunit alpha;       
    3::508     e-133  49%  549 aa  ATPA_MYCBT RecName: Full=ATP synthase subunit alpha;       
    3::508     e-133  49%  549 aa  ATPA_MYCBP RecName: Full=ATP synthase subunit alpha;       
    3::508     e-133  49%  549 aa  ATPA_MYCBO RecName: Full=ATP synthase subunit alpha;       
    3::508     e-131  50%  547 aa  ATPA_NOCSJ RecName: Full=ATP synthase subunit alpha;       
    1::487     e-131  51%  527 aa  ATPA_MYCA5 RecName: Full=ATP synthase subunit alpha;       
   11::511     e-130  52%  543 aa  ATPA_BIFLI RecName: Full=ATP synthase subunit alpha;       
   11::511     e-130  51%  543 aa  ATPA_BIFLO RecName: Full=ATP synthase subunit alpha;       
   11::511     e-130  51%  543 aa  ATPA_BIFLD RecName: Full=ATP synthase subunit alpha;       
    4::449     e-129  52%  481 aa  ATPA_CARRP RecName: Full=ATP synthase subunit alpha;       
   18::479     e-129  52%  507 aa  ATPA_MYCH7 RecName: Full=ATP synthase subunit alpha;       
   12::502     e-129  47%  510 aa  ATPA1_MARMS RecName: Full=ATP synthase subunit alpha 1;       
   18::479     e-129  52%  507 aa  ATPA_MYCHJ RecName: Full=ATP synthase subunit alpha;       
   18::479     e-128  52%  507 aa  ATPA_MYCH2 RecName: Full=ATP synthase subunit alpha;       
   44::486     e-128  54%  519 aa  ATPAM_DICDI RecName: Full=ATP synthase subunit alpha,
   23::486     e-128  52%  519 aa  ATPAM_DICCI RecName: Full=ATP synthase subunit alpha,
   25::489     e-128  50%  511 aa  ATPA1_PELLD RecName: Full=ATP synthase subunit alpha 1;       
   19::467     e-128  51%  523 aa  ATPA_MYCMO RecName: Full=ATP synthase subunit alpha;       
    5::464     e-127  50%  528 aa  ATPA_MYCAP RecName: Full=ATP synthase subunit alpha;       
   18::507     e-127  48%  534 aa  ATPA2_RHOFD RecName: Full=ATP synthase subunit alpha 2;       
    8::495     e-124  49%  507 aa  ATPA_SELUN RecName: Full=ATP synthase subunit alpha, chloroplastic;
   22::491     e-123  47%  513 aa  ATPA2_ACAM1 RecName: Full=ATP synthase subunit alpha 2;       
    8::491     e-123  45%  517 aa  ATPA1_SHEFN RecName: Full=ATP synthase subunit alpha 1;       
   14::490     e-122  48%  522 aa  ATPA2_PELCD RecName: Full=ATP synthase subunit alpha 2;       
   32::474     e-121  51%  504 aa  ATPA1_RHOBA RecName: Full=ATP synthase subunit alpha 1;       
   19::460     e-121  48%  520 aa  ATPA2_POLNA RecName: Full=ATP synthase subunit alpha 2;       
   22::463     e-118  48%  519 aa  ATPA1_PSYIN RecName: Full=ATP synthase subunit alpha 1;       
   34::487     e-117  46%  511 aa  ATPA2_NITMU RecName: Full=ATP synthase subunit alpha 2;       
   37::492     e-116  45%  528 aa  ATPA1_PSEA6 RecName: Full=ATP synthase subunit alpha 1;       
   26::487     e-114  47%  519 aa  ATPA2_SYNAS RecName: Full=ATP synthase subunit alpha 2;       
   27::447     e-112  49%  509 aa  ATPA1_DINSH RecName: Full=ATP synthase subunit alpha 1;       
    7::498     e-110  46%  530 aa  ATPA3_BURXL RecName: Full=ATP synthase subunit alpha 3;       
   33::433     e-110  51%  556 aa  ATPA2_BURTA RecName: Full=ATP synthase subunit alpha 2;       
   23::444     e-110  49%  510 aa  ATPA1_BURXL RecName: Full=ATP synthase subunit alpha 1;       
   38::475     e-107  44%  503 aa  ATPA2_METCA RecName: Full=ATP synthase subunit alpha 2;       
   36::475     e-107  48%  670 aa  ATPA2_BURMS RecName: Full=ATP synthase subunit alpha 2;       
   36::475     e-107  48%  670 aa  ATPA2_BURMA RecName: Full=ATP synthase subunit alpha 2;       
   36::475     e-107  48%  670 aa  ATPA2_BURM7 RecName: Full=ATP synthase subunit alpha 2;       
   21::455     e-105  45%  498 aa  ATPA1_LISMO RecName: Full=ATP synthase subunit alpha 1;       
   21::455     e-105  45%  498 aa  ATPA1_LISMF RecName: Full=ATP synthase subunit alpha 1;       
    5::469     e-105  43%  490 aa  ATPA1_LEGPH RecName: Full=ATP synthase subunit alpha 1;       
    5::469     e-105  43%  490 aa  ATPA1_LEGPA RecName: Full=ATP synthase subunit alpha 1;       
   21::455     e-104  44%  498 aa  ATPA1_LISIN RecName: Full=ATP synthase subunit alpha 1;       
   42::438     e-104  50%  666 aa  ATPA2_BURPS RecName: Full=ATP synthase subunit alpha 2;       
   40::436     e-104  50%  670 aa  ATPA2_BURP6 RecName: Full=ATP synthase subunit alpha 2;       
   40::436     e-104  50%  664 aa  ATPA2_BURP1 RecName: Full=ATP synthase subunit alpha 2;       
   42::438     e-104  50%  666 aa  ATPA2_BURP0 RecName: Full=ATP synthase subunit alpha 2;       
    8::458     e-104  44%  497 aa  ATPA2_RHOS4 RecName: Full=ATP synthase subunit alpha 2;       
    8::458     e-104  44%  497 aa  ATPA2_RHOS1 RecName: Full=ATP synthase subunit alpha 2;       
    5::455     e-102  42%  490 aa  ATPA1_LEGPC RecName: Full=ATP synthase subunit alpha 1;       
   21::455     e-101  44%  498 aa  ATPA1_LISW6 RecName: Full=ATP synthase subunit alpha 1;       
   37::463     8e-98  43%  516 aa  ATPA2_NITEC RecName: Full=ATP synthase subunit alpha 2;       
   31::498     8e-95  40%  507 aa  ATPA2_GLUOX RecName: Full=ATP synthase subunit alpha 2;       
   17::451     2e-91  40%  494 aa  ATPA1_HAHCH RecName: Full=ATP synthase subunit alpha 1;       
    8::481     1e-57  32%  513 aa  ATPA2_MYCPU RecName: Full=ATP synthase subunit alpha 2;       
   23::392     4e-38  33%  442 aa  HRPB6_XANEU RecName: Full=Probable ATP synthase hrpB6;       
   13::431     4e-35  30%  471 aa  VATB_IGNH4 RecName: Full=V-type ATP synthase beta chain;AltName:
   67::385     4e-34  34%  438 aa  FLII_BACSU RecName: Full=Flagellum-specific ATP synthase;       
   76::409     5e-34  31%  439 aa  YSCN_YERPS RecName: Full=Probable ATP synthase yscN;       
   76::409     5e-34  31%  439 aa  YSCN_YEREN RecName: Full=Probable ATP synthase yscN;       
    9::353     3e-32  29%  464 aa  VATB_STRSV RecName: Full=V-type ATP synthase beta chain;AltName:
    9::353     3e-32  29%  464 aa  VATB_STRGC RecName: Full=V-type ATP synthase beta chain;AltName:
   12::355     1e-31  30%  462 aa  VATB_CENSY RecName: Full=V-type ATP synthase beta chain;AltName:
   55::418     2e-31  29%  471 aa  ATPB_ROSS1 RecName: Full=ATP synthase subunit beta;       
   48::409     2e-31  27%  469 aa  ATPB_SYNAS RecName: Full=ATP synthase subunit beta;       
   16::351     4e-31  31%  460 aa  VATB_THENN RecName: Full=V-type ATP synthase beta chain;AltName:
   47::442     5e-31  28%  472 aa  ATPB_DESAP RecName: Full=ATP synthase subunit beta;       
   12::355     6e-31  29%  465 aa  VATB_SULTO RecName: Full=V-type ATP synthase beta chain;AltName:
   74::355     6e-31  32%  461 aa  VATB_NITMS RecName: Full=V-type ATP synthase beta chain;AltName:
   52::436     6e-31  29%  463 aa  ATPB_CLOBB RecName: Full=ATP synthase subunit beta;       
   52::436     6e-31  29%  463 aa  ATPB_CLOBA RecName: Full=ATP synthase subunit beta;       
   55::353     2e-30  30%  471 aa  ATPB_ROSCS RecName: Full=ATP synthase subunit beta;       
    6::376     2e-30  32%  485 aa  VATB_TRYCO RecName: Full=V-type proton ATPase subunit B;       
   52::416     2e-30  27%  463 aa  ATPB_CLOB8 RecName: Full=ATP synthase subunit beta;       
    3::374     3e-30  29%  462 aa  ATPB1_DINSH RecName: Full=ATP synthase subunit beta 1;       
   12::361     4e-30  28%  465 aa  VATB_METJA RecName: Full=V-type ATP synthase beta chain;AltName:
   75::356     4e-30  30%  436 aa  FLII_BORBU RecName: Full=Flagellum-specific ATP synthase;       
    3::355     7e-30  28%  469 aa  VATB3_METHJ RecName: Full=V-type ATP synthase beta chain 3;AltName:
   41::349     9e-30  29%  458 aa  VATB_UNCMA RecName: Full=V-type ATP synthase beta chain;AltName:
   10::354     9e-30  29%  465 aa  VATB_THEON RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     9e-30  28%  461 aa  VATB1_CLOTE RecName: Full=V-type ATP synthase beta chain 1;AltName:
   53::437     1e-29  28%  465 aa  ATPB_CLOPS RecName: Full=ATP synthase subunit beta;       
   53::437     1e-29  28%  465 aa  ATPB_CLOPE RecName: Full=ATP synthase subunit beta;       
   53::437     1e-29  28%  465 aa  ATPB_CLOP1 RecName: Full=ATP synthase subunit beta;       
   96::525     3e-29  27%  525 aa  ATPB_SCHPO RecName: Full=ATP synthase subunit beta, mitochondrial; 
   41::397     3e-29  27%  451 aa  ATPB_COPPD RecName: Full=ATP synthase subunit beta;       
    8::352     3e-29  28%  463 aa  VATB_THESI RecName: Full=V-type ATP synthase beta chain;AltName:
   10::354     3e-29  28%  465 aa  VATB_PYRKO RecName: Full=V-type ATP synthase beta chain;AltName:
    4::461     5e-29  26%  462 aa  ATPB_SHEAM RecName: Full=ATP synthase subunit beta;       
   35::399     5e-29  29%  485 aa  ATPB2_NITEC RecName: Full=ATP synthase subunit beta 2;       
   71::353     6e-29  29%  471 aa  VATB_STRPZ RecName: Full=V-type ATP synthase beta chain;AltName:
    6::349     6e-29  27%  470 aa  VATB_ARCFU RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRPM RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRPG RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRPF RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRPD RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRPC RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRPB RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRP8 RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRP6 RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRP3 RecName: Full=V-type ATP synthase beta chain;AltName:
   71::353     8e-29  29%  471 aa  VATB_STRP1 RecName: Full=V-type ATP synthase beta chain;AltName:
    2::432     8e-29  26%  458 aa  ATPB_LARHH RecName: Full=ATP synthase subunit beta;       
    2::351     1e-28  28%  462 aa  VATB_PYRFU RecName: Full=V-type ATP synthase beta chain;AltName:
   41::349     1e-28  30%  462 aa  VATB_METB6 RecName: Full=V-type ATP synthase beta chain;AltName:
    2::369     1e-28  26%  459 aa  ATPB_THIDA RecName: Full=ATP synthase subunit beta;       
    8::352     1e-28  28%  463 aa  VATB_THEGJ RecName: Full=V-type ATP synthase beta chain;AltName:
   42::443     1e-28  27%  473 aa  ATPB_CARHZ RecName: Full=ATP synthase subunit beta;       
    7::351     2e-28  28%  459 aa  VATB_CLOBB RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     2e-28  28%  459 aa  VATB_CLOBA RecName: Full=V-type ATP synthase beta chain;AltName:
  100::368     2e-28  29%  451 aa  FLII_PSEAE RecName: Full=Flagellum-specific ATP synthase;       
   47::411     2e-28  26%  472 aa  ATPB_DESRM RecName: Full=ATP synthase subunit beta;       
   13::356     2e-28  30%  466 aa  VATB_SULAC RecName: Full=V-type ATP synthase beta chain;AltName:
   68::353     2e-28  29%  461 aa  VATB_STRPS RecName: Full=V-type ATP synthase beta chain;AltName:
    6::356     2e-28  28%  463 aa  VATB_METTH RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     2e-28  28%  458 aa  VATB_FUSNN RecName: Full=V-type ATP synthase beta chain;AltName:
   94::384     2e-28  32%  492 aa  VATB1_ACEAT RecName: Full=V-type proton ATPase subunit B 1;        
   32::458     2e-28  27%  459 aa  ATPB_HAHCH RecName: Full=ATP synthase subunit beta;       
   50::442     2e-28  27%  467 aa  ATPB_DESOH RecName: Full=ATP synthase subunit beta;       
   68::353     3e-28  29%  461 aa  VATB_STRZJ RecName: Full=V-type ATP synthase beta chain;AltName:
   68::353     3e-28  29%  461 aa  VATB_STRPN RecName: Full=V-type ATP synthase beta chain;AltName:
   68::353     3e-28  29%  461 aa  VATB_STRPJ RecName: Full=V-type ATP synthase beta chain;AltName:
   68::353     3e-28  29%  461 aa  VATB_STRPI RecName: Full=V-type ATP synthase beta chain;AltName:
   68::353     3e-28  29%  461 aa  VATB_STRP4 RecName: Full=V-type ATP synthase beta chain;AltName:
   93::413     3e-28  32%  447 aa  FLII_TREPA RecName: Full=Flagellum-specific ATP synthase;       
   40::352     3e-28  28%  470 aa  ATPB_PELTS RecName: Full=ATP synthase subunit beta;       
   10::352     4e-28  27%  460 aa  VATB_THEPD RecName: Full=V-type ATP synthase beta chain;AltName:
   12::358     5e-28  28%  464 aa  VATB_META3 RecName: Full=V-type ATP synthase beta chain;AltName:
   47::354     5e-28  31%  468 aa  VATB_HALVO RecName: Full=V-type ATP synthase beta chain;AltName:
   28::443     5e-28  28%  473 aa  FLII_AGRT5 RecName: Full=Flagellum-specific ATP synthase;       
    7::351     7e-28  27%  460 aa  VATB_CLOPS RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     7e-28  27%  460 aa  VATB_CLOPE RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     7e-28  27%  460 aa  VATB_CLOP1 RecName: Full=V-type ATP synthase beta chain;AltName:
   46::441     7e-28  27%  472 aa  ATPB_SYMTH RecName: Full=ATP synthase subunit beta;       
    3::374     7e-28  28%  464 aa  ATPB2_BURXL RecName: Full=ATP synthase subunit beta 2;       
   98::385     8e-28  31%  494 aa  VATB_MANSE RecName: Full=V-type proton ATPase subunit B;       
   98::385     8e-28  31%  494 aa  VATB_HELVI RecName: Full=V-type proton ATPase subunit B;       
    4::423     8e-28  28%  460 aa  VATB_DICTD RecName: Full=V-type ATP synthase beta chain;AltName:
    8::352     8e-28  28%  463 aa  VATB_DESSY RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     8e-28  27%  460 aa  VATB_CLONN RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     8e-28  27%  461 aa  VATB_CLOBJ RecName: Full=V-type ATP synthase beta chain;AltName:
   70::354     8e-28  32%  463 aa  VATB_AERPE RecName: Full=V-type ATP synthase beta chain;AltName:
    4::457     8e-28  25%  458 aa  ATPB_SHELP RecName: Full=ATP synthase subunit beta;       
    9::361     1e-27  28%  462 aa  VATB_METM5 RecName: Full=V-type ATP synthase beta chain;AltName:
    4::423     1e-27  28%  460 aa  VATB_DICT6 RecName: Full=V-type ATP synthase beta chain;AltName:
   22::441     1e-27  27%  473 aa  ATPB_THEYD RecName: Full=ATP synthase subunit beta;       
   94::381     1e-27  31%  490 aa  VATB_DROME RecName: Full=V-type proton ATPase subunit B;       
    6::442     1e-27  27%  476 aa  ATPB_MYCGE RecName: Full=ATP synthase subunit beta;       
    2::435     1e-27  27%  461 aa  ATPB2_PSEA6 RecName: Full=ATP synthase subunit beta 2;       
    2::344     2e-27  30%  465 aa  ATPB_DICT6 RecName: Full=ATP synthase subunit beta;       
   33::348     2e-27  29%  464 aa  ATPB_CLOTH RecName: Full=ATP synthase subunit beta;       
   10::354     2e-27  27%  465 aa  VATB_PYRAB RecName: Full=V-type ATP synthase beta chain;AltName:
   41::349     2e-27  29%  464 aa  VATB_METPE RecName: Full=V-type ATP synthase beta chain;AltName:
    9::361     2e-27  28%  462 aa  VATB_METMP RecName: Full=V-type ATP synthase beta chain;AltName:
    9::361     2e-27  28%  462 aa  VATB_METM6 RecName: Full=V-type ATP synthase beta chain;AltName:
   56::355     2e-27  29%  434 aa  FLII_HELPY RecName: Full=Flagellum-specific ATP synthase;       
   56::355     2e-27  29%  434 aa  FLII_HELPJ RecName: Full=Flagellum-specific ATP synthase;       
    3::406     2e-27  26%  464 aa  ATPB_BURS3 RecName: Full=ATP synthase subunit beta;       
   48::465     2e-27  25%  468 aa  ATPB1_PELCD RecName: Full=ATP synthase subunit beta 1;       
   96::382     3e-27  32%  517 aa  VATB_YEAST RecName: Full=V-type proton ATPase subunit B;       
   74::361     3e-27  29%  462 aa  VATB_METVS RecName: Full=V-type ATP synthase beta chain;AltName:
    9::361     3e-27  28%  462 aa  VATB_METM7 RecName: Full=V-type ATP synthase beta chain;AltName:
    6::356     3e-27  29%  470 aa  VATB_HALMA RecName: Full=V-type ATP synthase beta chain;AltName:
   87::378     3e-27  29%  493 aa  VATB_DICDI RecName: Full=V-type proton ATPase subunit B;       
    1::382     3e-27  31%  511 aa  VATB_CANTR RecName: Full=V-type proton ATPase subunit B;       
   41::349     3e-27  30%  460 aa  VATB1_METHJ RecName: Full=V-type ATP synthase beta chain 1;AltName:
   45::437     3e-27  26%  466 aa  ATPB_HELHP RecName: Full=ATP synthase subunit beta;       
    3::406     3e-27  26%  464 aa  ATPB_BURM1 RecName: Full=ATP synthase subunit beta;       
   91::379     4e-27  31%  500 aa  VATB_CYACA RecName: Full=V-type proton ATPase subunit B;       
    7::351     4e-27  27%  461 aa  VATB_CLOBM RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     4e-27  27%  461 aa  VATB_CLOBL RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     4e-27  27%  461 aa  VATB_CLOBK RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     4e-27  27%  461 aa  VATB_CLOBH RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     4e-27  27%  461 aa  VATB_CLOB6 RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     4e-27  27%  461 aa  VATB_CLOB1 RecName: Full=V-type ATP synthase beta chain;AltName:
    4::383     4e-27  28%  430 aa  SPAL_SHISO RecName: Full=Probable ATP synthase spaL/mxiB;       
    4::383     4e-27  28%  430 aa  SPAL_SHIFL RecName: Full=Probable ATP synthase spaL/mxiB;       
    3::438     4e-27  28%  466 aa  ATPB_OENOB RecName: Full=ATP synthase subunit beta;       
    3::406     4e-27  25%  464 aa  ATPB_BURCM RecName: Full=ATP synthase subunit beta;       
    3::406     4e-27  26%  464 aa  ATPB_BURCH RecName: Full=ATP synthase subunit beta;       
    3::406     4e-27  26%  464 aa  ATPB_BURCC RecName: Full=ATP synthase subunit beta;       
    3::406     4e-27  26%  464 aa  ATPB_BURCA RecName: Full=ATP synthase subunit beta;       
   48::465     4e-27  25%  468 aa  ATPB3_PELCD RecName: Full=ATP synthase subunit beta 3;       
   10::354     6e-27  27%  465 aa  VATB_PYRHO RecName: Full=V-type ATP synthase beta chain;AltName:
    3::406     6e-27  26%  464 aa  ATPB_BURVG RecName: Full=ATP synthase subunit beta;       
  107::375     7e-27  30%  454 aa  FLII_BUCBP RecName: Full=Flagellum-specific ATP synthase;       
    4::461     7e-27  25%  463 aa  ATPB_SHESW RecName: Full=ATP synthase subunit beta;       
    4::461     7e-27  25%  463 aa  ATPB_SHEPC RecName: Full=ATP synthase subunit beta;       
    4::461     7e-27  26%  463 aa  ATPB_SHEB9 RecName: Full=ATP synthase subunit beta;       
    4::461     7e-27  26%  463 aa  ATPB_SHEB8 RecName: Full=ATP synthase subunit beta;       
    4::461     7e-27  26%  463 aa  ATPB_SHEB5 RecName: Full=ATP synthase subunit beta;       
    4::461     7e-27  26%  463 aa  ATPB_SHEB2 RecName: Full=ATP synthase subunit beta;       
   56::410     7e-27  27%  475 aa  ATPB_MYCPN RecName: Full=ATP synthase subunit beta;       
   52::344     7e-27  30%  465 aa  ATPB_DICTD RecName: Full=ATP synthase subunit beta;       
    3::406     7e-27  25%  464 aa  ATPB_BURA4 RecName: Full=ATP synthase subunit beta;       
    3::406     7e-27  26%  464 aa  ATPB1_BURTA RecName: Full=ATP synthase subunit beta 1;       
    3::406     7e-27  26%  464 aa  ATPB1_BURPS RecName: Full=ATP synthase subunit beta 1;       
    3::406     7e-27  26%  464 aa  ATPB1_BURP6 RecName: Full=ATP synthase subunit beta 1;       
    3::406     7e-27  26%  464 aa  ATPB1_BURP1 RecName: Full=ATP synthase subunit beta 1;       
    3::406     7e-27  26%  464 aa  ATPB1_BURP0 RecName: Full=ATP synthase subunit beta 1;       
    3::406     7e-27  26%  464 aa  ATPB1_BURMS RecName: Full=ATP synthase subunit beta 1;       
    3::406     7e-27  26%  464 aa  ATPB1_BURMA RecName: Full=ATP synthase subunit beta 1;       
    3::406     7e-27  26%  464 aa  ATPB1_BURM7 RecName: Full=ATP synthase subunit beta 1;       
   10::353     9e-27  28%  463 aa  VATB_SULSO RecName: Full=V-type ATP synthase beta chain;AltName:
   10::353     9e-27  28%  463 aa  VATB_SULIY RecName: Full=V-type ATP synthase beta chain;AltName:
   10::353     9e-27  28%  463 aa  VATB_SULIN RecName: Full=V-type ATP synthase beta chain;AltName:
   10::353     9e-27  28%  463 aa  VATB_SULIM RecName: Full=V-type ATP synthase beta chain;AltName:
   10::353     9e-27  28%  463 aa  VATB_SULIL RecName: Full=V-type ATP synthase beta chain;AltName:
   10::353     9e-27  28%  463 aa  VATB_SULIK RecName: Full=V-type ATP synthase beta chain;AltName:
   10::353     9e-27  28%  463 aa  VATB_SULIA RecName: Full=V-type ATP synthase beta chain;AltName:
   94::384     9e-27  31%  492 aa  VATB2_ACEAT RecName: Full=V-type proton ATPase subunit B 2;        
   25::379     9e-27  29%  431 aa  SPAL_SALTY RecName: Full=Probable ATP synthase spaL;       
   25::379     9e-27  29%  431 aa  SPAL_SALTI RecName: Full=Probable ATP synthase spaL;       
   50::477     9e-27  27%  481 aa  ATPB_STIAU RecName: Full=ATP synthase subunit beta;       
    4::457     9e-27  25%  458 aa  ATPB_SHEPA RecName: Full=ATP synthase subunit beta;       
   44::409     9e-27  26%  466 aa  ATPB_POLSQ RecName: Full=ATP synthase subunit beta;       
   44::409     9e-27  26%  466 aa  ATPB_POLNS RecName: Full=ATP synthase subunit beta;       
   46::404     9e-27  26%  462 aa  ATPB_MOOTA RecName: Full=ATP synthase subunit beta;       
   74::413     9e-27  30%  466 aa  ATPB_LEUMM RecName: Full=ATP synthase subunit beta;       
   77::474     9e-27  26%  505 aa  ATPB_KLULA RecName: Full=ATP synthase subunit beta, mitochondrial; 
   51::435     9e-27  28%  463 aa  ATPB_CLOBM RecName: Full=ATP synthase subunit beta;       
   51::435     9e-27  28%  463 aa  ATPB_CLOBL RecName: Full=ATP synthase subunit beta;       
   51::435     9e-27  28%  463 aa  ATPB_CLOBK RecName: Full=ATP synthase subunit beta;       
   51::435     9e-27  28%  463 aa  ATPB_CLOBJ RecName: Full=ATP synthase subunit beta;       
   51::435     9e-27  28%  463 aa  ATPB_CLOBH RecName: Full=ATP synthase subunit beta;       
   51::435     9e-27  28%  463 aa  ATPB_CLOB6 RecName: Full=ATP synthase subunit beta;       
   51::435     9e-27  28%  463 aa  ATPB_CLOB1 RecName: Full=ATP synthase subunit beta;       
    3::406     9e-27  26%  464 aa  ATPB_BURCJ RecName: Full=ATP synthase subunit beta;       
    4::457     1e-26  25%  458 aa  ATPB_SHESH RecName: Full=ATP synthase subunit beta;       
   65::429     1e-26  27%  482 aa  ATPB_GNEPA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   18::378     1e-26  29%  469 aa  ATPB_DELAS RecName: Full=ATP synthase subunit beta;       
   42::347     1e-26  27%  465 aa  ATPB_CLOCE RecName: Full=ATP synthase subunit beta;       
   72::352     2e-26  28%  460 aa  VATB_PICTO RecName: Full=V-type ATP synthase beta chain;AltName:
   87::377     2e-26  30%  486 aa  VATB1_ARATH RecName: Full=V-type proton ATPase subunit B1;       
   83::480     2e-26  26%  511 aa  ATPB_YEAST RecName: Full=ATP synthase subunit beta, mitochondrial; 
    4::457     2e-26  25%  458 aa  ATPB_SHEPW RecName: Full=ATP synthase subunit beta;       
   88::485     2e-26  27%  519 aa  ATPB_NEUCR RecName: Full=ATP synthase subunit beta, mitochondrial; 
   16::433     2e-26  27%  498 aa  ATPB_JASNU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-26  28%  473 aa  ATPB_EQUAR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   51::397     2e-26  29%  451 aa  Y4YI_RHISN RecName: Full=Probable ATP synthase y4yI;       
   66::352     2e-26  29%  463 aa  VATB_HALOH RecName: Full=V-type ATP synthase beta chain;AltName:
   97::381     2e-26  30%  491 aa  VATB_CAEBR RecName: Full=Probable V-type proton ATPase subunit B;  
   88::378     2e-26  30%  487 aa  VATB2_ARATH RecName: Full=V-type proton ATPase subunit B2;       
    7::407     2e-26  27%  469 aa  ATPB_THELT RecName: Full=ATP synthase subunit beta;       
   69::433     2e-26  28%  495 aa  ATPB_ORNLO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   44::435     2e-26  26%  464 aa  ATPB_CLOK5 RecName: Full=ATP synthase subunit beta;       
   69::433     2e-26  28%  495 aa  ATPB_BRIAM RecName: Full=ATP synthase subunit beta, chloroplastic; 
   92::379     3e-26  31%  503 aa  VATB_SCHPO RecName: Full=V-type proton ATPase subunit B;       
    7::357     3e-26  28%  471 aa  VATB_NATPD RecName: Full=V-type ATP synthase beta chain;AltName:
  109::451     3e-26  29%  457 aa  FLII_ECOLI RecName: Full=Flagellum-specific ATP synthase;       
    4::461     3e-26  25%  463 aa  ATPB_SHEON RecName: Full=ATP synthase subunit beta;       
   69::433     3e-26  28%  498 aa  ATPB_GOSHI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     3e-26  27%  492 aa  ATPB_CYCTA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   71::435     3e-26  27%  500 aa  ATPB_AMBTC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   31::401     3e-26  25%  458 aa  ATPB_ALHEH RecName: Full=ATP synthase subunit beta;       
   97::381     4e-26  30%  491 aa  VATB_CAEEL RecName: Full=Probable V-type proton ATPase subunit B;  
   89::379     4e-26  30%  488 aa  VATB1_HORVU RecName: Full=V-type proton ATPase subunit B 1;        
   79::412     4e-26  27%  433 aa  SSAN_SALTY RecName: Full=Probable secretion system apparatus ATP
   32::408     4e-26  27%  470 aa  ATPB_TERTT RecName: Full=ATP synthase subunit beta;       
    4::461     4e-26  25%  463 aa  ATPB_SHESA RecName: Full=ATP synthase subunit beta;       
   67::431     4e-26  28%  492 aa  ATPB_PINTH RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     4e-26  28%  495 aa  ATPB_HYANO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     4e-26  28%  498 aa  ATPB_CARPA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   34::347     4e-26  29%  467 aa  ATPB_CALS8 RecName: Full=ATP synthase subunit beta;       
   50::401     4e-26  27%  459 aa  ATPB_BURM9 RecName: Full=ATP synthase subunit beta;       
   69::433     4e-26  27%  495 aa  ATPB_BARSC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   35::456     4e-26  26%  457 aa  ATPB_ACTPJ RecName: Full=ATP synthase subunit beta;       
   78::352     5e-26  31%  480 aa  VATB2_TREPA RecName: Full=V-type ATP synthase beta chain 2;AltName:
   60::348     5e-26  27%  468 aa  ATPB_THIFE RecName: Full=ATP synthase subunit beta;       
    4::461     5e-26  25%  463 aa  ATPB_SHESR RecName: Full=ATP synthase subunit beta;       
   69::433     5e-26  27%  495 aa  ATPB_SCHME RecName: Full=ATP synthase subunit beta, chloroplastic; 
   44::447     5e-26  26%  478 aa  ATPB_PARL1 RecName: Full=ATP synthase subunit beta;       
   69::433     5e-26  27%  495 aa  ATPB_OTHSI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     5e-26  28%  498 aa  ATPB_MORIN RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     5e-26  27%  493 aa  ATPB_LACPU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     5e-26  27%  495 aa  ATPB_HYAOR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     5e-26  28%  498 aa  ATPB_GOSBA RecName: Full=ATP synthase subunit beta, chloroplastic; 
    6::441     5e-26  26%  473 aa  ATPB_DESDA RecName: Full=ATP synthase subunit beta;       
    7::404     5e-26  24%  461 aa  ATPB_COXBU RecName: Full=ATP synthase subunit beta;       
    7::404     5e-26  24%  461 aa  ATPB_COXBR RecName: Full=ATP synthase subunit beta;       
    7::404     5e-26  24%  461 aa  ATPB_COXBN RecName: Full=ATP synthase subunit beta;       
    3::405     5e-26  26%  463 aa  ATPB_BURCE RecName: Full=ATP synthase subunit beta;       
   69::433     5e-26  27%  495 aa  ATPB_BOWVO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   43::408     5e-26  25%  466 aa  ATPB_AZOSE RecName: Full=ATP synthase subunit beta;       
   69::433     5e-26  27%  498 aa  ATPB_ACOCL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   71::358     6e-26  30%  475 aa  VATB_HALWD RecName: Full=V-type ATP synthase beta chain;AltName:
   69::433     6e-26  27%  498 aa  ATPB_SOYBN RecName: Full=ATP synthase subunit beta, chloroplastic; 
    4::461     6e-26  25%  463 aa  ATPB_SHESM RecName: Full=ATP synthase subunit beta;       
   71::435     6e-26  27%  500 aa  ATPB_MANES RecName: Full=ATP synthase subunit beta, chloroplastic; 
   31::401     6e-26  25%  458 aa  ATPB_HALHL RecName: Full=ATP synthase subunit beta;       
   35::456     6e-26  26%  457 aa  ATPB_HAEDU RecName: Full=ATP synthase subunit beta;       
    2::356     8e-26  27%  466 aa  VATB_METS5 RecName: Full=V-type ATP synthase beta chain;AltName:
   89::379     8e-26  30%  488 aa  VATB1_GOSHI RecName: Full=V-type proton ATPase subunit B 1;        
    4::457     8e-26  25%  458 aa  ATPB_SHEWM RecName: Full=ATP synthase subunit beta;       
    4::457     8e-26  25%  458 aa  ATPB_SHEHH RecName: Full=ATP synthase subunit beta;       
   50::457     8e-26  27%  458 aa  ATPB_PSEPK RecName: Full=ATP synthase subunit beta;       
   50::401     8e-26  26%  458 aa  ATPB_PSEPF RecName: Full=ATP synthase subunit beta;       
   50::457     8e-26  27%  458 aa  ATPB_PSEP1 RecName: Full=ATP synthase subunit beta;       
   69::433     8e-26  27%  498 aa  ATPB_PLAOC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   16::433     8e-26  26%  498 aa  ATPB_PIPCE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     8e-26  27%  490 aa  ATPB_PINKO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   16::456     8e-26  28%  457 aa  ATPB_HAES1 RecName: Full=ATP synthase subunit beta;       
   35::456     8e-26  26%  457 aa  ATPB_ACTP7 RecName: Full=ATP synthase subunit beta;       
   35::456     8e-26  26%  457 aa  ATPB_ACTP2 RecName: Full=ATP synthase subunit beta;       
    4::461     8e-26  26%  463 aa  ATPB1_SHEFN RecName: Full=ATP synthase subunit beta 1;       
   82::376     1e-25  31%  513 aa  VATB_NEUCR RecName: Full=V-type proton ATPase subunit B;       
   15::350     1e-25  28%  458 aa  VATB_COPPD RecName: Full=V-type ATP synthase beta chain;AltName:
   79::357     1e-25  29%  466 aa  VATB2_METHJ RecName: Full=V-type ATP synthase beta chain 2;AltName:
   69::433     1e-25  27%  498 aa  ATPB_WHIBI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_TROAR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_SPIOL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   35::404     1e-25  26%  461 aa  ATPB_PSEHT RecName: Full=ATP synthase subunit beta;       
   67::467     1e-25  27%  488 aa  ATPB_PICAB RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_LOTJA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_DAUCA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_BETVU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   43::407     1e-25  25%  464 aa  ATPB_ALKMQ RecName: Full=ATP synthase subunit beta;       
   16::454     1e-25  28%  458 aa  ATPB_ACTSZ RecName: Full=ATP synthase subunit beta;       
   50::457     1e-25  27%  458 aa  ATPB2_MARMS RecName: Full=ATP synthase subunit beta 2;       
   62::357     1e-25  29%  474 aa  VATB_HALLT RecName: Full=V-type ATP synthase beta chain;AltName:
   69::433     1e-25  27%  498 aa  ATPB_WHEAT RecName: Full=ATP synthase subunit beta, chloroplastic; 
   37::402     1e-25  25%  459 aa  ATPB_PSEU2 RecName: Full=ATP synthase subunit beta;       
   37::402     1e-25  25%  459 aa  ATPB_PSESM RecName: Full=ATP synthase subunit beta;       
   69::433     1e-25  27%  498 aa  ATPB_NICSY RecName: Full=ATP synthase subunit beta, chloroplastic; 
   16::433     1e-25  26%  498 aa  ATPB_NANDO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_LOLPR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   53::404     1e-25  26%  461 aa  ATPB_IDILO RecName: Full=ATP synthase subunit beta;       
   69::433     1e-25  27%  498 aa  ATPB_HORVU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_CASSA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_CAPBU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   16::433     1e-25  26%  498 aa  ATPB_CALFL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_AGRST RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_AEGCR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-25  27%  498 aa  ATPB_AEGCO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   84::374     2e-25  30%  483 aa  VATB2_HORVU RecName: Full=V-type proton ATPase subunit B 2;        
    7::362     2e-25  26%  458 aa  NTPB_ENTHR RecName: Full=V-type sodium ATPase subunit B;AltName:
   69::433     2e-25  27%  498 aa  ATPB_VITVI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_RAPSA RecName: Full=ATP synthase subunit beta, chloroplastic; 
    2::457     2e-25  25%  458 aa  ATPB_PSEPW RecName: Full=ATP synthase subunit beta;       
    2::401     2e-25  24%  458 aa  ATPB_PSEAE RecName: Full=ATP synthase subunit beta;       
    2::401     2e-25  24%  458 aa  ATPB_PSEAB RecName: Full=ATP synthase subunit beta;       
    2::401     2e-25  24%  458 aa  ATPB_PSEA8 RecName: Full=ATP synthase subunit beta;       
    2::401     2e-25  24%  458 aa  ATPB_PSEA7 RecName: Full=ATP synthase subunit beta;       
   69::433     2e-25  27%  498 aa  ATPB_POPTR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_PHOTN RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  28%  498 aa  ATPB_PHAVU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  28%  498 aa  ATPB_PELHO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_NYMAL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_MAIZE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   42::413     2e-25  28%  466 aa  ATPB_LEUCK RecName: Full=ATP synthase subunit beta;       
   45::434     2e-25  26%  462 aa  ATPB_FUSNN RecName: Full=ATP synthase subunit beta;       
   50::432     2e-25  26%  463 aa  ATPB_DICNV RecName: Full=ATP synthase subunit beta;       
   69::433     2e-25  27%  498 aa  ATPB_CITSI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_CALFG RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_ASPEL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_ARAHI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   16::455     2e-25  26%  476 aa  VATB_HYPBU RecName: Full=V-type ATP synthase beta chain;AltName:
   87::378     2e-25  30%  487 aa  VATB3_ARATH RecName: Full=V-type proton ATPase subunit B3;       
   69::433     2e-25  27%  498 aa  ATPB_SOLLC RecName: Full=ATP synthase subunit beta, chloroplastic; 
    4::461     2e-25  25%  463 aa  ATPB_SHEDO RecName: Full=ATP synthase subunit beta;       
   69::433     2e-25  27%  498 aa  ATPB_OLIPU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_NICTO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_NICPL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_NICBI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   42::465     2e-25  26%  465 aa  ATPB_METFK RecName: Full=ATP synthase subunit beta;       
   90::488     2e-25  26%  519 aa  ATPB_MESSB RecName: Full=ATP synthase subunit beta;       
   69::433     2e-25  28%  490 aa  ATPB_MEDSA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   40::441     2e-25  27%  471 aa  ATPB_LAWIP RecName: Full=ATP synthase subunit beta;       
   67::431     2e-25  27%  490 aa  ATPB_IPOBA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  495 aa  ATPB_EUCMO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_EUCGG RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  495 aa  ATPB_EUCBI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_DRANE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   80::443     2e-25  26%  471 aa  ATPB_DESPS RecName: Full=ATP synthase subunit beta;       
   69::433     2e-25  27%  498 aa  ATPB_CRUWA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_BRASC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_BARVE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  498 aa  ATPB_ARATH RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  490 aa  ATPB_AETGR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-25  27%  490 aa  ATPB_AETCO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   70::356     3e-25  29%  462 aa  VATB_METS3 RecName: Full=V-type ATP synthase beta chain;AltName:
   72::350     3e-25  30%  460 aa  VATB_METBF RecName: Full=V-type ATP synthase beta chain;AltName:
   72::350     3e-25  30%  460 aa  VATB_METBA RecName: Full=V-type ATP synthase beta chain;AltName:
   69::433     3e-25  27%  498 aa  ATPB_SORBI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   63::422     3e-25  27%  480 aa  ATPB_SCEOB RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-25  27%  498 aa  ATPB_SACOF RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-25  27%  498 aa  ATPB_SACHY RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::401     3e-25  26%  458 aa  ATPB_PSEMY RecName: Full=ATP synthase subunit beta;       
   50::401     3e-25  26%  458 aa  ATPB_PSEFS RecName: Full=ATP synthase subunit beta;       
   69::433     3e-25  27%  498 aa  ATPB_PANGI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-25  27%  498 aa  ATPB_ORYSJ RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-25  27%  498 aa  ATPB_ORYSI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-25  27%  498 aa  ATPB_ORYSA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-25  27%  498 aa  ATPB_ORYNI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-25  27%  498 aa  ATPB_NYMOD RecName: Full=ATP synthase subunit beta, chloroplastic; 
    3::451     3e-25  28%  481 aa  ATPB_NOVAD RecName: Full=ATP synthase subunit beta;       
   69::433     3e-25  27%  498 aa  ATPB_NICSP RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-25  27%  498 aa  ATPB_NASOF RecName: Full=ATP synthase subunit beta, chloroplastic; 
   48::409     3e-25  25%  469 aa  ATPB_HELPJ RecName: Full=ATP synthase subunit beta;       
   48::409     3e-25  25%  469 aa  ATPB_HELPG RecName: Full=ATP synthase subunit beta;       
   35::400     3e-25  26%  457 aa  ATPB_HAEPS RecName: Full=ATP synthase subunit beta;       
   47::412     3e-25  28%  470 aa  ATPB_BACHD RecName: Full=ATP synthase subunit beta;       
   50::457     3e-25  26%  460 aa  ATPB_ALCBS RecName: Full=ATP synthase subunit beta;       
   55::354     4e-25  26%  467 aa  VATB_PYRCJ RecName: Full=V-type ATP synthase beta chain;AltName:
    2::361     4e-25  26%  475 aa  VATB_ANADE RecName: Full=V-type ATP synthase beta chain;AltName:
   64::475     4e-25  28%  484 aa  ATPB_SYNP6 RecName: Full=ATP synthase subunit beta;       
   64::475     4e-25  28%  484 aa  ATPB_SYNE7 RecName: Full=ATP synthase subunit beta;       
   69::433     4e-25  27%  498 aa  ATPB_SOLTU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     4e-25  27%  498 aa  ATPB_SOLBU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   65::469     4e-25  29%  471 aa  ATPB_LACBA RecName: Full=ATP synthase subunit beta;       
   67::431     4e-25  27%  490 aa  ATPB_IPOAQ RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     4e-25  27%  498 aa  ATPB_CUCSA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   58::427     4e-25  26%  486 aa  ATPB_CLAMS RecName: Full=ATP synthase subunit beta;       
   67::466     4e-25  27%  492 aa  ATPB_ANGLY RecName: Full=ATP synthase subunit beta, chloroplastic; 
   45::347     4e-25  28%  467 aa  ATPB_ANATD RecName: Full=ATP synthase subunit beta;       
   25::389     4e-25  28%  456 aa  ATPB_ACAM1 RecName: Full=ATP synthase subunit beta;       
   76::476     4e-25  27%  574 aa  ATPBM_CHLRE RecName: Full=ATP synthase subunit beta, mitochondrial;
   45::459     5e-25  25%  467 aa  ATPB_WOLSU RecName: Full=ATP synthase subunit beta;       
   69::433     5e-25  26%  498 aa  ATPB_TOBAC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::457     5e-25  26%  458 aa  ATPB_PSEPG RecName: Full=ATP synthase subunit beta;       
   69::433     5e-25  27%  498 aa  ATPB_LICGR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   16::456     5e-25  28%  457 aa  ATPB_HAES2 RecName: Full=ATP synthase subunit beta;       
   69::433     5e-25  27%  498 aa  ATPB_DRIGR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::352     5e-25  27%  472 aa  ATPB_DESAA RecName: Full=ATP synthase subunit beta;       
    2::409     5e-25  26%  466 aa  ATPB_DECAR RecName: Full=ATP synthase subunit beta;       
   69::433     5e-25  27%  495 aa  ATPB_CONMJ RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::407     5e-25  26%  465 aa  ATPB_CHRVO RecName: Full=ATP synthase subunit beta;       
   69::433     5e-25  27%  498 aa  ATPB_CHLSC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     5e-25  27%  498 aa  ATPB_AGAAF RecName: Full=ATP synthase subunit beta, chloroplastic; 
  115::401     7e-25  30%  511 aa  VATB2_RAT RecName: Full=V-type proton ATPase subunit B, brain
  115::401     7e-25  30%  511 aa  VATB2_PONAB RecName: Full=V-type proton ATPase subunit B, brain
  115::401     7e-25  30%  511 aa  VATB2_MOUSE RecName: Full=V-type proton ATPase subunit B, brain
  115::401     7e-25  30%  511 aa  VATB2_HUMAN RecName: Full=V-type proton ATPase subunit B, brain
  115::401     7e-25  30%  511 aa  VATB2_BOVIN RecName: Full=V-type proton ATPase subunit B, brain
   69::433     7e-25  27%  498 aa  ATPB_SCHSP RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::401     7e-25  26%  458 aa  ATPB_PSEF5 RecName: Full=ATP synthase subunit beta;       
    2::350     7e-25  26%  467 aa  ATPB_POLSJ RecName: Full=ATP synthase subunit beta;       
   69::433     7e-25  27%  498 aa  ATPB_NICRU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     7e-25  27%  498 aa  ATPB_MYRFG RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     7e-25  27%  498 aa  ATPB_MAGTR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     7e-25  27%  498 aa  ATPB_LIRTU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::468     7e-25  27%  498 aa  ATPB_LEMMI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::462     7e-25  27%  499 aa  ATPB_IPOPU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   48::409     7e-25  25%  469 aa  ATPB_HELP2 RecName: Full=ATP synthase subunit beta;       
   69::433     7e-25  27%  498 aa  ATPB_GALBE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   53::437     7e-25  27%  466 aa  ATPB_CLOAB RecName: Full=ATP synthase subunit beta;       
   69::433     7e-25  27%  498 aa  ATPB_CINCA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     7e-25  27%  498 aa  ATPB_BUXMI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     7e-25  27%  498 aa  ATPB_BRANA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   43::464     7e-25  26%  466 aa  ATPB_AZOSB RecName: Full=ATP synthase subunit beta;       
   35::435     7e-25  26%  461 aa  ATPB2_VIBHB RecName: Full=ATP synthase subunit beta 2;       
   56::342     9e-25  30%  453 aa  VATB_CHICK RecName: Full=V-type proton ATPase subunit B;       
   69::433     9e-25  27%  498 aa  ATPB_POPAL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     9e-25  27%  498 aa  ATPB_OENPA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     9e-25  27%  498 aa  ATPB_OENGL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     9e-25  27%  498 aa  ATPB_OENEH RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     9e-25  27%  498 aa  ATPB_OENBI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     9e-25  27%  498 aa  ATPB_MONCA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   42::407     9e-25  27%  475 aa  ATPB_LACRJ RecName: Full=ATP synthase subunit beta;       
   42::407     9e-25  27%  475 aa  ATPB_LACRD RecName: Full=ATP synthase subunit beta;       
   67::431     9e-25  27%  490 aa  ATPB_IPOSE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     9e-25  27%  490 aa  ATPB_IPOQU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   48::409     9e-25  25%  469 aa  ATPB_HELPY RecName: Full=ATP synthase subunit beta;       
   45::406     9e-25  25%  466 aa  ATPB_HELPH RecName: Full=ATP synthase subunit beta;       
   67::431     9e-25  27%  490 aa  ATPB_CRETR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     9e-25  27%  498 aa  ATPB_COFAR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     9e-25  27%  498 aa  ATPB_CANWI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     9e-25  27%  490 aa  ATPB_CALSE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     9e-25  27%  495 aa  ATPB_BEARE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::466     9e-25  27%  492 aa  ATPB_ANGEV RecName: Full=ATP synthase subunit beta, chloroplastic; 
   72::350     1e-24  30%  460 aa  VATB_METMA RecName: Full=V-type ATP synthase beta chain;AltName:
    7::402     1e-24  26%  460 aa  VATB_METBU RecName: Full=V-type ATP synthase beta chain;AltName:
   67::431     1e-24  27%  496 aa  ATPB_TRAFO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_SALZA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_ROYRE RecName: Full=ATP synthase subunit beta, chloroplastic; 
    4::433     1e-24  28%  494 aa  ATPB_PHYPA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_NYPFR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_LACSA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_IDIAU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_HYPCO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_HYOLA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_ELAOL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     1e-24  27%  490 aa  ATPB_CONAR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_COCNU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   62::427     1e-24  26%  486 aa  ATPB_CLAM3 RecName: Full=ATP synthase subunit beta;       
    3::436     1e-24  25%  465 aa  ATPB_CHLT3 RecName: Full=ATP synthase subunit beta;       
   69::433     1e-24  27%  498 aa  ATPB_CHASI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_CHAHU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_CALUS RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_BALSE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_ACRAL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   72::349     1e-24  29%  458 aa  VATB_METLZ RecName: Full=V-type ATP synthase beta chain;AltName:
   72::350     1e-24  30%  460 aa  VATB_METAC RecName: Full=V-type ATP synthase beta chain;AltName:
    7::351     1e-24  28%  460 aa  VATB_CLOTH RecName: Full=V-type ATP synthase beta chain;AltName:
    2::361     1e-24  26%  477 aa  VATB_ANASK RecName: Full=V-type ATP synthase beta chain;AltName:
    2::361     1e-24  26%  477 aa  VATB_ANAD2 RecName: Full=V-type ATP synthase beta chain;AltName:
   40::395     1e-24  28%  513 aa  VATB1_HUMAN RecName: Full=V-type proton ATPase subunit B, kidney
   53::450     1e-24  26%  477 aa  ATPB_SYNJA RecName: Full=ATP synthase subunit beta;       
   67::431     1e-24  27%  490 aa  ATPB_IPOWR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     1e-24  27%  498 aa  ATPB_HELAN RecName: Full=ATP synthase subunit beta, chloroplastic; 
   47::412     1e-24  28%  470 aa  ATPB_BACPF RecName: Full=ATP synthase subunit beta;       
  128::528     1e-24  26%  560 aa  ATPBM_NICPL RecName: Full=ATP synthase subunit beta, mitochondrial;
   62::421     1e-24  27%  496 aa  ATPB1_BURXL RecName: Full=ATP synthase subunit beta 1;       
   53::450     2e-24  26%  477 aa  ATPB_SYNJB RecName: Full=ATP synthase subunit beta;       
   69::433     2e-24  27%  498 aa  ATPB_PHODC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-24  27%  498 aa  ATPB_PHAAO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     2e-24  27%  492 aa  ATPB_MARPO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   45::459     2e-24  26%  466 aa  ATPB_HELAH RecName: Full=ATP synthase subunit beta;       
   67::431     2e-24  27%  490 aa  ATPB_CUSJA RecName: Full=ATP synthase subunit beta, plastid;       
   64::423     2e-24  26%  481 aa  ATPB_CHLRE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     2e-24  27%  498 aa  ATPB_CERDE RecName: Full=ATP synthase subunit beta, chloroplastic; 
  121::431     2e-24  27%  553 aa  ATPBM_MAIZE RecName: Full=ATP synthase subunit beta, mitochondrial;
    5::352     3e-24  26%  460 aa  VATB_THEVO RecName: Full=V-type ATP synthase beta chain;AltName:
   40::395     3e-24  28%  513 aa  VATB1_BOVIN RecName: Full=V-type proton ATPase subunit B, kidney
   69::433     3e-24  27%  498 aa  ATPB_SARHE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::401     3e-24  26%  458 aa  ATPB_PSEU5 RecName: Full=ATP synthase subunit beta;       
   69::433     3e-24  27%  498 aa  ATPB_OENAR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   16::454     3e-24  26%  458 aa  ATPB_MANSM RecName: Full=ATP synthase subunit beta;       
   67::431     3e-24  27%  496 aa  ATPB_DIOEL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   29::346     3e-24  28%  462 aa  ATPB_CHLLI RecName: Full=ATP synthase subunit beta;       
   70::466     3e-24  27%  493 aa  ATPB_CHAGL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-24  27%  498 aa  ATPB_CARMI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     3e-24  27%  498 aa  ATPB_ASACA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   46::413     3e-24  25%  464 aa  ATPB_ALKOO RecName: Full=ATP synthase subunit beta;       
    2::407     3e-24  25%  468 aa  ATPB_STRMK RecName: Full=ATP synthase subunit beta;       
   65::424     3e-24  27%  484 aa  ATPB_STIHE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   47::346     3e-24  26%  462 aa  ATPB_PROVI RecName: Full=ATP synthase subunit beta;       
   69::433     3e-24  27%  491 aa  ATPB_PEA RecName: Full=ATP synthase subunit beta, chloroplastic;   
    9::409     3e-24  26%  472 aa  ATPB_FERNB RecName: Full=ATP synthase subunit beta;       
   69::433     3e-24  27%  498 aa  ATPB_ARIMA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   92::484     3e-24  29%  492 aa  ATPB_ANEMR RecName: Full=ATP synthase subunit beta, plastid;       
   70::431     4e-24  27%  489 aa  ATPB_ZYGCR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   65::459     4e-24  27%  481 aa  ATPB_PSEAK RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     4e-24  27%  498 aa  ATPB_POPTM RecName: Full=ATP synthase subunit beta, chloroplastic; 
   48::410     4e-24  28%  471 aa  ATPB_LYSSC RecName: Full=ATP synthase subunit beta;       
   73::437     4e-24  27%  502 aa  ATPB_LEPVR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   76::371     6e-24  28%  460 aa  VATB_ANADF RecName: Full=V-type ATP synthase beta chain;AltName:
    2::438     6e-24  25%  468 aa  ATPB_STRM5 RecName: Full=ATP synthase subunit beta;       
   37::402     6e-24  25%  459 aa  ATPB_PSE14 RecName: Full=ATP synthase subunit beta;       
   69::433     6e-24  27%  498 aa  ATPB_LOBMA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   62::458     6e-24  27%  483 aa  ATPB_CYAP8 RecName: Full=ATP synthase subunit beta;       
   44::409     6e-24  27%  468 aa  ATPB_BACCQ RecName: Full=ATP synthase subunit beta;       
   44::409     6e-24  27%  468 aa  ATPB_BACC7 RecName: Full=ATP synthase subunit beta;       
   44::409     6e-24  27%  468 aa  ATPB_BACC1 RecName: Full=ATP synthase subunit beta;       
   69::433     6e-24  26%  498 aa  ATPB_ATRBE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     6e-24  27%  493 aa  ATPB_ADICA RecName: Full=ATP synthase subunit beta, chloroplastic; 
  130::527     6e-24  26%  559 aa  ATPBO_ARATH RecName: Full=ATP synthase subunit beta-3,
  127::524     6e-24  26%  556 aa  ATPBN_ARATH RecName: Full=ATP synthase subunit beta-2,
  120::430     6e-24  27%  552 aa  ATPBM_ORYSJ RecName: Full=ATP synthase subunit beta, mitochondrial;
  127::524     6e-24  26%  556 aa  ATPBM_ARATH RecName: Full=ATP synthase subunit beta-1,
   21::434     7e-24  25%  460 aa  ATPB_PROMH RecName: Full=ATP synthase subunit beta;       
   59::428     7e-24  26%  487 aa  ATPB_LEIXX RecName: Full=ATP synthase subunit beta;       
   42::407     7e-24  27%  467 aa  ATPB_LACPL RecName: Full=ATP synthase subunit beta;       
   67::431     7e-24  26%  490 aa  ATPB_IPOOB RecName: Full=ATP synthase subunit beta, chloroplastic; 
    6::351     7e-24  25%  470 aa  ATPB_DESVV RecName: Full=ATP synthase subunit beta;       
    6::351     7e-24  25%  470 aa  ATPB_DESVH RecName: Full=ATP synthase subunit beta;       
   70::462     7e-24  26%  493 aa  ATPB_CHAVU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   44::409     1e-23  27%  470 aa  ATPB_STAES RecName: Full=ATP synthase subunit beta;       
   44::409     1e-23  27%  470 aa  ATPB_STAEQ RecName: Full=ATP synthase subunit beta;       
   50::457     1e-23  26%  458 aa  ATPB_PSEE4 RecName: Full=ATP synthase subunit beta;       
   55::352     1e-23  29%  467 aa  ATPB_LEPIN RecName: Full=ATP synthase subunit beta;       
   55::352     1e-23  29%  467 aa  ATPB_LEPIC RecName: Full=ATP synthase subunit beta;       
   35::453     1e-23  27%  457 aa  ATPB_HAEIG RecName: Full=ATP synthase subunit beta;       
   59::357     1e-23  27%  474 aa  ATPB1_POLNA RecName: Full=ATP synthase subunit beta 1;       
   79::384     1e-23  29%  471 aa  VATB_DEIDV RecName: Full=V-type ATP synthase beta chain;AltName:
   30::434     1e-23  26%  460 aa  ATPB_YERPY RecName: Full=ATP synthase subunit beta;       
   30::434     1e-23  26%  460 aa  ATPB_YERPS RecName: Full=ATP synthase subunit beta;       
   30::434     1e-23  26%  460 aa  ATPB_YERPP RecName: Full=ATP synthase subunit beta;       
   30::434     1e-23  26%  460 aa  ATPB_YERPN RecName: Full=ATP synthase subunit beta;       
   30::434     1e-23  26%  460 aa  ATPB_YERPG RecName: Full=ATP synthase subunit beta;       
   30::434     1e-23  26%  460 aa  ATPB_YERPE RecName: Full=ATP synthase subunit beta;       
   30::434     1e-23  26%  460 aa  ATPB_YERPB RecName: Full=ATP synthase subunit beta;       
   30::434     1e-23  26%  460 aa  ATPB_YERPA RecName: Full=ATP synthase subunit beta;       
   30::434     1e-23  26%  460 aa  ATPB_YERP3 RecName: Full=ATP synthase subunit beta;       
   64::458     1e-23  28%  482 aa  ATPB_SYNP1 RecName: Full=ATP synthase subunit beta;       
   45::439     1e-23  25%  471 aa  ATPB_MYCHJ RecName: Full=ATP synthase subunit beta;       
   45::439     1e-23  25%  471 aa  ATPB_MYCH7 RecName: Full=ATP synthase subunit beta;       
   55::441     1e-23  25%  471 aa  ATPB_MYCGA RecName: Full=ATP synthase subunit beta;       
   75::375     1e-23  31%  476 aa  ATPB_LACSS RecName: Full=ATP synthase subunit beta;       
   47::412     1e-23  27%  473 aa  ATPB_GEOTH RecName: Full=ATP synthase subunit beta;       
   47::412     1e-23  27%  473 aa  ATPB_GEOKA RecName: Full=ATP synthase subunit beta;       
   67::431     1e-23  26%  490 aa  ATPB_CUSEX RecName: Full=ATP synthase subunit beta, plastid;       
   49::400     1e-23  25%  458 aa  ATPB_CHRSD RecName: Full=ATP synthase subunit beta;       
   67::431     1e-23  26%  492 aa  ATPB_ANTFO RecName: Full=ATP synthase subunit beta, chloroplastic; 
   10::386     1e-23  26%  476 aa  ATPB_ACIAC RecName: Full=ATP synthase subunit beta;       
   61::388     1e-23  28%  486 aa  ATPB2_GLUOX RecName: Full=ATP synthase subunit beta 2;       
  115::397     2e-23  28%  467 aa  FLII_RHIME RecName: Full=Flagellum-specific ATP synthase;       
    4::341     2e-23  24%  459 aa  ATPB_THISH RecName: Full=ATP synthase subunit beta;       
   45::460     2e-23  28%  487 aa  ATPB_SYNS3 RecName: Full=ATP synthase subunit beta;       
   47::338     2e-23  26%  467 aa  ATPB_PROMO RecName: Full=ATP synthase subunit beta, sodium ion
   45::439     2e-23  25%  471 aa  ATPB_MYCH2 RecName: Full=ATP synthase subunit beta;       
   29::346     2e-23  27%  462 aa  ATPB_CHLP8 RecName: Full=ATP synthase subunit beta;       
   47::412     2e-23  28%  470 aa  ATPB_BACSK RecName: Full=ATP synthase subunit beta;       
   69::351     2e-23  29%  457 aa  VATB_CLOD6 RecName: Full=V-type ATP synthase beta chain;AltName:
   62::454     2e-23  28%  483 aa  ATPB_PRODI RecName: Full=ATP synthase subunit beta;       
   60::364     2e-23  27%  484 aa  ATPB_NOCSJ RecName: Full=ATP synthase subunit beta;       
   48::440     2e-23  25%  469 aa  ATPB_NITSB RecName: Full=ATP synthase subunit beta;       
   35::453     2e-23  26%  457 aa  ATPB_HAEIE RecName: Full=ATP synthase subunit beta;       
   50::352     2e-23  26%  470 aa  ATPB_GEOUR RecName: Full=ATP synthase subunit beta;       
    2::378     2e-23  26%  468 aa  ATPB_DIAST RecName: Full=ATP synthase subunit beta;       
   47::412     2e-23  27%  473 aa  ATPB_BACP3 RecName: Full=ATP synthase subunit beta;       
   45::410     2e-23  27%  469 aa  ATPB_BACHK RecName: Full=ATP synthase subunit beta;       
   45::410     2e-23  27%  469 aa  ATPB_BACCZ RecName: Full=ATP synthase subunit beta;       
   45::410     2e-23  27%  469 aa  ATPB_BACC3 RecName: Full=ATP synthase subunit beta;       
   45::410     2e-23  27%  469 aa  ATPB_BACC0 RecName: Full=ATP synthase subunit beta;       
   45::410     2e-23  27%  469 aa  ATPB_BACAN RecName: Full=ATP synthase subunit beta;       
   45::410     2e-23  27%  469 aa  ATPB_BACAH RecName: Full=ATP synthase subunit beta;       
   45::410     2e-23  27%  469 aa  ATPB_BACAC RecName: Full=ATP synthase subunit beta;       
   45::410     2e-23  27%  469 aa  ATPB_BACAA RecName: Full=ATP synthase subunit beta;       
   60::358     3e-23  27%  476 aa  ATPB_SYNWW RecName: Full=ATP synthase subunit beta;       
   66::425     3e-23  26%  488 aa  ATPB_SYNR3 RecName: Full=ATP synthase subunit beta;       
   48::446     3e-23  24%  475 aa  ATPB_RHIE6 RecName: Full=ATP synthase subunit beta;       
   67::409     3e-23  26%  470 aa  ATPB_PECFR RecName: Full=ATP synthase subunit beta;       
   55::352     3e-23  29%  467 aa  ATPB_LEPBL RecName: Full=ATP synthase subunit beta;       
   55::352     3e-23  29%  467 aa  ATPB_LEPBJ RecName: Full=ATP synthase subunit beta;       
   67::431     3e-23  26%  490 aa  ATPB_CUSRE RecName: Full=ATP synthase subunit beta, plastid;       
   44::409     3e-23  27%  468 aa  ATPB_BACCR RecName: Full=ATP synthase subunit beta;       
   44::409     3e-23  27%  468 aa  ATPB_BACC4 RecName: Full=ATP synthase subunit beta;       
    2::378     3e-23  26%  468 aa  ATPB_ACISJ RecName: Full=ATP synthase subunit beta;       
   29::346     3e-23  27%  462 aa  ATPB2_CHLTE RecName: Full=ATP synthase subunit beta 2;       
    7::351     4e-23  25%  458 aa  VATB_ENTFA RecName: Full=V-type ATP synthase beta chain;AltName:
   79::384     4e-23  29%  471 aa  VATB_DEIRA RecName: Full=V-type ATP synthase beta chain;AltName:
   80::385     4e-23  29%  470 aa  VATB_DEIGD RecName: Full=V-type ATP synthase beta chain;AltName:
   36::434     4e-23  25%  459 aa  ATPB_VESOH RecName: Full=ATP synthase subunit beta;       
   49::454     4e-23  25%  459 aa  ATPB_THICR RecName: Full=ATP synthase subunit beta;       
   54::439     4e-23  27%  467 aa  ATPB_PETMO RecName: Full=ATP synthase subunit beta;       
   47::346     4e-23  26%  462 aa  ATPB_PELPB RecName: Full=ATP synthase subunit beta;       
    2::465     4e-23  24%  465 aa  ATPB_NEIMB RecName: Full=ATP synthase subunit beta;       
   61::457     4e-23  27%  482 aa  ATPB_MICAN RecName: Full=ATP synthase subunit beta;       
   35::453     4e-23  26%  457 aa  ATPB_HAEIN RecName: Full=ATP synthase subunit beta;       
   35::453     4e-23  26%  457 aa  ATPB_HAEI8 RecName: Full=ATP synthase subunit beta;       
    4::459     4e-23  25%  460 aa  ATPB_ERWCT RecName: Full=ATP synthase subunit beta;       
   40::405     4e-23  27%  464 aa  ATPB_BACCN RecName: Full=ATP synthase subunit beta;       
   47::412     4e-23  27%  473 aa  ATPB_BACCA RecName: Full=ATP synthase subunit beta;       
   75::484     4e-23  25%  547 aa  ATPBM_DAUCA RecName: Full=ATP synthase subunit beta, mitochondrial;
   47::346     4e-23  26%  462 aa  ATPB1_PELLD RecName: Full=ATP synthase subunit beta 1;       
   79::352     5e-23  28%  479 aa  VATB_NITOC RecName: Full=V-type ATP synthase beta chain;AltName:
   67::453     5e-23  28%  503 aa  ATPB_RUBXD RecName: Full=ATP synthase subunit beta;       
    2::353     5e-23  26%  471 aa  ATPB_METPP RecName: Full=ATP synthase subunit beta;       
   50::432     5e-23  26%  464 aa  ATPB_MARAV RecName: Full=ATP synthase subunit beta;       
   50::352     5e-23  25%  470 aa  ATPB_GEOSM RecName: Full=ATP synthase subunit beta;       
   58::475     5e-23  27%  476 aa  ATPB_FUCVE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   39::532     5e-23  28%  541 aa  ATPB_BART1 RecName: Full=ATP synthase subunit beta;       
   56::448     5e-23  25%  478 aa  ATPB_AQUPY RecName: Full=ATP synthase subunit beta;       
   57::461     5e-23  25%  462 aa  ATPB_AERHH RecName: Full=ATP synthase subunit beta;       
    7::350     6e-23  25%  463 aa  VATB_METTP RecName: Full=V-type ATP synthase beta chain;AltName:
   45::437     6e-23  25%  466 aa  ATPB_SULNB RecName: Full=ATP synthase subunit beta;       
   45::440     6e-23  27%  471 aa  ATPB_STACT RecName: Full=ATP synthase subunit beta;       
   80::478     6e-23  24%  509 aa  ATPB_SINMW RecName: Full=ATP synthase subunit beta;       
   50::401     6e-23  25%  459 aa  ATPB_RUTMC RecName: Full=ATP synthase subunit beta;       
   61::457     6e-23  27%  481 aa  ATPB_MESVI RecName: Full=ATP synthase subunit beta, chloroplastic; 
    4::434     6e-23  25%  464 aa  ATPB_DEHSC RecName: Full=ATP synthase subunit beta;       
    4::434     6e-23  25%  464 aa  ATPB_DEHSB RecName: Full=ATP synthase subunit beta;       
   29::346     6e-23  27%  462 aa  ATPB_CHLCH RecName: Full=ATP synthase subunit beta;       
   45::410     6e-23  26%  469 aa  ATPB_BACWK RecName: Full=ATP synthase subunit beta;       
   30::361     8e-23  29%  478 aa  VATB_THET8 RecName: Full=V-type ATP synthase beta chain;AltName:
   30::361     8e-23  29%  478 aa  VATB_THET2 RecName: Full=V-type ATP synthase beta chain;AltName:
   69::351     8e-23  29%  459 aa  VATB_THEPX RecName: Full=V-type ATP synthase beta chain;AltName:
   48::357     8e-23  26%  469 aa  VATB_STAMF RecName: Full=V-type ATP synthase beta chain;AltName:
  100::385     8e-23  29%  494 aa  VATB_PLAFA RecName: Full=V-type proton ATPase subunit B;       
   53::417     8e-23  26%  479 aa  ATPB_VANDA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   57::440     8e-23  24%  468 aa  ATPB_THESQ RecName: Full=ATP synthase subunit beta;       
   57::440     8e-23  24%  468 aa  ATPB_THEP1 RecName: Full=ATP synthase subunit beta;       
   57::440     8e-23  24%  468 aa  ATPB_THEMA RecName: Full=ATP synthase subunit beta;       
   67::492     8e-23  26%  492 aa  ATPB_HUPLU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::352     8e-23  25%  470 aa  ATPB_GEOMG RecName: Full=ATP synthase subunit beta;       
   48::440     8e-23  24%  470 aa  ATPB_DESDG RecName: Full=ATP synthase subunit beta;       
    4::434     8e-23  25%  464 aa  ATPB_DEHE1 RecName: Full=ATP synthase subunit beta;       
   53::470     8e-23  26%  472 aa  ATPB_CLOPH RecName: Full=ATP synthase subunit beta;       
   44::409     8e-23  26%  468 aa  ATPB_BACC2 RecName: Full=ATP synthase subunit beta;       
   62::475     8e-23  27%  482 aa  ATPB_ANASP RecName: Full=ATP synthase subunit beta;       
    7::351     1e-22  26%  459 aa  VATB_THEP3 RecName: Full=V-type ATP synthase beta chain;AltName:
   62::423     1e-22  27%  483 aa  ATPB_SYNY3 RecName: Full=ATP synthase subunit beta;       
   72::431     1e-22  27%  493 aa  ATPB_STAPU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   67::431     1e-22  26%  492 aa  ATPB_PSINU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   35::456     1e-22  26%  457 aa  ATPB_PASMU RecName: Full=ATP synthase subunit beta;       
    2::465     1e-22  24%  465 aa  ATPB_NEIMF RecName: Full=ATP synthase subunit beta;       
    2::465     1e-22  24%  465 aa  ATPB_NEIM0 RecName: Full=ATP synthase subunit beta;       
   21::353     1e-22  25%  471 aa  ATPB_HERAU RecName: Full=ATP synthase subunit beta;       
    6::441     1e-22  24%  471 aa  ATPB_DESVM RecName: Full=ATP synthase subunit beta;       
   61::457     1e-22  27%  482 aa  ATPB_CYAP7 RecName: Full=ATP synthase subunit beta;       
   56::404     1e-22  25%  461 aa  ATPB_COLP3 RecName: Full=ATP synthase subunit beta;       
   45::406     1e-22  24%  464 aa  ATPB_CLOD6 RecName: Full=ATP synthase subunit beta;       
   56::448     1e-22  25%  478 aa  ATPB_AQUAE RecName: Full=ATP synthase subunit beta;       
   36::461     1e-22  25%  462 aa  ATPB_TOLAT RecName: Full=ATP synthase subunit beta;       
    4::403     1e-22  25%  460 aa  ATPB_SODGM RecName: Full=ATP synthase subunit beta;       
    4::459     1e-22  25%  460 aa  ATPB_SALG2 RecName: Full=ATP synthase subunit beta;       
   65::424     1e-22  27%  491 aa  ATPB_NEPOL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   65::438     1e-22  26%  468 aa  ATPB_NAUPA RecName: Full=ATP synthase subunit beta;       
   50::352     1e-22  25%  470 aa  ATPB_GEOSF RecName: Full=ATP synthase subunit beta;       
   50::352     1e-22  25%  470 aa  ATPB_GEOBB RecName: Full=ATP synthase subunit beta;       
   69::431     1e-22  26%  447 aa  ATPB_CARRP RecName: Full=ATP synthase subunit beta;       
   47::412     1e-22  27%  473 aa  ATPB_BACA2 RecName: Full=ATP synthase subunit beta;       
   47::412     1e-22  27%  473 aa  ATPB_ANOFW RecName: Full=ATP synthase subunit beta;       
    1::277     2e-22  29%  386 aa  VATB2_GOSHI RecName: Full=V-type proton ATPase subunit B 2;        
   62::454     2e-22  25%  484 aa  ATPB_TRIEI RecName: Full=ATP synthase subunit beta;       
   77::409     2e-22  24%  468 aa  ATPB_THENN RecName: Full=ATP synthase subunit beta;       
   71::350     2e-22  26%  469 aa  ATPB_SYNFM RecName: Full=ATP synthase subunit beta;       
   76::474     2e-22  24%  505 aa  ATPB_RHISN RecName: Full=ATP synthase subunit beta;       
   75::473     2e-22  24%  504 aa  ATPB_RHIME RecName: Full=ATP synthase subunit beta;       
   14::415     2e-22  28%  477 aa  ATPB_PSYA2 RecName: Full=ATP synthase subunit beta;       
    2::465     2e-22  24%  465 aa  ATPB_NEIG2 RecName: Full=ATP synthase subunit beta;       
    2::465     2e-22  24%  465 aa  ATPB_NEIG1 RecName: Full=ATP synthase subunit beta;       
   64::423     2e-22  26%  481 aa  ATPB_CHLVU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   54::353     2e-22  28%  471 aa  ATPB_CHLAD RecName: Full=ATP synthase subunit beta;       
   35::435     2e-22  25%  461 aa  ATPB2_PHOPR RecName: Full=ATP synthase subunit beta 2;       
   50::442     2e-22  24%  471 aa  ATPB2_PELPD RecName: Full=ATP synthase subunit beta 2;       
   71::349     2e-22  28%  461 aa  VATB_METMJ RecName: Full=V-type ATP synthase beta chain;AltName:
    2::381     2e-22  27%  471 aa  ATPB_VEREI RecName: Full=ATP synthase subunit beta;       
   69::433     2e-22  26%  495 aa  ATPB_PSECV RecName: Full=ATP synthase subunit beta, chloroplastic; 
    4::434     2e-22  25%  460 aa  ATPB_PHOLL RecName: Full=ATP synthase subunit beta;       
   42::441     2e-22  24%  472 aa  ATPB_PELUB RecName: Full=ATP synthase subunit beta;       
    4::459     2e-22  24%  460 aa  ATPB_PECCP RecName: Full=ATP synthase subunit beta;       
   58::453     2e-22  25%  483 aa  ATPB_MYCUA RecName: Full=ATP synthase subunit beta;       
   58::453     2e-22  25%  483 aa  ATPB_MYCMM RecName: Full=ATP synthase subunit beta;       
   50::352     2e-22  24%  470 aa  ATPB_GEOSL RecName: Full=ATP synthase subunit beta;       
  149::547     2e-22  28%  651 aa  ATPB_DICDI RecName: Full=ATP synthase subunit beta, mitochondrial; 
   51::445     2e-22  26%  467 aa  ATPB_CYAME RecName: Full=ATP synthase subunit beta, chloroplastic; 
   53::437     2e-22  26%  464 aa  ATPB_CLONN RecName: Full=ATP synthase subunit beta;       
   54::353     2e-22  28%  471 aa  ATPB_CHLSY RecName: Full=ATP synthase subunit beta;       
   64::484     2e-22  27%  485 aa  ATPB_CHLAT RecName: Full=ATP synthase subunit beta, chloroplastic; 
   54::353     2e-22  28%  471 aa  ATPB_CHLAA RecName: Full=ATP synthase subunit beta;       
   50::352     2e-22  25%  471 aa  ATPB1_PELPD RecName: Full=ATP synthase subunit beta 1;       
   30::434     3e-22  25%  460 aa  ATPB_YERE8 RecName: Full=ATP synthase subunit beta;       
   56::362     3e-22  26%  480 aa  ATPB_THEFY RecName: Full=ATP synthase subunit beta;       
   50::432     3e-22  25%  458 aa  ATPB_LEGPL RecName: Full=ATP synthase subunit beta;       
   50::432     3e-22  25%  458 aa  ATPB_LEGPH RecName: Full=ATP synthase subunit beta;       
   50::432     3e-22  25%  458 aa  ATPB_LEGPC RecName: Full=ATP synthase subunit beta;       
   50::432     3e-22  25%  458 aa  ATPB_LEGPA RecName: Full=ATP synthase subunit beta;       
   50::432     3e-22  25%  458 aa  ATPB_FRATM RecName: Full=ATP synthase subunit beta;       
   63::422     3e-22  26%  480 aa  ATPB_EUGGR RecName: Full=ATP synthase subunit beta, chloroplastic; 
    2::401     3e-22  24%  459 aa  ATPB_CELJU RecName: Full=ATP synthase subunit beta;       
   47::412     3e-22  27%  473 aa  ATPB_BACSU RecName: Full=ATP synthase subunit beta;       
   62::475     3e-22  27%  482 aa  ATPB_ANAVT RecName: Full=ATP synthase subunit beta;       
   45::446     3e-22  27%  476 aa  ATPB_ACICJ RecName: Full=ATP synthase subunit beta;       
   72::352     4e-22  27%  460 aa  VATB_THEAC RecName: Full=V-type ATP synthase beta chain;AltName:
   52::410     4e-22  26%  467 aa  ATPB_VIBCM RecName: Full=ATP synthase subunit beta;       
   52::410     4e-22  26%  467 aa  ATPB_VIBCH RecName: Full=ATP synthase subunit beta;       
   52::410     4e-22  26%  467 aa  ATPB_VIBC3 RecName: Full=ATP synthase subunit beta;       
   61::462     4e-22  26%  486 aa  ATPB_KINRD RecName: Full=ATP synthase subunit beta;       
   59::363     4e-22  27%  479 aa  ATPB_FRASC RecName: Full=ATP synthase subunit beta;       
   64::458     4e-22  26%  485 aa  ATPB_CYAP4 RecName: Full=ATP synthase subunit beta;       
   73::346     4e-22  27%  462 aa  ATPB_CHLL2 RecName: Full=ATP synthase subunit beta;       
    3::357     5e-22  24%  467 aa  VATB_METST RecName: Full=V-type ATP synthase beta chain;AltName:
    4::459     5e-22  25%  460 aa  ATPB_SALTY RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALTI RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALSV RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALPC RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALPB RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALNS RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALHS RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALEP RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALDC RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALCH RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALAR RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_SALA4 RecName: Full=ATP synthase subunit beta;       
   51::449     5e-22  24%  478 aa  ATPB_RHILW RecName: Full=ATP synthase subunit beta;       
   48::412     5e-22  25%  471 aa  ATPB_RHDSA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   64::391     5e-22  27%  481 aa  ATPB_PROWI RecName: Full=ATP synthase subunit beta, plastid;       
   62::454     5e-22  26%  482 aa  ATPB_NOSP7 RecName: Full=ATP synthase subunit beta;       
    2::465     5e-22  24%  465 aa  ATPB_NEIMA RecName: Full=ATP synthase subunit beta;       
   67::431     5e-22  26%  490 aa  ATPB_IPOCC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   69::433     5e-22  26%  498 aa  ATPB_ILLOL RecName: Full=ATP synthase subunit beta, chloroplastic; 
    4::459     5e-22  25%  460 aa  ATPB_ECOHS RecName: Full=ATP synthase subunit beta;       
    4::459     5e-22  25%  460 aa  ATPB_CITK8 RecName: Full=ATP synthase subunit beta;       
   92::490     5e-22  25%  521 aa  ATPB_BRUSU RecName: Full=ATP synthase subunit beta;       
   92::490     5e-22  25%  521 aa  ATPB_BRUSI RecName: Full=ATP synthase subunit beta;       
   92::490     5e-22  25%  521 aa  ATPB_BRUO2 RecName: Full=ATP synthase subunit beta;       
   92::490     5e-22  25%  521 aa  ATPB_BRUME RecName: Full=ATP synthase subunit beta;       
   92::490     5e-22  25%  521 aa  ATPB_BRUC2 RecName: Full=ATP synthase subunit beta;       
   92::490     5e-22  25%  521 aa  ATPB_BRUAB RecName: Full=ATP synthase subunit beta;       
   92::490     5e-22  25%  521 aa  ATPB_BRUA2 RecName: Full=ATP synthase subunit beta;       
   65::424     5e-22  26%  493 aa  ATPB3_BURXL RecName: Full=ATP synthase subunit beta 3;       
   37::438     5e-22  26%  475 aa  ATPB1_MYCPU RecName: Full=ATP synthase subunit beta 1;       
   73::430     7e-22  28%  460 aa  VATB2_CLOTE RecName: Full=V-type ATP synthase beta chain 2;AltName:
    4::459     7e-22  25%  460 aa  ATPB_SHISS RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_SHIFL RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_SHIF8 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_SHIBS RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_SHIB3 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_SALPK RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_SALPA RecName: Full=ATP synthase subunit beta;       
   51::449     7e-22  24%  478 aa  ATPB_RHIL3 RecName: Full=ATP synthase subunit beta;       
   21::353     7e-22  25%  471 aa  ATPB_HERA2 RecName: Full=ATP synthase subunit beta;       
   59::363     7e-22  26%  479 aa  ATPB_FRASN RecName: Full=ATP synthase subunit beta;       
   62::363     7e-22  26%  479 aa  ATPB_FRAAA RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ESCF3 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOUT RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOSM RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOSE RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOLU RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOLI RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOLC RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOL6 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOL5 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOK1 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECODH RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECOBW RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO8A RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO81 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO7I RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO5E RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO57 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO55 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO45 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO27 RecName: Full=ATP synthase subunit beta;       
    4::459     7e-22  25%  460 aa  ATPB_ECO24 RecName: Full=ATP synthase subunit beta;       
   73::346     7e-22  26%  462 aa  ATPB_CHLPB RecName: Full=ATP synthase subunit beta;       
    2::408     7e-22  25%  466 aa  ATPB_BORA1 RecName: Full=ATP synthase subunit beta;       
   65::372     7e-22  27%  494 aa  ATPB_BIFAA RecName: Full=ATP synthase subunit beta;       
   47::412     7e-22  27%  473 aa  ATPB_BACP2 RecName: Full=ATP synthase subunit beta;       
   53::452     7e-22  27%  485 aa  ATPB1_PSYIN RecName: Full=ATP synthase subunit beta 1;       
    6::436     7e-22  24%  456 aa  ATPB1_LISMO RecName: Full=ATP synthase subunit beta 1;       
   72::357     9e-22  28%  471 aa  VATB_HALSA RecName: Full=V-type ATP synthase beta chain;AltName:
   72::357     9e-22  28%  471 aa  VATB_HALS3 RecName: Full=V-type ATP synthase beta chain;AltName:
   16::347     9e-22  28%  466 aa  ATPB_XYLFT RecName: Full=ATP synthase subunit beta;       
   16::347     9e-22  28%  466 aa  ATPB_XYLFA RecName: Full=ATP synthase subunit beta;       
   16::347     9e-22  28%  466 aa  ATPB_XYLF2 RecName: Full=ATP synthase subunit beta;       
   60::450     9e-22  27%  479 aa  ATPB_RHOBA RecName: Full=ATP synthase subunit beta;       
   44::409     9e-22  25%  467 aa  ATPB_RALME RecName: Full=ATP synthase subunit beta;       
   50::415     9e-22  26%  477 aa  ATPB_PSYCK RecName: Full=ATP synthase subunit beta;       
   61::456     9e-22  26%  486 aa  ATPB_MYCTU RecName: Full=ATP synthase subunit beta;       
   61::456     9e-22  26%  486 aa  ATPB_MYCTA RecName: Full=ATP synthase subunit beta;       
   61::456     9e-22  26%  486 aa  ATPB_MYCBT RecName: Full=ATP synthase subunit beta;       
   61::456     9e-22  26%  486 aa  ATPB_MYCBP RecName: Full=ATP synthase subunit beta;       
   61::456     9e-22  26%  486 aa  ATPB_MYCBO RecName: Full=ATP synthase subunit beta;       
   50::432     9e-22  25%  458 aa  ATPB_FRATN RecName: Full=ATP synthase subunit beta;       
   47::411     9e-22  27%  469 aa  ATPB_BREBN RecName: Full=ATP synthase subunit beta;       
   52::459     1e-21  26%  460 aa  ATPB_SHIDS RecName: Full=ATP synthase subunit beta;       
   74::407     1e-21  27%  469 aa  ATPB_PEDPA RecName: Full=ATP synthase subunit beta;       
   50::432     1e-21  24%  458 aa  ATPB_FRATW RecName: Full=ATP synthase subunit beta;       
   50::432     1e-21  24%  458 aa  ATPB_FRATT RecName: Full=ATP synthase subunit beta;       
   50::432     1e-21  24%  458 aa  ATPB_FRAT1 RecName: Full=ATP synthase subunit beta;       
    4::459     1e-21  25%  460 aa  ATPB_ENT38 RecName: Full=ATP synthase subunit beta;       
   30::459     1e-21  25%  460 aa  ATPB_EDWI9 RecName: Full=ATP synthase subunit beta;       
   61::368     1e-21  28%  490 aa  ATPB_BIFLO RecName: Full=ATP synthase subunit beta;       
   61::368     1e-21  28%  490 aa  ATPB_BIFLD RecName: Full=ATP synthase subunit beta;       
   47::475     1e-21  27%  480 aa  ATPB_ACIC5 RecName: Full=ATP synthase subunit beta;       
   66::370     1e-21  27%  490 aa  ATPB_ACIC1 RecName: Full=ATP synthase subunit beta;       
   34::404     1e-21  27%  466 aa  ATPB_ACEWO RecName: Full=ATP synthase subunit beta, sodium ion
    4::357     1e-21  25%  474 aa  ATPB1_RHOFD RecName: Full=ATP synthase subunit beta 1;       
    3::436     1e-21  24%  456 aa  ATPB1_LISMF RecName: Full=ATP synthase subunit beta 1;       
   44::409     2e-21  25%  467 aa  ATPB_RALEH RecName: Full=ATP synthase subunit beta;       
   36::409     2e-21  25%  467 aa  ATPB_CUPTR RecName: Full=ATP synthase subunit beta;       
   46::409     2e-21  28%  467 aa  ATPB_BACFI RecName: Full=ATP synthase subunit beta;       
   48::424     2e-21  25%  485 aa  ATPB_MYCA1 RecName: Full=ATP synthase subunit beta;       
   43::408     2e-21  25%  466 aa  ATPB_BORPD RecName: Full=ATP synthase subunit beta;       
   61::368     2e-21  28%  490 aa  ATPB_BIFLI RecName: Full=ATP synthase subunit beta;       
   98::373     2e-21  28%  495 aa  ATPB_BIFA0 RecName: Full=ATP synthase subunit beta;       
   47::412     2e-21  27%  473 aa  ATPB_BACST RecName: Full=ATP synthase subunit beta;       
   47::412     2e-21  27%  473 aa  ATPB_BACLD RecName: Full=ATP synthase subunit beta;       
   16::347     3e-21  27%  466 aa  ATPB_XYLFM RecName: Full=ATP synthase subunit beta;       
   55::447     3e-21  25%  475 aa  ATPB_PORYE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   41::406     3e-21  26%  464 aa  ATPB_OCEIH RecName: Full=ATP synthase subunit beta;       
   21::459     3e-21  25%  460 aa  ATPB_KLEP3 RecName: Full=ATP synthase subunit beta;       
   57::409     3e-21  25%  472 aa  ATPB_FERIS RecName: Full=ATP synthase subunit beta;       
   45::462     3e-21  25%  465 aa  ATPB_CAMHC RecName: Full=ATP synthase subunit beta;       
    2::411     3e-21  25%  466 aa  ATPB_BORPE RecName: Full=ATP synthase subunit beta;       
   50::347     3e-21  25%  464 aa  ATPB_ACIAD RecName: Full=ATP synthase subunit beta;       
    4::407     3e-21  26%  474 aa  ATPB2_PELCD RecName: Full=ATP synthase subunit beta 2;       
   56::454     3e-21  27%  489 aa  ATPB1_MARMS RecName: Full=ATP synthase subunit beta 1;       
    4::376     3e-21  26%  480 aa  ATPB1_CHLTE RecName: Full=ATP synthase subunit beta 1;       
   76::425     3e-21  24%  449 aa  HRCN_PSESY RecName: Full=Type III secretion ATP synthase hrcN;     
   47::415     3e-21  26%  474 aa  ATPB_TROWT RecName: Full=ATP synthase subunit beta;       
   47::415     3e-21  26%  474 aa  ATPB_TROW8 RecName: Full=ATP synthase subunit beta;       
   66::487     3e-21  26%  488 aa  ATPB_PROMA RecName: Full=ATP synthase subunit beta;       
   48::424     3e-21  25%  485 aa  ATPB_MYCPA RecName: Full=ATP synthase subunit beta;       
    4::459     3e-21  25%  460 aa  ATPB_KLEP7 RecName: Full=ATP synthase subunit beta;       
   89::487     3e-21  26%  518 aa  ATPB_CYPCA RecName: Full=ATP synthase subunit beta, mitochondrial; 
   47::346     3e-21  26%  462 aa  ATPB_CHLPD RecName: Full=ATP synthase subunit beta;       
    2::408     3e-21  25%  466 aa  ATPB_BORPA RecName: Full=ATP synthase subunit beta;       
    2::408     3e-21  25%  466 aa  ATPB_BORBR RecName: Full=ATP synthase subunit beta;       
   50::347     3e-21  25%  464 aa  ATPB_ACIBY RecName: Full=ATP synthase subunit beta;       
   50::347     3e-21  25%  464 aa  ATPB_ACIBT RecName: Full=ATP synthase subunit beta;       
   50::347     3e-21  25%  464 aa  ATPB_ACIBS RecName: Full=ATP synthase subunit beta;       
   50::347     3e-21  25%  464 aa  ATPB_ACIBC RecName: Full=ATP synthase subunit beta;       
   50::347     3e-21  25%  464 aa  ATPB_ACIB5 RecName: Full=ATP synthase subunit beta;       
   50::347     3e-21  25%  464 aa  ATPB_ACIB3 RecName: Full=ATP synthase subunit beta;       
    6::436     3e-21  24%  456 aa  ATPB1_LISW6 RecName: Full=ATP synthase subunit beta 1;       
    6::447     3e-21  24%  456 aa  ATPB1_LISIN RecName: Full=ATP synthase subunit beta 1;       
  121::387     5e-21  28%  466 aa  FLII_BUCAP RecName: Full=Flagellum-specific ATP synthase;       
   66::425     5e-21  26%  487 aa  ATPB_SYNPW RecName: Full=ATP synthase subunit beta;       
   45::353     5e-21  26%  474 aa  ATPB_MAGSA RecName: Full=ATP synthase subunit beta;       
   47::444     5e-21  25%  475 aa  ATPB_HYPNA RecName: Full=ATP synthase subunit beta;       
   50::432     5e-21  24%  458 aa  ATPB_FRAP2 RecName: Full=ATP synthase subunit beta;       
   76::474     5e-21  24%  505 aa  ATPB_DROME RecName: Full=ATP synthase subunit beta, mitochondrial; 
   56::460     5e-21  26%  461 aa  ATPB_ALTMD RecName: Full=ATP synthase subunit beta;       
   80::378     5e-21  26%  538 aa  ATPB2_BURPS RecName: Full=ATP synthase subunit beta 2;       
   80::378     5e-21  26%  534 aa  ATPB2_BURP6 RecName: Full=ATP synthase subunit beta 2;       
  109::434     6e-21  26%  456 aa  FLII_SALTY RecName: Full=Flagellum-specific ATP synthase;       
   52::434     6e-21  25%  460 aa  ATPB_SERP5 RecName: Full=ATP synthase subunit beta;       
   66::486     6e-21  26%  488 aa  ATPB_PROM4 RecName: Full=ATP synthase subunit beta;       
   52::468     6e-21  26%  475 aa  ATPB_OCHNE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   40::522     6e-21  24%  523 aa  ATPB_HEMPU RecName: Full=ATP synthase subunit beta, mitochondrial; 
   50::352     6e-21  25%  471 aa  ATPB_GEOLS RecName: Full=ATP synthase subunit beta;       
   50::432     6e-21  24%  458 aa  ATPB_FRATO RecName: Full=ATP synthase subunit beta;       
   50::432     6e-21  24%  458 aa  ATPB_FRATH RecName: Full=ATP synthase subunit beta;       
   50::432     6e-21  24%  458 aa  ATPB_FRATF RecName: Full=ATP synthase subunit beta;       
    2::434     6e-21  25%  457 aa  ATPB_BAUCH RecName: Full=ATP synthase subunit beta;       
   69::367     6e-21  26%  512 aa  ATPB2_BURTA RecName: Full=ATP synthase subunit beta 2;       
   63::363     8e-21  27%  482 aa  ATPB_SOLUE RecName: Full=ATP synthase subunit beta;       
   45::441     8e-21  26%  471 aa  ATPB_MACCJ RecName: Full=ATP synthase subunit beta;       
   65::407     8e-21  27%  479 aa  ATPB_LACDB RecName: Full=ATP synthase subunit beta;       
   65::407     8e-21  27%  479 aa  ATPB_LACDA RecName: Full=ATP synthase subunit beta;       
   54::359     8e-21  26%  478 aa  ATPB_CORK4 RecName: Full=ATP synthase subunit beta;       
   74::372     8e-21  26%  528 aa  ATPB2_BURP1 RecName: Full=ATP synthase subunit beta 2;       
   74::372     8e-21  26%  528 aa  ATPB2_BURP0 RecName: Full=ATP synthase subunit beta 2;       
   64::458     1e-20  27%  482 aa  ATPB_THEEB RecName: Full=ATP synthase subunit beta;       
   49::453     1e-20  25%  484 aa  ATPB_SPHWW RecName: Full=ATP synthase subunit beta;       
   55::451     1e-20  25%  475 aa  ATPB_PORPU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   64::423     1e-20  26%  482 aa  ATPB_LEPTE RecName: Full=ATP synthase subunit beta, chloroplastic; 
   45::446     1e-20  26%  476 aa  ATPB_GRABC RecName: Full=ATP synthase subunit beta;       
   76::459     1e-20  27%  460 aa  ATPB_ERWT9 RecName: Full=ATP synthase subunit beta;       
   12::463     1e-20  27%  474 aa  ATPB2_SHEFN RecName: Full=ATP synthase subunit beta 2;       
   55::478     1e-20  25%  484 aa  ATPB_AGRT5 RecName: Full=ATP synthase subunit beta;       
   80::378     1e-20  26%  534 aa  ATPB2_BURMS RecName: Full=ATP synthase subunit beta 2;       
   80::378     1e-20  26%  534 aa  ATPB2_BURMA RecName: Full=ATP synthase subunit beta 2;       
   80::378     1e-20  26%  534 aa  ATPB2_BURM7 RecName: Full=ATP synthase subunit beta 2;       
   50::341     1e-20  26%  459 aa  ATPB1_NITMU RecName: Full=ATP synthase subunit beta 1;       
   55::409     2e-20  24%  469 aa  ATPB_THEM4 RecName: Full=ATP synthase subunit beta;       
   48::446     2e-20  25%  477 aa  ATPB_RHILO RecName: Full=ATP synthase subunit beta;       
   99::497     2e-20  24%  529 aa  ATPB_RAT RecName: Full=ATP synthase subunit beta, mitochondrial;   
   44::409     2e-20  24%  467 aa  ATPB_RALEJ RecName: Full=ATP synthase subunit beta;       
   86::414     2e-20  24%  427 aa  ATPB_PEPNI RecName: Full=ATP synthase subunit beta;       
    4::414     2e-20  25%  475 aa  ATPB_MYCS2 RecName: Full=ATP synthase subunit beta;       
   99::497     2e-20  24%  529 aa  ATPB_MOUSE RecName: Full=ATP synthase subunit beta, mitochondrial; 
   65::340     2e-20  28%  479 aa  ATPB_LACAC RecName: Full=ATP synthase subunit beta;       
   51::455     2e-20  27%  485 aa  ATPB_ERYLH RecName: Full=ATP synthase subunit beta;       
   76::459     2e-20  27%  460 aa  ATPB_ENTS8 RecName: Full=ATP synthase subunit beta;       
   69::430     2e-20  26%  490 aa  ATPB_CYACA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   47::430     2e-20  25%  494 aa  ATPB_CUSSA RecName: Full=ATP synthase subunit beta, plastid;       
   47::430     2e-20  25%  487 aa  ATPB_CUSPE RecName: Full=ATP synthase subunit beta, plastid;       
   47::430     2e-20  25%  494 aa  ATPB_CUSOB RecName: Full=ATP synthase subunit beta, plastid;       
   47::430     2e-20  25%  494 aa  ATPB_CUSGR RecName: Full=ATP synthase subunit beta, plastid;       
    7::440     2e-20  24%  468 aa  ATPB_BDEBA RecName: Full=ATP synthase subunit beta;       
   53::452     2e-20  24%  481 aa  ATPB_ANADF RecName: Full=ATP synthase subunit beta;       
  120::388     2e-20  26%  467 aa  FLII_BUCAI RecName: Full=Flagellum-specific ATP synthase;       
    2::463     2e-20  24%  468 aa  ATPB_XANCP RecName: Full=ATP synthase subunit beta;       
    2::463     2e-20  24%  468 aa  ATPB_XANCB RecName: Full=ATP synthase subunit beta;       
    2::463     2e-20  24%  468 aa  ATPB_XANC8 RecName: Full=ATP synthase subunit beta;       
   36::439     2e-20  26%  470 aa  ATPB_SACD2 RecName: Full=ATP synthase subunit beta;       
   66::484     2e-20  26%  486 aa  ATPB_PROM9 RecName: Full=ATP synthase subunit beta;       
    6::458     2e-20  25%  481 aa  ATPB_OLTVI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   88::486     2e-20  24%  517 aa  ATPB_OCHA4 RecName: Full=ATP synthase subunit beta;       
   60::424     2e-20  25%  485 aa  ATPB_MYCLE RecName: Full=ATP synthase subunit beta;       
   45::438     2e-20  26%  468 aa  ATPB_LACS1 RecName: Full=ATP synthase subunit beta;       
   53::442     2e-20  26%  468 aa  ATPB1_PHOPR RecName: Full=ATP synthase subunit beta 1;       
   66::425     3e-20  26%  487 aa  ATPB_SYNSC RecName: Full=ATP synthase subunit beta;       
   69::433     3e-20  26%  495 aa  ATPB_PTEAQ RecName: Full=ATP synthase subunit beta, chloroplastic; 
    2::414     3e-20  24%  475 aa  ATPB_PSYWF RecName: Full=ATP synthase subunit beta;       
   65::340     3e-20  28%  479 aa  ATPB_LACH4 RecName: Full=ATP synthase subunit beta;       
   76::409     3e-20  29%  488 aa  ATPB_LACCB RecName: Full=ATP synthase subunit beta;       
   76::409     3e-20  29%  488 aa  ATPB_LACC3 RecName: Full=ATP synthase subunit beta;       
  130::440     3e-20  26%  562 aa  ATPBM_HEVBR RecName: Full=ATP synthase subunit beta, mitochondrial;
   52::410     4e-20  25%  467 aa  ATPB_VIBF1 RecName: Full=ATP synthase subunit beta;       
   44::377     4e-20  25%  467 aa  ATPB_RALSO RecName: Full=ATP synthase subunit beta;       
   66::484     4e-20  26%  486 aa  ATPB_PROMS RecName: Full=ATP synthase subunit beta;       
   66::484     4e-20  26%  486 aa  ATPB_PROM0 RecName: Full=ATP synthase subunit beta;       
    4::414     4e-20  25%  475 aa  ATPB_MYCVP RecName: Full=ATP synthase subunit beta;       
  343::701     4e-20  25%  778 aa  ATPB_MYCPE RecName: Full=ATP synthase subunit beta;       
   99::497     4e-20  24%  529 aa  ATPB_HUMAN RecName: Full=ATP synthase subunit beta, mitochondrial; 
   54::453     4e-20  24%  482 aa  ATPB_ANADE RecName: Full=ATP synthase subunit beta;       
   15::343     4e-20  25%  460 aa  ATPB_ACHLI RecName: Full=ATP synthase subunit beta;       
  168::423     5e-20  29%  578 aa  VATA_METBF RecName: Full=V-type ATP synthase alpha chain;       
   76::425     5e-20  24%  449 aa  HRCN_PSESH RecName: Full=Type III secretion ATP synthase hrcN;     
   52::410     5e-20  25%  467 aa  ATPB_VIBFM RecName: Full=ATP synthase subunit beta;       
   75::461     5e-20  25%  464 aa  ATPB_UREU1 RecName: Full=ATP synthase subunit beta;       
   66::425     5e-20  26%  487 aa  ATPB_SYNPX RecName: Full=ATP synthase subunit beta;       
   44::456     5e-20  26%  470 aa  ATPB_STAS1 RecName: Full=ATP synthase subunit beta;       
   79::393     5e-20  27%  513 aa  ATPB_SPHAL RecName: Full=ATP synthase subunit beta;       
   66::425     5e-20  26%  488 aa  ATPB_PROM3 RecName: Full=ATP synthase subunit beta;       
   57::421     5e-20  25%  509 aa  ATPB_MYCSS RecName: Full=ATP synthase subunit beta;       
   57::421     5e-20  25%  509 aa  ATPB_MYCSK RecName: Full=ATP synthase subunit beta;       
   57::421     5e-20  25%  517 aa  ATPB_MYCSJ RecName: Full=ATP synthase subunit beta;       
   47::422     5e-20  26%  472 aa  ATPB_BACME RecName: Full=ATP synthase subunit beta;       
   51::477     5e-20  26%  480 aa  ATPB_ACIBL RecName: Full=ATP synthase subunit beta;       
    2::463     7e-20  24%  468 aa  ATPB_XANC5 RecName: Full=ATP synthase subunit beta;       
   66::425     7e-20  25%  487 aa  ATPB_SYNS9 RecName: Full=ATP synthase subunit beta;       
    6::422     7e-20  25%  476 aa  ATPB_MYCGI RecName: Full=ATP synthase subunit beta;       
   45::354     7e-20  25%  474 aa  ATPB_MAGSM RecName: Full=ATP synthase subunit beta;       
   58::363     7e-20  26%  482 aa  ATPB_CORU7 RecName: Full=ATP synthase subunit beta;       
   44::437     7e-20  24%  464 aa  ATPB_ARCB4 RecName: Full=ATP synthase subunit beta;       
    4::342     7e-20  24%  460 aa  ATPB1_NITEC RecName: Full=ATP synthase subunit beta 1;       
   71::421     9e-20  26%  444 aa  FLII_CAUCR RecName: Full=Flagellum-specific ATP synthase;       
   71::421     9e-20  26%  444 aa  FLII_CAUCN RecName: Full=Flagellum-specific ATP synthase;       
    2::463     9e-20  24%  468 aa  ATPB_XANOR RecName: Full=ATP synthase subunit beta;       
    2::463     9e-20  24%  468 aa  ATPB_XANOP RecName: Full=ATP synthase subunit beta;       
    2::463     9e-20  24%  468 aa  ATPB_XANOM RecName: Full=ATP synthase subunit beta;       
   52::410     9e-20  25%  467 aa  ATPB_VIBVY RecName: Full=ATP synthase subunit beta;       
   52::410     9e-20  25%  467 aa  ATPB_VIBVU RecName: Full=ATP synthase subunit beta;       
   42::403     9e-20  25%  461 aa  ATPB_THETN RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAW RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAT RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAS RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAR RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAN RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAM RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAE RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAC RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAAB RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAA9 RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAA8 RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAA3 RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAA2 RecName: Full=ATP synthase subunit beta;       
   44::470     9e-20  26%  470 aa  ATPB_STAA1 RecName: Full=ATP synthase subunit beta;       
   66::456     9e-20  27%  488 aa  ATPB_PROMT RecName: Full=ATP synthase subunit beta;       
   66::425     9e-20  26%  486 aa  ATPB_PROM2 RecName: Full=ATP synthase subunit beta;       
   66::456     9e-20  27%  488 aa  ATPB_PROM1 RecName: Full=ATP synthase subunit beta;       
   50::477     9e-20  26%  481 aa  ATPB_MYXXD RecName: Full=ATP synthase subunit beta;       
   47::409     9e-20  26%  470 aa  ATPB_LACCA RecName: Full=ATP synthase subunit beta;       
   47::412     9e-20  26%  473 aa  ATPB_GEOSW RecName: Full=ATP synthase subunit beta;       
   45::350     1e-19  27%  469 aa  ATPB_LACLA RecName: Full=ATP synthase subunit beta;       
   56::459     1e-19  24%  483 aa  ATPB_ARTAT RecName: Full=ATP synthase subunit beta;       
   48::334     1e-19  26%  464 aa  ATPB2_RHOS1 RecName: Full=ATP synthase subunit beta 2;       
   55::414     1e-19  26%  476 aa  ATPB2_BRASB RecName: Full=ATP synthase subunit beta 2;       
   81::366     1e-19  27%  477 aa  VATB_ENCCU RecName: Full=V-type proton ATPase subunit B;       
   52::410     1e-19  25%  467 aa  ATPB_VIBPA RecName: Full=ATP synthase subunit beta;       
    4::410     1e-19  24%  470 aa  ATPB_THEAB RecName: Full=ATP synthase subunit beta;       
   49::410     1e-19  22%  468 aa  ATPB_SULDN RecName: Full=ATP synthase subunit beta;       
   44::443     1e-19  24%  474 aa  ATPB_SILST RecName: Full=ATP synthase subunit beta;       
   66::425     1e-19  25%  488 aa  ATPB_PROMM RecName: Full=ATP synthase subunit beta;       
   47::445     1e-19  25%  476 aa  ATPB_NITWN RecName: Full=ATP synthase subunit beta;       
   47::412     1e-19  25%  473 aa  ATPB_GEOTN RecName: Full=ATP synthase subunit beta;       
   52::416     1e-19  25%  476 aa  ATPB_EMIHU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   15::406     1e-19  24%  465 aa  ATPB_CAMC1 RecName: Full=ATP synthase subunit beta;       
   59::497     1e-19  24%  528 aa  ATPB_BOVIN RecName: Full=ATP synthase subunit beta, mitochondrial; 
    6::253     2e-19  26%  253 aa  VATB_METTL RecName: Full=V-type ATP synthase beta chain;AltName:
   10::350     2e-19  24%  440 aa  VATB_GEOUR RecName: Full=V-type ATP synthase beta chain;AltName:
   76::425     2e-19  24%  449 aa  HRCN_PSESM RecName: Full=Type III secretion ATP synthase hrcN;     
   50::463     2e-19  25%  468 aa  ATPB_XANAC RecName: Full=ATP synthase subunit beta;       
   75::461     2e-19  25%  464 aa  ATPB_UREPA RecName: Full=ATP synthase subunit beta;       
   75::461     2e-19  25%  464 aa  ATPB_UREP2 RecName: Full=ATP synthase subunit beta;       
   32::432     2e-19  23%  458 aa  ATPB_NITOC RecName: Full=ATP synthase subunit beta;       
   59::447     2e-19  25%  476 aa  ATPB_MYCCT RecName: Full=ATP synthase subunit beta;       
   42::406     2e-19  25%  465 aa  ATPB_DESHY RecName: Full=ATP synthase subunit beta;       
   76::415     2e-19  28%  537 aa  ATPB_BARBK RecName: Full=ATP synthase subunit beta;       
   57::460     2e-19  24%  484 aa  ATPB_ARTS2 RecName: Full=ATP synthase subunit beta;       
    4::452     2e-19  26%  479 aa  ATPB_ANAPZ RecName: Full=ATP synthase subunit beta;       
   52::410     2e-19  24%  467 aa  ATPB_VIBAL RecName: Full=ATP synthase subunit beta;       
   48::446     2e-19  23%  475 aa  ATPB_RHIEC RecName: Full=ATP synthase subunit beta;       
   66::425     2e-19  26%  486 aa  ATPB_PROM5 RecName: Full=ATP synthase subunit beta;       
   45::406     2e-19  25%  464 aa  ATPB_PARUW RecName: Full=ATP synthase subunit beta;       
   45::467     2e-19  26%  474 aa  ATPB_NEOSM RecName: Full=ATP synthase subunit beta;       
   45::350     2e-19  27%  469 aa  ATPB_LACLS RecName: Full=ATP synthase subunit beta;       
   45::350     2e-19  27%  469 aa  ATPB_LACLM RecName: Full=ATP synthase subunit beta;       
   51::415     2e-19  26%  486 aa  ATPB_DENPU RecName: Full=ATP synthase subunit beta, chloroplastic; 
   57::362     2e-19  25%  481 aa  ATPB_CORJK RecName: Full=ATP synthase subunit beta;       
   76::464     2e-19  27%  465 aa  ATPB_BUCBP RecName: Full=ATP synthase subunit beta;       
   43::451     3e-19  24%  474 aa  ATPB_THAPS RecName: Full=ATP synthase subunit beta, chloroplastic; 
   46::446     3e-19  26%  474 aa  ATPB_RICPR RecName: Full=ATP synthase subunit beta;       
   42::406     3e-19  24%  465 aa  ATPB_DESHD RecName: Full=ATP synthase subunit beta;       
   47::340     3e-19  26%  464 aa  ATPB_BLOFL RecName: Full=ATP synthase subunit beta;       
   57::461     3e-19  24%  462 aa  ATPB_AERS4 RecName: Full=ATP synthase subunit beta;       
   49::148     3e-19  43%  148 aa  ATPA2_PIG RecName: Full=ATP synthase subunit alpha liver isoform,
  168::423     4e-19  28%  578 aa  VATA_METBA RecName: Full=V-type ATP synthase alpha chain;       
   11::433     4e-19  26%  473 aa  ATPB_PTEES RecName: Full=ATP synthase subunit beta, chloroplastic; 
   56::450     4e-19  25%  475 aa  ATPB_ODOSI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   57::362     4e-19  25%  482 aa  ATPB_CORA7 RecName: Full=ATP synthase subunit beta;       
   45::437     4e-19  24%  484 aa  ATPB_CAMLR RecName: Full=ATP synthase subunit beta;       
   15::437     4e-19  24%  465 aa  ATPB_CAMFF RecName: Full=ATP synthase subunit beta;       
   55::457     4e-19  27%  487 aa  ATPB1_GLUOX RecName: Full=ATP synthase subunit beta 1;       
   58::446     6e-19  24%  475 aa  ATPB_MYCMS RecName: Full=ATP synthase subunit beta;       
   49::413     6e-19  24%  471 aa  ATPB_HELMI RecName: Full=ATP synthase subunit beta;       
   45::437     6e-19  24%  465 aa  ATPB_CAMJR RecName: Full=ATP synthase subunit beta;       
   45::437     6e-19  24%  465 aa  ATPB_CAMJJ RecName: Full=ATP synthase subunit beta;       
   45::437     6e-19  24%  465 aa  ATPB_CAMJE RecName: Full=ATP synthase subunit beta;       
   45::437     6e-19  24%  484 aa  ATPB_CAMJD RecName: Full=ATP synthase subunit beta;       
   45::437     6e-19  24%  465 aa  ATPB_CAMJ8 RecName: Full=ATP synthase subunit beta;       
  101::414     6e-19  25%  536 aa  ATPB_BARQU RecName: Full=ATP synthase subunit beta;       
   21::354     7e-19  25%  467 aa  VATB_THENV RecName: Full=V-type ATP synthase beta chain;AltName:
   44::409     7e-19  25%  470 aa  ATPB_STAHJ RecName: Full=ATP synthase subunit beta;       
   51::342     7e-19  25%  460 aa  ATPB_NITEU RecName: Full=ATP synthase subunit beta;       
   65::340     7e-19  28%  480 aa  ATPB_LACJO RecName: Full=ATP synthase subunit beta;       
   65::340     7e-19  28%  480 aa  ATPB_LACGA RecName: Full=ATP synthase subunit beta;       
   48::334     7e-19  26%  464 aa  ATPB2_RHOS4 RecName: Full=ATP synthase subunit beta 2;       
   12::408     7e-19  26%  518 aa  ATPB2_RHOFD RecName: Full=ATP synthase subunit beta 2;       
   47::412     7e-19  25%  473 aa  ATPB2_LISW6 RecName: Full=ATP synthase subunit beta 2;       
   47::412     7e-19  25%  473 aa  ATPB2_LISMO RecName: Full=ATP synthase subunit beta 2;       
   47::412     7e-19  25%  473 aa  ATPB2_LISMF RecName: Full=ATP synthase subunit beta 2;       
   47::412     7e-19  25%  473 aa  ATPB2_LISIN RecName: Full=ATP synthase subunit beta 2;       
   52::410     7e-19  24%  467 aa  ATPB1_VIBHB RecName: Full=ATP synthase subunit beta 1;       
   44::439     9e-19  26%  464 aa  ATPB_MYCS5 RecName: Full=ATP synthase subunit beta;       
   57::451     9e-19  25%  476 aa  ATPB_GALSU RecName: Full=ATP synthase subunit beta, chloroplastic; 
  103::419     9e-19  26%  539 aa  ATPB_CAUCR RecName: Full=ATP synthase subunit beta;       
  108::524     9e-19  23%  538 aa  ATPB_CAEEL RecName: Full=ATP synthase subunit beta, mitochondrial; 
    3::464     9e-19  25%  465 aa  ATPB_BUCAT RecName: Full=ATP synthase subunit beta;       
    3::464     9e-19  25%  465 aa  ATPB_BUCAI RecName: Full=ATP synthase subunit beta;       
    3::464     9e-19  25%  465 aa  ATPB_BUCA5 RecName: Full=ATP synthase subunit beta;       
   44::443     9e-19  23%  474 aa  ATPB2_DINSH RecName: Full=ATP synthase subunit beta 2;       
   52::459     1e-18  24%  462 aa  ATPB_WIGBR RecName: Full=ATP synthase subunit beta;       
   46::356     1e-18  25%  474 aa  ATPB_RICTY RecName: Full=ATP synthase subunit beta;       
   56::452     1e-18  25%  475 aa  ATPB_PHATR RecName: Full=ATP synthase subunit beta, chloroplastic; 
   47::377     2e-18  28%  468 aa  ATPB_STRU0 RecName: Full=ATP synthase subunit beta;       
   66::425     2e-18  25%  486 aa  ATPB_PROMP RecName: Full=ATP synthase subunit beta;       
   60::474     2e-18  26%  478 aa  ATPB_ORITI RecName: Full=ATP synthase subunit beta;       
   47::409     2e-18  26%  468 aa  ATPB_STRSV RecName: Full=ATP synthase subunit beta;       
   59::423     2e-18  25%  483 aa  ATPB_RHOSR RecName: Full=ATP synthase subunit beta;       
   59::423     2e-18  25%  483 aa  ATPB_RHOOB RecName: Full=ATP synthase subunit beta;       
   60::362     2e-18  26%  478 aa  ATPB_ORITB RecName: Full=ATP synthase subunit beta;       
   50::414     2e-18  25%  476 aa  ATPB_DICAN RecName: Full=ATP synthase subunit beta, chloroplastic; 
  104::483     2e-18  23%  533 aa  ATPB_CHICK RecName: Full=ATP synthase subunit beta, mitochondrial; 
   45::437     2e-18  23%  465 aa  ATPB_CAMC5 RecName: Full=ATP synthase subunit beta;       
   47::359     2e-18  25%  480 aa  ATPB_BRASO RecName: Full=ATP synthase subunit beta;       
   45::354     2e-18  25%  475 aa  ATPB1_RHOS4 RecName: Full=ATP synthase subunit beta 1;       
   45::354     2e-18  25%  475 aa  ATPB1_RHOS1 RecName: Full=ATP synthase subunit beta 1;       
   47::359     2e-18  25%  480 aa  ATPB1_BRASB RecName: Full=ATP synthase subunit beta 1;       
   81::426     3e-18  26%  582 aa  VATA1_METHJ RecName: Full=V-type ATP synthase alpha chain 1;       
   47::409     3e-18  26%  468 aa  ATPB_STRS7 RecName: Full=ATP synthase subunit beta;       
   47::409     3e-18  26%  468 aa  ATPB_STREM RecName: Full=ATP synthase subunit beta;       
   47::409     3e-18  26%  468 aa  ATPB_STRE4 RecName: Full=ATP synthase subunit beta;       
   47::355     3e-18  25%  476 aa  ATPB_RHOPB RecName: Full=ATP synthase subunit beta;       
   47::355     3e-18  25%  476 aa  ATPB_RHOP2 RecName: Full=ATP synthase subunit beta;       
   63::478     3e-18  26%  481 aa  ATPB_PYLLI RecName: Full=ATP synthase subunit beta, chloroplastic; 
   52::472     3e-18  25%  475 aa  ATPB_GUITH RecName: Full=ATP synthase subunit beta, chloroplastic; 
   63::446     3e-18  26%  478 aa  ATPB_GLOVI RecName: Full=ATP synthase subunit beta;       
    2::335     3e-18  26%  396 aa  ATPB_ADIRA RecName: Full=ATP synthase subunit beta, chloroplastic; 
  154::491     4e-18  27%  579 aa  VATA_ANASK RecName: Full=V-type ATP synthase alpha chain;       
   47::359     4e-18  24%  476 aa  ATPB_RHOPA RecName: Full=ATP synthase subunit beta;       
   69::433     4e-18  26%  473 aa  ATPB_MICSZ RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::348     4e-18  26%  466 aa  ATPB_JANMA RecName: Full=ATP synthase subunit beta;       
   60::362     4e-18  24%  481 aa  ATPB_COREF RecName: Full=ATP synthase subunit beta;       
   44::356     4e-18  24%  477 aa  ATPB_BRAJA RecName: Full=ATP synthase subunit beta;       
   57::460     4e-18  23%  484 aa  ATPB_ARTCA RecName: Full=ATP synthase subunit beta;       
   55::354     5e-18  25%  467 aa  VATB_PYRIL RecName: Full=V-type ATP synthase beta chain;AltName:
   44::443     5e-18  24%  474 aa  ATPB_SILPO RecName: Full=ATP synthase subunit beta;       
   45::354     5e-18  24%  475 aa  ATPB_RHOS5 RecName: Full=ATP synthase subunit beta;       
    7::443     5e-18  24%  474 aa  ATPB_RHORU RecName: Full=ATP synthase subunit beta;       
    7::443     5e-18  24%  474 aa  ATPB_RHORT RecName: Full=ATP synthase subunit beta;       
   53::349     5e-18  25%  466 aa  ATPB_BUCAP RecName: Full=ATP synthase subunit beta;       
  154::424     6e-18  30%  584 aa  VATA2_METHJ RecName: Full=V-type ATP synthase alpha chain 2;       
   47::409     6e-18  26%  468 aa  ATPB_STRZP RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRZJ RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRT2 RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRR6 RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRPS RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRPN RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRPJ RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRPI RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRP7 RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRP4 RecName: Full=ATP synthase subunit beta;       
   47::409     6e-18  26%  468 aa  ATPB_STRP2 RecName: Full=ATP synthase subunit beta;       
   50::348     6e-18  25%  466 aa  ATPB_HERAR RecName: Full=ATP synthase subunit beta;       
  178::439     8e-18  26%  586 aa  VATA_HALMA RecName: Full=V-type ATP synthase alpha chain;       
   47::409     8e-18  26%  468 aa  ATPB_STRZT RecName: Full=ATP synthase subunit beta;       
   47::409     8e-18  26%  468 aa  ATPB_STRTD RecName: Full=ATP synthase subunit beta;       
   47::409     8e-18  26%  468 aa  ATPB_STRT1 RecName: Full=ATP synthase subunit beta;       
   47::409     8e-18  26%  468 aa  ATPB_STRA5 RecName: Full=ATP synthase subunit beta;       
   47::409     8e-18  26%  468 aa  ATPB_STRA1 RecName: Full=ATP synthase subunit beta;       
   47::355     8e-18  25%  476 aa  ATPB_RHOPS RecName: Full=ATP synthase subunit beta;       
   47::355     8e-18  25%  476 aa  ATPB_RHOP5 RecName: Full=ATP synthase subunit beta;       
   43::442     8e-18  24%  472 aa  ATPB_RHOCA RecName: Full=ATP synthase subunit beta;       
   55::354     1e-17  25%  467 aa  VATB_PYRAR RecName: Full=V-type ATP synthase beta chain;AltName:
  203::423     1e-17  30%  578 aa  VATA_METMA RecName: Full=V-type ATP synthase alpha chain;       
   64::461     1e-17  25%  483 aa  ATPB_OSTTA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::401     1e-17  24%  460 aa  ATPB_METCA RecName: Full=ATP synthase subunit beta;       
   57::362     1e-17  26%  481 aa  ATPB_CORDI RecName: Full=ATP synthase subunit beta;       
  155::423     1e-17  27%  578 aa  VATA_METBU RecName: Full=V-type ATP synthase alpha chain;       
  175::430     1e-17  27%  585 aa  VATA_HALSA RecName: Full=V-type ATP synthase alpha chain;       
  175::430     1e-17  27%  585 aa  VATA_HALS3 RecName: Full=V-type ATP synthase alpha chain;       
   47::409     1e-17  26%  468 aa  ATPB_STRGC RecName: Full=ATP synthase subunit beta;       
   44::353     1e-17  24%  474 aa  ATPB_ROSDO RecName: Full=ATP synthase subunit beta;       
   58::364     1e-17  22%  484 aa  ATPB_PROAC RecName: Full=ATP synthase subunit beta;       
   62::283     1e-17  27%  485 aa  ATPB_CYAPA RecName: Full=ATP synthase subunit beta, cyanelle;      
   18::459     1e-17  24%  486 aa  ATPB_ANAMM RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRMU RecName: Full=ATP synthase subunit beta;       
   76::409     2e-17  27%  468 aa  ATPB_STRA3 RecName: Full=ATP synthase subunit beta;       
   48::446     2e-17  24%  474 aa  ATPB_SORC5 RecName: Full=ATP synthase subunit beta;       
   59::423     2e-17  24%  483 aa  ATPB_RHOE4 RecName: Full=ATP synthase subunit beta;       
    2::449     2e-17  25%  479 aa  ATPB_MESFL RecName: Full=ATP synthase subunit beta;       
   23::318     2e-17  28%  434 aa  VATB_BORGA RecName: Full=V-type ATP synthase beta chain;AltName:
   23::318     2e-17  27%  434 aa  VATB_BORAP RecName: Full=V-type ATP synthase beta chain;AltName:
   23::381     2e-17  26%  430 aa  VATB1_TREPA RecName: Full=V-type ATP synthase beta chain 1;AltName:
  154::427     2e-17  29%  591 aa  VATA_NITOC RecName: Full=V-type ATP synthase alpha chain;       
  206::491     2e-17  27%  579 aa  VATA_ANAD2 RecName: Full=V-type ATP synthase alpha chain;       
   47::409     2e-17  26%  468 aa  ATPB_STRPM RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRPG RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRPF RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRPD RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRPC RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRPB RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRP8 RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRP6 RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRP3 RecName: Full=ATP synthase subunit beta;       
   47::409     2e-17  26%  468 aa  ATPB_STRP1 RecName: Full=ATP synthase subunit beta;       
   58::428     2e-17  22%  485 aa  ATPB_SALAI RecName: Full=ATP synthase subunit beta;       
   48::357     2e-17  26%  478 aa  ATPB_RHOBL RecName: Full=ATP synthase subunit beta;       
   46::356     3e-17  25%  473 aa  ATPB_RICRS RecName: Full=ATP synthase subunit beta;       
   46::356     3e-17  25%  473 aa  ATPB_RICRO RecName: Full=ATP synthase subunit beta;       
   46::356     3e-17  25%  473 aa  ATPB_RICPU RecName: Full=ATP synthase subunit beta;       
   46::356     3e-17  25%  473 aa  ATPB_RICM5 RecName: Full=ATP synthase subunit beta;       
   46::356     3e-17  25%  473 aa  ATPB_RICAE RecName: Full=ATP synthase subunit beta;       
    3::318     4e-17  26%  433 aa  VATB_BORHD RecName: Full=V-type ATP synthase beta chain;AltName:
  149::430     4e-17  30%  592 aa  VATA_SULIM RecName: Full=V-type ATP synthase alpha chain;       
  149::430     4e-17  30%  592 aa  VATA_SULIL RecName: Full=V-type ATP synthase alpha chain;       
  149::430     4e-17  30%  592 aa  VATA_SULIK RecName: Full=V-type ATP synthase alpha chain;       
  149::430     4e-17  30%  592 aa  VATA_SULIA RecName: Full=V-type ATP synthase alpha chain;       
    4::448     4e-17  25%  479 aa  ATPB_MARMM RecName: Full=ATP synthase subunit beta;       
   60::364     4e-17  25%  483 aa  ATPB_CORGL RecName: Full=ATP synthase subunit beta;       
   60::364     4e-17  25%  483 aa  ATPB_CORGB RecName: Full=ATP synthase subunit beta;       
   52::410     4e-17  24%  467 aa  ATPB_ALISL RecName: Full=ATP synthase subunit beta;       
   77::409     4e-17  26%  468 aa  ATPB2_PELLD RecName: Full=ATP synthase subunit beta 2;       
   43::318     5e-17  27%  433 aa  VATB_BORT9 RecName: Full=V-type ATP synthase beta chain;AltName:
  149::430     5e-17  30%  592 aa  VATA_SULIN RecName: Full=V-type ATP synthase alpha chain;       
  139::438     5e-17  26%  585 aa  VATA_NATPD RecName: Full=V-type ATP synthase alpha chain;       
  203::423     5e-17  30%  578 aa  VATA_METAC RecName: Full=V-type ATP synthase alpha chain;       
   44::469     5e-17  24%  478 aa  ATPB_XANP2 RecName: Full=ATP synthase subunit beta;       
   59::429     5e-17  22%  486 aa  ATPB_SALTO RecName: Full=ATP synthase subunit beta;       
   46::356     5e-17  25%  473 aa  ATPB_RICCN RecName: Full=ATP synthase subunit beta;       
   16::463     5e-17  24%  493 aa  ATPB_GLUDA RecName: Full=ATP synthase subunit beta;       
   23::391     7e-17  25%  431 aa  VATB_TREDE RecName: Full=V-type ATP synthase beta chain;AltName:
   49::453     7e-17  25%  484 aa  ATPB_ZYMMO RecName: Full=ATP synthase subunit beta;       
   53::446     7e-17  24%  473 aa  ATPB_RICCK RecName: Full=ATP synthase subunit beta;       
   46::446     7e-17  23%  473 aa  ATPB_RICAH RecName: Full=ATP synthase subunit beta;       
   13::417     7e-17  24%  477 aa  ATPB_BIGNA RecName: Full=ATP synthase subunit beta, chloroplastic; 
   70::409     7e-17  25%  531 aa  ATPB_BARHE RecName: Full=ATP synthase subunit beta;       
   23::318     9e-17  27%  434 aa  VATB_BORBZ RecName: Full=V-type ATP synthase beta chain;AltName:
   23::318     9e-17  27%  434 aa  VATB_BORBU RecName: Full=V-type ATP synthase beta chain;AltName:
  207::430     9e-17  30%  592 aa  VATA_SULIY RecName: Full=V-type ATP synthase alpha chain;       
   78::338     9e-17  26%  462 aa  ATPB_BLOPB RecName: Full=ATP synthase subunit beta;       
   44::447     9e-17  23%  478 aa  ATPB_AZOC5 RecName: Full=ATP synthase subunit beta;       
   52::377     9e-17  27%  470 aa  ATPB2_NITMU RecName: Full=ATP synthase subunit beta 2;       
   47::409     1e-16  25%  468 aa  ATPB_STRSY RecName: Full=ATP synthase subunit beta;       
   47::409     1e-16  25%  468 aa  ATPB_STRS2 RecName: Full=ATP synthase subunit beta;       
   47::409     1e-16  25%  468 aa  ATPB_STRPZ RecName: Full=ATP synthase subunit beta;       
    7::405     1e-16  24%  470 aa  ATPB_MYCMO RecName: Full=ATP synthase subunit beta;       
   49::469     1e-16  25%  502 aa  ATPB_AMOA5 RecName: Full=ATP synthase subunit beta;       
   53::411     1e-16  27%  474 aa  ATPB2_POLNA RecName: Full=ATP synthase subunit beta 2;       
  202::427     2e-16  30%  578 aa  VATA_ANADF RecName: Full=V-type ATP synthase alpha chain;       
  107::481     2e-16  24%  542 aa  ATPB_CAUSK RecName: Full=ATP synthase subunit beta;       
   37::408     2e-16  25%  465 aa  ATPB2_PSYIN RecName: Full=ATP synthase subunit beta 2;       
  211::440     2e-16  30%  593 aa  VATA_PYRIL RecName: Full=V-type ATP synthase alpha chain;       
  168::446     2e-16  26%  570 aa  VATA_NANEQ RecName: Full=V-type ATP synthase alpha chain;       
    1::333     2e-16  25%  395 aa  ATPB_MICPL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   50::472     2e-16  25%  502 aa  ATPB_CYTLY RecName: Full=ATP synthase subunit beta;       
  149::430     3e-16  29%  592 aa  VATA_SULSO RecName: Full=V-type ATP synthase alpha chain;       
  196::439     3e-16  27%  601 aa  VATA_HYPBU RecName: Full=V-type ATP synthase alpha chain;       
  206::491     3e-16  27%  579 aa  VATA_ANADE RecName: Full=V-type ATP synthase alpha chain;       
   25::361     3e-16  23%  443 aa  FLII_AQUAE RecName: Full=Flagellum-specific ATP synthase;       
   58::422     3e-16  24%  482 aa  ATPB_NOCFA RecName: Full=ATP synthase subunit beta;       
    1::333     3e-16  25%  395 aa  ATPB_BLEOC RecName: Full=ATP synthase subunit beta, chloroplastic; 
   23::439     3e-16  25%  500 aa  ATPB_AZOPC RecName: Full=ATP synthase subunit beta;       
   71::498     4e-16  27%  591 aa  VATA_STRZJ RecName: Full=V-type ATP synthase alpha chain;       
   71::498     4e-16  27%  591 aa  VATA_STRPN RecName: Full=V-type ATP synthase alpha chain;       
   71::498     4e-16  27%  591 aa  VATA_STRPJ RecName: Full=V-type ATP synthase alpha chain;       
  206::434     4e-16  31%  592 aa  VATA_STAMF RecName: Full=V-type ATP synthase alpha chain;       
  183::439     4e-16  26%  586 aa  VATA_HALVO RecName: Full=V-type ATP synthase alpha chain;       
   47::342     4e-16  25%  468 aa  ATPB_ENTFA RecName: Full=ATP synthase subunit beta;       
  193::498     7e-16  28%  591 aa  VATA_STRP4 RecName: Full=V-type ATP synthase alpha chain;       
  165::432     7e-16  26%  585 aa  VATA_HALWD RecName: Full=V-type ATP synthase alpha chain;       
  211::440     1e-15  28%  594 aa  VATA_PYRCJ RecName: Full=V-type ATP synthase alpha chain;       
  202::429     1e-15  33%  581 aa  VATA_ARCFU RecName: Full=V-type ATP synthase alpha chain;       
   55::361     1e-15  25%  480 aa  ATPB_STRGG RecName: Full=ATP synthase subunit beta;       
   47::274     1e-15  25%  476 aa  ATPB_NITHX RecName: Full=ATP synthase subunit beta;       
   72::473     1e-15  24%  504 aa  ATPB_EHRRW RecName: Full=ATP synthase subunit beta;       
   72::473     1e-15  24%  504 aa  ATPB_EHRRG RecName: Full=ATP synthase subunit beta;       
   71::498     1e-15  26%  591 aa  VATA_STRPI RecName: Full=V-type ATP synthase alpha chain;       
  211::440     1e-15  28%  593 aa  VATA_PYRAE RecName: Full=V-type ATP synthase alpha chain;       
  211::410     2e-15  28%  594 aa  VATA_THENV RecName: Full=V-type ATP synthase alpha chain;       
  208::431     2e-15  28%  592 aa  VATA_SULAC RecName: Full=V-type ATP synthase alpha chain;       
  160::364     2e-15  28%  581 aa  VATA_METLZ RecName: Full=V-type ATP synthase alpha chain;       
   51::473     2e-15  26%  503 aa  ATPB_GRAFK RecName: Full=ATP synthase subunit beta;       
   76::342     2e-15  27%  468 aa  ATPB_ENTHR RecName: Full=ATP synthase subunit beta;       
  155::423     2e-15  29%  578 aa  VATA_THET8 RecName: Full=V-type ATP synthase alpha chain;       
  155::423     2e-15  29%  578 aa  VATA_THET2 RecName: Full=V-type ATP synthase alpha chain;       
  211::410     2e-15  28%  593 aa  VATA_PYRAR RecName: Full=V-type ATP synthase alpha chain;       
  158::433     2e-15  26%  592 aa  VATA_METKA RecName: Full=V-type ATP synthase alpha chain;       
   55::359     2e-15  24%  478 aa  ATPB_STRLI RecName: Full=ATP synthase subunit beta;       
   55::359     2e-15  24%  478 aa  ATPB_STRCO RecName: Full=ATP synthase subunit beta;       
  174::429     3e-15  26%  584 aa  VATA_METMJ RecName: Full=V-type ATP synthase alpha chain;       
  207::430     3e-15  29%  592 aa  VATA1_CLOTE RecName: Full=V-type ATP synthase alpha chain 1;       
   57::363     4e-15  23%  484 aa  ATPB_RENSM RecName: Full=ATP synthase subunit beta;       
   47::355     4e-15  24%  476 aa  ATPB_OLICO RecName: Full=ATP synthase subunit beta;       
  209::431     5e-15  30%  592 aa  VATA_SULTO RecName: Full=V-type ATP synthase alpha chain;       
  207::430     5e-15  29%  591 aa  VATA_METS5 RecName: Full=V-type ATP synthase alpha chain;       
  209::437     5e-15  29%  588 aa  VATA3_METHJ RecName: Full=V-type ATP synthase alpha chain 3;       
   63::455     5e-15  26%  481 aa  ATPB_DICDH RecName: Full=ATP synthase subunit beta, chloroplastic; 
   55::477     5e-15  25%  511 aa  ATPB_BACV8 RecName: Full=ATP synthase subunit beta;       
  192::429     6e-15  31%  593 aa  NTPA_ENTHR RecName: Full=V-type sodium ATPase catalytic subunit A; 
   46::356     6e-15  23%  474 aa  ATPB_RICFE RecName: Full=ATP synthase subunit beta;       
  177::432     1e-14  27%  588 aa  VATA_METB6 RecName: Full=V-type ATP synthase alpha chain;       
   64::413     1e-14  24%  475 aa  ATPB_WOLWR RecName: Full=ATP synthase subunit beta;       
   44::443     1e-14  22%  474 aa  ATPB_PARDP RecName: Full=ATP synthase subunit beta;       
   51::473     1e-14  26%  503 aa  ATPB_FLAPJ RecName: Full=ATP synthase subunit beta;       
  217::444     1e-14  29%  596 aa  VATA_IGNH4 RecName: Full=V-type ATP synthase alpha chain;       
   64::346     2e-14  25%  475 aa  ATPB_WOLPM RecName: Full=ATP synthase subunit beta;       
   61::386     2e-14  24%  537 aa  ATPB1_PSEA6 RecName: Full=ATP synthase subunit beta 1;       
  208::430     2e-14  29%  596 aa  VATA_STRSV RecName: Full=V-type ATP synthase alpha chain;       
  208::430     2e-14  29%  596 aa  VATA_STRGC RecName: Full=V-type ATP synthase alpha chain;       
  183::432     2e-14  27%  592 aa  VATA2_CLOTE RecName: Full=V-type ATP synthase alpha chain 2;       
   46::446     2e-14  23%  473 aa  ATPB_RICB8 RecName: Full=ATP synthase subunit beta;       
   51::473     2e-14  25%  503 aa  ATPB_FLAJ1 RecName: Full=ATP synthase subunit beta;       
  207::428     3e-14  25%  585 aa  VATA_THEGJ RecName: Full=V-type ATP synthase alpha chain;       
  156::429     3e-14  25%  593 aa  VATA_ENTFA RecName: Full=V-type ATP synthase alpha chain;       
  207::428     3e-14  25%  585 aa  VATA_DESSY RecName: Full=V-type ATP synthase alpha chain;       
  158::426     3e-14  27%  582 aa  VATA_DEIGD RecName: Full=V-type ATP synthase alpha chain;       
  208::429     3e-14  28%  589 aa  VATA_CLOTH RecName: Full=V-type ATP synthase alpha chain;       
  198::417     3e-14  26%  589 aa  VATA1_TREPA RecName: Full=V-type ATP synthase alpha chain 1;       
    4::346     3e-14  24%  478 aa  ATPB_WOLPP RecName: Full=ATP synthase subunit beta;       
   58::448     3e-14  23%  475 aa  ATPB_GRATL RecName: Full=ATP synthase subunit beta, chloroplastic; 
   55::354     4e-14  24%  467 aa  VATB_PYRAE RecName: Full=V-type ATP synthase beta chain;AltName:
  106::431     4e-14  28%  592 aa  VATA_NITMS RecName: Full=V-type ATP synthase alpha chain;       
   55::359     4e-14  23%  478 aa  ATPB_STRAW RecName: Full=ATP synthase subunit beta;       
  197::424     5e-14  26%  579 aa  VATA_UNCMA RecName: Full=V-type ATP synthase alpha chain;       
  208::430     5e-14  26%  592 aa  VATA_CLOBM RecName: Full=V-type ATP synthase alpha chain;       
  206::428     5e-14  26%  590 aa  VATA_CLOBL RecName: Full=V-type ATP synthase alpha chain;       
  208::430     5e-14  26%  592 aa  VATA_CLOBK RecName: Full=V-type ATP synthase alpha chain;       
  191::430     7e-14  30%  591 aa  VATA_STRP8 RecName: Full=V-type ATP synthase alpha chain;       
  215::463     7e-14  27%  617 aa  VATA_ASHGO RecName: Full=V-type proton ATPase catalytic subunit A; 
  191::430     9e-14  28%  591 aa  VATA_STRPM RecName: Full=V-type ATP synthase alpha chain;       
  191::430     9e-14  28%  591 aa  VATA_STRPG RecName: Full=V-type ATP synthase alpha chain;       
  191::430     9e-14  28%  591 aa  VATA_STRPF RecName: Full=V-type ATP synthase alpha chain;       
  191::430     9e-14  28%  591 aa  VATA_STRPD RecName: Full=V-type ATP synthase alpha chain;       
  191::430     9e-14  28%  591 aa  VATA_STRPC RecName: Full=V-type ATP synthase alpha chain;       
  191::430     9e-14  28%  591 aa  VATA_STRPB RecName: Full=V-type ATP synthase alpha chain;       
  191::430     9e-14  28%  591 aa  VATA_STRP6 RecName: Full=V-type ATP synthase alpha chain;       
  191::430     9e-14  28%  591 aa  VATA_STRP1 RecName: Full=V-type ATP synthase alpha chain;       
  223::448     9e-14  30%  593 aa  VATA_PARUW RecName: Full=V-type ATP synthase alpha chain;       
  156::429     9e-14  26%  592 aa  VATA_CLOD6 RecName: Full=V-type ATP synthase alpha chain;       
   46::446     9e-14  23%  473 aa  ATPB_RICBR RecName: Full=ATP synthase subunit beta;       
  207::428     1e-13  25%  585 aa  VATA_THESM RecName: Full=V-type ATP synthase alpha chain;       
  207::428     1e-13  25%  585 aa  VATA_THESI RecName: Full=V-type ATP synthase alpha chain;       
  191::430     1e-13  28%  591 aa  VATA_STRPZ RecName: Full=V-type ATP synthase alpha chain;       
  191::430     1e-13  28%  591 aa  VATA_STRP3 RecName: Full=V-type ATP synthase alpha chain;       
  207::428     1e-13  25%  585 aa  VATA_PYRKO RecName: Full=V-type ATP synthase alpha chain;       
  210::466     1e-13  27%  623 aa  VATA_GOSHI RecName: Full=V-type proton ATPase catalytic subunit A; 
   74::475     1e-13  23%  507 aa  ATPB_EHRCJ RecName: Full=ATP synthase subunit beta;       
   38::322     2e-13  23%  438 aa  VATB_CHLFF RecName: Full=V-type ATP synthase beta chain;AltName:
  205::426     2e-13  27%  582 aa  VATA_DEIRA RecName: Full=V-type ATP synthase alpha chain;       
  190::436     2e-13  27%  605 aa  VATA2_TREPA RecName: Full=V-type ATP synthase alpha chain 2;       
   74::377     2e-13  23%  507 aa  ATPB_EHRCR RecName: Full=ATP synthase subunit beta;       
  204::430     2e-13  27%  590 aa  VATA_HALOH RecName: Full=V-type ATP synthase alpha chain;       
   38::322     3e-13  24%  438 aa  VATB_CHLCV RecName: Full=V-type ATP synthase beta chain;AltName:
  208::429     3e-13  26%  590 aa  VATA_THEPX RecName: Full=V-type ATP synthase alpha chain;       
  208::429     3e-13  26%  590 aa  VATA_THEP3 RecName: Full=V-type ATP synthase alpha chain;       
  207::428     3e-13  25%  585 aa  VATA_THEON RecName: Full=V-type ATP synthase alpha chain;       
  205::428     3e-13  27%  590 aa  VATA_CLOBH RecName: Full=V-type ATP synthase alpha chain;       
  205::428     3e-13  27%  590 aa  VATA_CLOB1 RecName: Full=V-type ATP synthase alpha chain;       
   38::322     3e-13  25%  438 aa  VATB_CHLAB RecName: Full=V-type ATP synthase beta chain;AltName:
   53::473     3e-13  24%  505 aa  ATPB_BACFR RecName: Full=ATP synthase subunit beta;       
   53::473     3e-13  24%  505 aa  ATPB_BACFN RecName: Full=ATP synthase subunit beta;       
  205::426     5e-13  27%  582 aa  VATA_DEIDV RecName: Full=V-type ATP synthase alpha chain;       
  223::450     8e-13  29%  611 aa  VATA_PLAFA RecName: Full=V-type proton ATPase catalytic subunit A; 
  223::450     8e-13  29%  611 aa  VATA_PLAF7 RecName: Full=V-type proton ATPase catalytic subunit A; 
  175::360     8e-13  27%  576 aa  VATA_METTP RecName: Full=V-type ATP synthase alpha chain;       
  180::429     8e-13  26%  586 aa  VATA_METM7 RecName: Full=V-type ATP synthase alpha chain;       
   36::474     8e-13  25%  505 aa  ATPB_PARD8 RecName: Full=ATP synthase subunit beta;       
  208::429     1e-12  28%  585 aa  VATA_METST RecName: Full=V-type ATP synthase alpha chain;       
  197::416     1e-12  26%  575 aa  VATA_BORBZ RecName: Full=V-type ATP synthase alpha chain;       
  197::416     1e-12  26%  575 aa  VATA_BORBU RecName: Full=V-type ATP synthase alpha chain;       
  193::409     2e-12  28%  584 aa  VATA_METS3 RecName: Full=V-type ATP synthase alpha chain;       
  175::464     2e-12  27%  618 aa  VATA_DICDI RecName: Full=V-type proton ATPase catalytic subunit A; 
  207::429     2e-12  28%  592 aa  VATA_CLOBB RecName: Full=V-type ATP synthase alpha chain;       
  210::466     2e-12  27%  623 aa  VATA_BETVU RecName: Full=V-type proton ATPase catalytic subunit A; 
  197::416     2e-12  26%  575 aa  VATA_BORGA RecName: Full=V-type ATP synthase alpha chain;       
  210::466     3e-12  26%  623 aa  VATA_PHAAU RecName: Full=V-type proton ATPase catalytic subunit A; 
  207::429     3e-12  28%  592 aa  VATA_CLOBA RecName: Full=V-type ATP synthase alpha chain;       
   68::469     3e-12  25%  496 aa  ATPB_SULMW RecName: Full=ATP synthase subunit beta;       
  216::470     4e-12  25%  619 aa  VATA_SCHPO RecName: Full=V-type proton ATPase catalytic subunit A; 
  167::422     4e-12  27%  580 aa  VATA_HORVU RecName: Full=V-type proton ATPase catalytic subunit A; 
   38::322     5e-12  23%  438 aa  VATB_CHLPN RecName: Full=V-type ATP synthase beta chain;AltName:
  192::429     5e-12  26%  586 aa  VATA_METMP RecName: Full=V-type ATP synthase alpha chain;       
  192::429     5e-12  26%  586 aa  VATA_METM6 RecName: Full=V-type ATP synthase alpha chain;       
  210::431     5e-12  28%  587 aa  VATA_METJA RecName: Full=V-type ATP synthase alpha chain;       
  212::416     5e-12  26%  575 aa  VATA_BORAP RecName: Full=V-type ATP synthase alpha chain;       
   53::473     5e-12  23%  505 aa  ATPB_BACTN RecName: Full=ATP synthase subunit beta;       
  205::451     7e-12  26%  610 aa  VATA_TRYCO RecName: Full=V-type proton ATPase catalytic subunit A; 
  192::429     7e-12  26%  586 aa  VATA_METVS RecName: Full=V-type ATP synthase alpha chain;       
  148::404     7e-12  26%  561 aa  VATA_MAIZE RecName: Full=V-type proton ATPase catalytic subunit A; 
  212::466     7e-12  26%  623 aa  VATA_CITUN RecName: Full=V-type proton ATPase catalytic subunit A; 
  197::378     7e-12  27%  579 aa  VATA_BORHD RecName: Full=V-type ATP synthase alpha chain;       
   54::269     7e-12  26%  468 aa  ATPB_LEPBP RecName: Full=ATP synthase subunit beta;       
   54::269     7e-12  26%  468 aa  ATPB_LEPBA RecName: Full=ATP synthase subunit beta;       
  190::417     9e-12  25%  589 aa  VATA_TREDE RecName: Full=V-type ATP synthase alpha chain;       
  438::612     9e-12  25%  776 aa  VATA_THEVO RecName: Full=V-type ATP synthase alpha chain;       
  192::429     9e-12  27%  586 aa  VATA_METM5 RecName: Full=V-type ATP synthase alpha chain;       
  197::378     9e-12  27%  576 aa  VATA_BORT9 RecName: Full=V-type ATP synthase alpha chain;       
  682::869     1e-11  30% 1013 aa  VATA_PYRFU RecName: Full=V-type ATP synthase alpha chain;       
  210::466     1e-11  26%  623 aa  VATA_DAUCA RecName: Full=V-type proton ATPase catalytic subunit A; 
  210::466     1e-11  26%  623 aa  VATA_BRANA RecName: Full=V-type proton ATPase catalytic subunit A; 
  200::447     1e-11  27%  613 aa  VATA2_ACEAT RecName: Full=V-type proton ATPase catalytic subunit A
  207::524     1e-11  26%  614 aa  VATA1_DROME RecName: Full=V-type proton ATPase catalytic subunit A
  200::447     1e-11  27%  613 aa  VATA1_ACEAT RecName: Full=V-type proton ATPase catalytic subunit A
  209::373     1e-11  30%  584 aa  VATA_METTH RecName: Full=V-type ATP synthase alpha chain;       
  209::430     1e-11  27%  586 aa  VATA_META3 RecName: Full=V-type ATP synthase alpha chain;       
  221::455     1e-11  25%  607 aa  VATA_ENCCU RecName: Full=V-type proton ATPase catalytic subunit A; 
  207::453     1e-11  26%  614 aa  VATA_AEDAL RecName: Full=V-type proton ATPase catalytic subunit A; 
  207::453     1e-11  26%  614 aa  VATA_AEDAE RecName: Full=V-type proton ATPase catalytic subunit A; 
  207::453     1e-11  26%  614 aa  VATA2_DROME RecName: Full=V-type proton ATPase catalytic subunit A
   38::320     2e-11  23%  438 aa  VATB_CHLMU RecName: Full=V-type ATP synthase beta chain;AltName:
  426::600     2e-11  24%  764 aa  VATA_THEAC RecName: Full=V-type ATP synthase alpha chain;       
  204::452     2e-11  23%  607 aa  VATA_NEUCR RecName: Full=V-type proton ATPase catalytic subunit A; 
  210::456     2e-11  26%  617 aa  VATA_MANSE RecName: Full=V-type proton ATPase catalytic subunit A; 
  212::466     2e-11  26%  623 aa  VATA_ARATH RecName: Full=V-type proton ATPase catalytic subunit A; 
   44::443     2e-11  21%  474 aa  ATPB_JANSC RecName: Full=ATP synthase subunit beta;       
   76::216     2e-11  26%  228 aa  ATPB_DROVI RecName: Full=ATP synthase subunit beta, mitochondrial; 
  207::453     2e-11  26%  614 aa  VATA_ANOGA RecName: Full=V-type proton ATPase catalytic subunit A; 
  633::807     4e-11  29%  964 aa  VATA_PYRHO RecName: Full=V-type ATP synthase alpha chain;       
  686::860     4e-11  29% 1017 aa  VATA_PYRAB RecName: Full=V-type ATP synthase alpha chain;       
  179::428     4e-11  25%  591 aa  VATA_CLONN RecName: Full=V-type ATP synthase alpha chain;       
  106::431     4e-11  24%  592 aa  VATA_CENSY RecName: Full=V-type ATP synthase alpha chain;       
  219::472     6e-11  28%  591 aa  VATA_CHLPN RecName: Full=V-type ATP synthase alpha chain;       
  217::444     6e-11  25%  597 aa  VATA_AERPE RecName: Full=V-type ATP synthase alpha chain;       
  255::429     9e-11  27%  591 aa  VATA_CLOPS RecName: Full=V-type ATP synthase alpha chain;       
  255::429     9e-11  27%  591 aa  VATA_CLOPE RecName: Full=V-type ATP synthase alpha chain;       
  255::429     9e-11  27%  591 aa  VATA_CLOP1 RecName: Full=V-type ATP synthase alpha chain;       
  224::456     9e-11  26%  617 aa  VATA_CHICK RecName: Full=V-type proton ATPase catalytic subunit A; 
   38::320     1e-10  23%  438 aa  VATB_CHLTR RecName: Full=V-type ATP synthase beta chain;AltName:
   38::320     1e-10  23%  438 aa  VATB_CHLTA RecName: Full=V-type ATP synthase beta chain;AltName:
  210::449     1e-10  25%  587 aa  VATA_CYACA RecName: Full=V-type proton ATPase catalytic subunit A; 
  199::445     2e-10  25%  606 aa  VATA_CAEBR RecName: Full=V-type proton ATPase catalytic subunit A; 
    4::346     2e-10  23%  480 aa  ATPB_WOLTR RecName: Full=ATP synthase subunit beta;       
   35::439     2e-10  23%  500 aa  ATPB_SALRD RecName: Full=ATP synthase subunit beta;       
   38::320     2e-10  24%  438 aa  VATB_CHLTB RecName: Full=V-type ATP synthase beta chain;AltName:
   38::320     2e-10  24%  438 aa  VATB_CHLT2 RecName: Full=V-type ATP synthase beta chain;AltName:
  197::366     2e-10  28%  576 aa  VATA_BORDL RecName: Full=V-type ATP synthase alpha chain;       
   76::153     3e-10  36%  990 aa  VATB_METKA RecName: Full=V-type ATP synthase beta chain;AltName:
  224::456     3e-10  25%  617 aa  VATA_PONAB RecName: Full=V-type proton ATPase catalytic subunit A; 
  224::456     3e-10  25%  617 aa  VATA_MOUSE RecName: Full=V-type proton ATPase catalytic subunit A; 
  224::456     3e-10  25%  617 aa  VATA_HUMAN RecName: Full=V-type proton ATPase catalytic subunit A; 
  219::459     3e-10  26%  591 aa  VATA_CHLMU RecName: Full=V-type ATP synthase alpha chain;       
  219::457     3e-10  27%  591 aa  VATA_CHLCV RecName: Full=V-type ATP synthase alpha chain;       
  199::444     3e-10  25%  606 aa  VATA_CAEEL RecName: Full=V-type proton ATPase catalytic subunit A; 
  224::456     3e-10  25%  617 aa  VATA_BOVIN RecName: Full=V-type proton ATPase catalytic subunit A; 
  224::456     4e-10  25%  617 aa  VATA_PIG RecName: Full=V-type proton ATPase catalytic subunit A;   
  219::459     4e-10  26%  591 aa  VATA_CHLTR RecName: Full=V-type ATP synthase alpha chain;       
  219::459     4e-10  26%  591 aa  VATA_CHLTB RecName: Full=V-type ATP synthase alpha chain;       
  219::459     4e-10  26%  591 aa  VATA_CHLTA RecName: Full=V-type ATP synthase alpha chain;       
  219::459     4e-10  26%  591 aa  VATA_CHLT2 RecName: Full=V-type ATP synthase alpha chain;       
   38::318     8e-10  20%  438 aa  VATB_PARUW RecName: Full=V-type ATP synthase beta chain;AltName:
  219::444     8e-10  27%  591 aa  VATA_CHLAB RecName: Full=V-type ATP synthase alpha chain;       
  197::366     1e-09  28%  576 aa  VATA_BORRA RecName: Full=V-type ATP synthase alpha chain;       
   49::469     1e-09  23%  501 aa  ATPB_CYTH3 RecName: Full=ATP synthase subunit beta;       
    6::94      3e-09  24%  601 aa  VATA_THEPD RecName: Full=V-type ATP synthase alpha chain;       
  806::934     5e-09  30% 1088 aa  VATA_CANTR RecName: Full=V-type proton ATPase catalytic subunit A; 
  789::917     9e-09  32% 1071 aa  VATA_YEAST RecName: Full=V-type proton ATPase catalytic subunit A; 
    3::57      5e-07  42%   58 aa  YLC7_YEREN RecName: Full=Uncharacterized protein in lcrE
   16::81      2e-06  44%   98 aa  ATPA_POPEU RecName: Full=ATP synthase subunit alpha, chloroplastic;
   68::245     5e-06  27%  284 aa  ATPB_ASPND RecName: Full=ATP synthase subunit beta, chloroplastic; 
  305::461     1e-04  22%  610 aa  RHO_MYCLE RecName: Full=Transcription termination factor rho;      
  434::554     4e-04  31%  707 aa  RHO_STRLI RecName: Full=Transcription termination factor rho;      
  127::194     4e-04  33%  426 aa  RHO_DEIRA RecName: Full=Transcription termination factor rho;      
  337::453     7e-04  23%  602 aa  RHO_MYCTU RecName: Full=Transcription termination factor rho;      
  337::453     7e-04  23%  602 aa  RHO_MYCBO RecName: Full=Transcription termination factor rho;      
    1::515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLER
ATPA_NITOC      MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLER
ATPA1_METCA     --MQLNASEISDLIKQRIGKFDLGVESRSEGTIVSLTDGIVRIHGLQDVMQGEMVEFPGNTYGMALNLER
ATPA_THISH      --MQLNPTEISELIKKRIASYDAAAQARTEGTVVSLSDGIVRLHGLADVMQGEMIEFPGNTYGLALNLER
ATPA_ALHEH      --MQLNPSEISELIKRRIENFEAVAEARNQGTIVSVGDGICRIHGLADAMQGEMLEFPNDTFGMALNLER
ATPA_SACD2      ---QLNPSEISEIIKQRIDNLAVSTEAQNEGTVVSVTDGIIRIHGLADVMYGEMIEFEGGVYGIALNLER
ATPA_HALHL      --MQVNPSEISELIKRRIENFDAAAEARNEGTVVSVGDGICRIHGLADVMFGEMLEFPDDTFGMALNLER
ATPA2_LEGPH     -QVALNPSEISELIRKKIDQFSVVSEARNEGTIVSLKDGIVRLHGLADVMAGEMIEFPGGVYGLALNLER
ATPA2_LEGPA     -QVALNPSEISELIRKKIDQFSVVSEARNEGTIVSLKDGIVRLHGLADVMAGEMIEFPGGVYGLALNLER
ATPA_LEGPL      -QVALNPSEISELIRKKIDQFSVVSEARNEGTIVSLKDGIVRLHGLADVMAGEMIEFPGGVYGLALNLER
ATPA2_LEGPC     -QVALNPSEISELIRKKIDQFSVVSEARNEGTIVSLKDGIVRLHGLADVMAGEMIEFPGGVYGLALNLKR
ATPA_TERTT      ---QLNPSEISEIIKARIDNLSVTTEAQNEGTVVSVTDGIIRIHGLAEVMYGEMIEFEGGVYGIALNLER
ATPA_CHRSD      ---QLNPSEISDIIKQRIEKLDVASEARNEGTVVSVSDGIVKIHGLADAMFGEMIEFPGSIFGMVLNLER
ATPA1_NITMU     --MHLNPSEISELIKSRIEGLEATAEVRTQGTVVSVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_METFK      --MQLSTSEISELIKSRLENFSTSAEARTQGTVISVTDGIVRIHGLSNVMAGEMIEFPGNVYGLALNLER
ATPA_RALPJ      --MQLNPSEISDLIKTRIEGLKAGADAKNTGTVISVTDGICRIHGLSGVMQGEMLEFPGNTFGLALNLER
ATPA_RUTMC      --MQLNAHEISDLIKKQIEGFDFDAEVRTEGSVVSVSDGIVRIHGLADVQFGEMLEFPNNTFGMALNLEQ
ATPA_RALSO      --MQLNPSEISDLIKTRIEGLKAGADAKNTGTVISVTDGICRIHGLSGVMQGEMLEFPGNTFGLALNLER
ATPA_ALTMD      --MQLNSTEIAELIKKRIEQFNVSSEARNEGTIVAVTDGIIRIHGLADVMQGEMIELPGSRYAIALNLER
ATPA_MARAV      ---QLNPSEISDIIKKRIEKLDISSEAKNEGTILSVSDGIVLIHGLADVMYGEMIEFANGTYGMALNLER
ATPA_RALEH      --MQLNPSEISELIKSRISGLGAEAEVRNTGTVISVTDGICRVHGLSGVMQGEMLEFPGNTFGLALNLER
ATPA2_HAHCH     ---QLNPXXXXXXXXXXXXXLDISSEAKTEGTIVSVSDGIVLIHGLADVMYGEMIEFEGGVYGLALNLER
ATPA_IDILO      --MQLNSNEIAELIKQRIEKFEVTSEARNEGTIMSVQDGIIRIHGLADCLQGEMVELPGNRYAIALNLER
ATPA_ALCBS      ---QLNPSEISEIIKSRIAKLDTSTEARNEGTVVSVSDGIVRIHGLADVMFGEMIEFEGGIYGMALNLEQ
ATPA_RALME      --MQLNPSEISELIKSRISGLGADAEVRNTGTVISVTDGICRVHGLSGVMQGEMLEFPGNTYGLALNLER
ATPA_BURM1      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_THIDA      --MQLNPSEISELIKAKIENLGASSELRTQGTIVSVTDGIVRIHGLSDVMSGEMIEMPGNTFGVALNLER
ATPA_BURCM      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_BURA4      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA1_BURTA     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_BURVG      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA1_BURPS     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA1_BURP6     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA1_BURP1     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA1_BURP0     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_RALEJ      --MQLNPSEISELIKSRISGLGADAEVRNTGTVISVTDGICRVHGLSGVMQGEMLEFPGNTFGLALNLER
ATPA_BURM9      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA1_BURMS     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA1_BURMA     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA1_BURM7     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_BURCJ      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_VESOH      --MQLNAHEISDLIKKQIEGFDFTAEARTEGSVVSVSDGIVRIHGLGDVQFGEMIEFSNNTFGMALNLEQ
ATPA_BURCH      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_BURCC      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_BURCA      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_THICR      --MQLNASEISNLIKDRIKGFDGAAESGSEGTVVSIADGIALIHGVSDVMYGEMVQFDEATFGMALNLER
ATPA_BURS3      --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA2_BURXL     --MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSEVMQGEMLEFPGNTFGLALNLER
ATPA_DECAR      --MQLNPSEISELIKSKIQNLQGASEVRTQGTVVSVTDGICRVHGLQDVMQGEMLEFPGNTFGMALNLER
ATPA_AZOSE      --MQLNPSEISDLIKSRIQNLQLAATSRNEGTVVSVTDGITRVHGLADVMQGEMLEFPGNTFGLALNLER
ATPA_PSEAE      ---QLNPSEISEIIKGRIEKLDVASQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYGMALNLEQ
ATPA_PSEAB      ---QLNPSEISEIIKGRIEKLDVASQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYGMALNLEQ
ATPA_PSEA8      ---QLNPSEISEIIKGRIEKLDVASQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYGMALNLEQ
ATPA_PSEA7      ---QLNPSEISEIIKGRIEKLDVASQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYGMALNLEQ
ATPA_AZOSB      --MQLNPSEISDLIKSRIQNLQLAATSRNEGTVVSVTDGITRIHGLTDVMQGEMLEFPGNTFGLALNLER
ATPA_PSEMY      ---QLNPSEISEIIKQRIESLDVTAQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYGMALNLEQ
ATPA_NEIMF      --MQLNPAEISDLIKAKIENLSVNAEVRTRGTVVSVTDGIVRIHGLSDAMQGEMLEFPGNTFGLAMNLER
ATPA_NEIM0      --MQLNPAEISDLIKAKIENLSVNAEVRTRGTVISVTDGIVRIHGLSDAMQGEMLEFPGNTFGLAMNLER
ATPA_HERAR      --MQLNPSEISELIKSRIQGLGESAEIRNQGTVISVSDGICRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_CELJU      ---QLNPSEISEIIKQRIAGLEFSTEAQNEGTVVSVTDGIIRIHGLAEVMYGEMIEFEGGVYGMALNLER
ATPA_NEIMB      --MQLNPAEISDLIKAKIENLSVNAEVRTCGTVISVTDGIVRIHGLSDAMQGEMLEFPGNTFGLAMNLER
ATPA_NEIMA      --MQLNPAEISDLIKAKIENLSVNAEVRTRGTVISVTDGIVRIHGLSDAMQGEMLEFPGNTFGLAMNLER
ATPA_CHRVO      --MQLNPSEISDLIKAKIQNLAEGAEVRTKGTVISVTDGIVRIHGLADVMQGEMLEFPGNTFGLAMNLER
ATPA_JANMA      --MQLNPSEISELIKSRIQGLGDTAEIRNQGTVISVSDGICRIHGLSDVMQGEMLEFPGNTFGLALNLER
ATPA_NEIG1      --MQLNPAEISDLIKAKIENLSVNAEVSTRGTVISVTDGIVRIHGLSDAMQGEMLEFPGNTLGLAMNLER
ATPA_STRMK      MATTLNPSEISELIKNRIEKVKLAAESRNEGTVTSVSDGIVRIFGLADVMQGEMIELPNNTFALALNLER
ATPA_BORA1      --MQLNPSEISELLKSRIEGLGASTDVRTQGTVVSVTD