[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for noce0:ABA59518.1

[Show Plain Result]


## Summary of Sequence Search
    1::178
    1::178     5e-95 100%  178 aa  ATPD_NITOC RecName: Full=ATP synthase subunit delta;AltName:
    1::179     1e-47  50%  179 aa  ATPD_ALHEH RecName: Full=ATP synthase subunit delta;AltName:
    1::178     9e-43  49%  178 aa  ATPD_HALHL RecName: Full=ATP synthase subunit delta;AltName:
    1::176     8e-42  45%  178 aa  ATPD_THISH RecName: Full=ATP synthase subunit delta;AltName:
    1::176     1e-41  47%  178 aa  ATPD_PSEAE RecName: Full=ATP synthase subunit delta;AltName:
    1::176     1e-41  47%  178 aa  ATPD_PSEAB RecName: Full=ATP synthase subunit delta;AltName:
    1::176     1e-41  47%  178 aa  ATPD_PSEA8 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     1e-41  47%  178 aa  ATPD_PSEA7 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     2e-41  47%  178 aa  ATPD_PSEPW RecName: Full=ATP synthase subunit delta;AltName:
    1::176     2e-41  48%  178 aa  ATPD_PSEPK RecName: Full=ATP synthase subunit delta;AltName:
    1::176     2e-41  48%  178 aa  ATPD_PSEPG RecName: Full=ATP synthase subunit delta;AltName:
    1::176     2e-41  48%  178 aa  ATPD_PSEP1 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     4e-41  47%  178 aa  ATPD_PSEPF RecName: Full=ATP synthase subunit delta;AltName:
    1::176     7e-41  48%  178 aa  ATPD_PSEF5 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     9e-41  47%  178 aa  ATPD_PSEU2 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     9e-41  47%  178 aa  ATPD_PSESM RecName: Full=ATP synthase subunit delta;AltName:
    1::176     9e-41  47%  178 aa  ATPD_PSEFS RecName: Full=ATP synthase subunit delta;AltName:
    1::176     9e-41  47%  178 aa  ATPD_PSE14 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     1e-40  47%  178 aa  ATPD_PSEE4 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     3e-39  44%  178 aa  ATPD_HAHCH RecName: Full=ATP synthase subunit delta;AltName:
    1::172     2e-38  45%  177 aa  ATPD_PECCP RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-38  45%  177 aa  ATPD_YERE8 RecName: Full=ATP synthase subunit delta;AltName:
    1::178     3e-38  44%  178 aa  ATPD_TERTT RecName: Full=ATP synthase subunit delta;AltName:
    1::171     5e-38  45%  177 aa  ATPD_PHOLL RecName: Full=ATP synthase subunit delta;AltName:
    1::176     9e-38  43%  178 aa  ATPD_ALCBS RecName: Full=ATP synthase subunit delta;AltName:
    1::171     1e-37  44%  177 aa  ATPD_PROMH RecName: Full=ATP synthase subunit delta;AltName:
    1::171     1e-37  44%  177 aa  ATPD_EDWI9 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERPY RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERPS RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERPP RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERPN RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERPG RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERPE RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERPB RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERPA RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-37  44%  177 aa  ATPD_YERP3 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-37  45%  177 aa  ATPD_VIBVY RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-37  45%  177 aa  ATPD_VIBVU RecName: Full=ATP synthase subunit delta;AltName:
    1::175     6e-37  44%  177 aa  ATPD_VIBPA RecName: Full=ATP synthase subunit delta;AltName:
    1::172     6e-37  44%  177 aa  ATPD_ENT38 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     8e-37  44%  177 aa  ATPD_ENTS8 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     1e-36  44%  177 aa  ATPD_ERWCT RecName: Full=ATP synthase subunit delta;AltName:
    1::171     3e-36  44%  177 aa  ATPD_SERP5 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     5e-36  42%  177 aa  ATPD_SALAR RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALTY RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALTI RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALSV RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALPK RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALPC RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALPB RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALPA RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALNS RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALHS RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALG2 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALEP RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALDC RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALCH RecName: Full=ATP synthase subunit delta;AltName:
    1::172     9e-36  42%  177 aa  ATPD_SALA4 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     1e-35  43%  177 aa  ATPD_SHESR RecName: Full=ATP synthase subunit delta;AltName:
    1::172     2e-35  42%  177 aa  ATPD_SHIDS RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_SHISS RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_SHIF8 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_SHIBS RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_SHIB3 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-35  43%  177 aa  ATPD_SHESM RecName: Full=ATP synthase subunit delta;AltName:
    1::176     3e-35  40%  178 aa  ATPD_MARMS RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ESCF3 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  44%  177 aa  ATPD_ERWT9 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOUT RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOSM RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOSE RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOLU RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOLI RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOLC RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOL5 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOHS RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECODH RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECOBW RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECO8A RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECO7I RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECO5E RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECO57 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECO55 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECO45 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECO27 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     3e-35  42%  177 aa  ATPD_ECO24 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     4e-35  41%  177 aa  ATPD_SHIFL RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-35  43%  177 aa  ATPD_SHEPW RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-35  44%  177 aa  ATPD_SHEHH RecName: Full=ATP synthase subunit delta;AltName:
    1::172     4e-35  42%  177 aa  ATPD_ECOL6 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     4e-35  42%  177 aa  ATPD_ECO81 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     6e-35  40%  178 aa  ATPD_THIDA RecName: Full=ATP synthase subunit delta;AltName:
    1::175     6e-35  43%  177 aa  ATPD_SHEPA RecName: Full=ATP synthase subunit delta;AltName:
    1::176     9e-35  41%  178 aa  ATPD_NITEU RecName: Full=ATP synthase subunit delta;AltName:
    1::176     1e-34  40%  178 aa  ATPD_NITMU RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-34  42%  177 aa  ATPD_HAEPS RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-34  42%  175 aa  ATPD_XANC5 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-34  42%  177 aa  ATPD_VIBF1 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-34  42%  177 aa  ATPD_SHEFN RecName: Full=ATP synthase subunit delta;AltName:
    1::176     4e-34  40%  178 aa  ATPD_METFK RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-34  42%  177 aa  ATPD_ACTPJ RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-34  42%  177 aa  ATPD_ACTP7 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-34  42%  177 aa  ATPD_ACTP2 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     6e-34  41%  177 aa  ATPD_SODGM RecName: Full=ATP synthase subunit delta;AltName:
    1::175     6e-34  43%  177 aa  ATPD1_VIBSL RecName: Full=ATP synthase subunit delta 1;AltName:
    1::175     8e-34  42%  177 aa  ATPD_AERS4 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     1e-33  42%  175 aa  ATPD_XANAC RecName: Full=ATP synthase subunit delta;AltName:
    1::176     1e-33  41%  178 aa  ATPD_NITEC RecName: Full=ATP synthase subunit delta;AltName:
    1::175     1e-33  42%  177 aa  ATPD_SHEWM RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-33  42%  177 aa  ATPD_VIBFM RecName: Full=ATP synthase subunit delta;AltName:
    1::176     2e-33  40%  178 aa  ATPD_SACD2 RecName: Full=ATP synthase subunit delta;AltName:
    1::180     2e-33  40%  182 aa  ATPD2_PHOPR RecName: Full=ATP synthase subunit delta 2;AltName:
    1::175     3e-33  41%  177 aa  ATPD_VIBCM RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-33  41%  177 aa  ATPD_VIBCH RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-33  41%  177 aa  ATPD_VIBC3 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     3e-33  39%  179 aa  ATPD_RALEJ RecName: Full=ATP synthase subunit delta;AltName:
    1::176     3e-33  39%  178 aa  ATPD_MARAV RecName: Full=ATP synthase subunit delta;AltName:
    1::176     3e-33  39%  178 aa  ATPD_CHRVO RecName: Full=ATP synthase subunit delta;AltName:
    1::175     5e-33  41%  175 aa  ATPD_XANOR RecName: Full=ATP synthase subunit delta;AltName:
    1::175     5e-33  41%  175 aa  ATPD_XANOM RecName: Full=ATP synthase subunit delta;AltName:
    1::175     5e-33  39%  177 aa  ATPD_HAEDU RecName: Full=ATP synthase subunit delta;AltName:
    1::175     7e-33  41%  177 aa  ATPD_VIBAL RecName: Full=ATP synthase subunit delta;AltName:
    1::175     9e-33  41%  177 aa  ATPD_SHESW RecName: Full=ATP synthase subunit delta;AltName:
    1::175     9e-33  41%  177 aa  ATPD_SHEPC RecName: Full=ATP synthase subunit delta;AltName:
    1::175     9e-33  39%  177 aa  ATPD_IDILO RecName: Full=ATP synthase subunit delta;AltName:
    1::175     1e-32  42%  175 aa  ATPD_XANOP RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-32  39%  176 aa  ATPD_ACTSZ RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-32  41%  177 aa  ATPD1_VIBHB RecName: Full=ATP synthase subunit delta 1;AltName:
    1::175     2e-32  41%  177 aa  ATPD_ALISL RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-32  39%  177 aa  ATPD_PSEHT RecName: Full=ATP synthase subunit delta;AltName:
    5::175     3e-32  43%  176 aa  ATPD_HAMD5 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-32  42%  177 aa  ATPD_TOLAT RecName: Full=ATP synthase subunit delta;AltName:
    1::178     4e-32  39%  180 aa  ATPD_RALEH RecName: Full=ATP synthase subunit delta;AltName:
    1::178     6e-32  39%  180 aa  ATPD_RALME RecName: Full=ATP synthase subunit delta;AltName:
    1::175     6e-32  40%  177 aa  ATPD_PSYIN RecName: Full=ATP synthase subunit delta;AltName:
    1::175     6e-32  39%  177 aa  ATPD_PSEA6 RecName: Full=ATP synthase subunit delta;AltName:
    1::178     6e-32  38%  181 aa  ATPD_CUPTR RecName: Full=ATP synthase subunit delta;AltName:
    1::176     6e-32  40%  178 aa  ATPD_AZOSE RecName: Full=ATP synthase subunit delta;AltName:
    1::176     7e-32  37%  178 aa  ATPD_THICR RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-31  41%  177 aa  ATPD_SHESH RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-31  40%  177 aa  ATPD_SHEAM RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-31  42%  177 aa  ATPD_AZOSB RecName: Full=ATP synthase subunit delta;AltName:
    6::176     4e-31  40%  178 aa  ATPD_PSEU5 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     8e-31  41%  178 aa  ATPD_CHRSD RecName: Full=ATP synthase subunit delta;AltName:
    1::175     1e-30  38%  178 aa  ATPD_RALPJ RecName: Full=ATP synthase subunit delta;AltName:
    1::175     1e-30  38%  177 aa  ATPD1_PHOPR RecName: Full=ATP synthase subunit delta 1;AltName:
    1::172     1e-30  38%  177 aa  ATPD_KLEP3 RecName: Full=ATP synthase subunit delta;AltName:
    1::172     2e-30  38%  177 aa  ATPD_KLEP7 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-30  39%  177 aa  ATPD_SHELP RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-30  38%  178 aa  ATPD_RALSO RecName: Full=ATP synthase subunit delta;AltName:
    1::175     4e-30  38%  177 aa  ATPD_AERHH RecName: Full=ATP synthase subunit delta;AltName:
    1::172     5e-30  37%  177 aa  ATPD_CITK8 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     7e-30  38%  177 aa  ATPD_PASMU RecName: Full=ATP synthase subunit delta;AltName:
    1::175     9e-30  39%  177 aa  ATPD_SHEON RecName: Full=ATP synthase subunit delta;AltName:
    1::176     9e-30  35%  178 aa  ATPD_DECAR RecName: Full=ATP synthase subunit delta;AltName:
    1::175     1e-29  39%  177 aa  ATPD_SHESA RecName: Full=ATP synthase subunit delta;AltName:
    1::180     1e-29  40%  181 aa  ATPD_MANSM RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-29  39%  177 aa  ATPD_SHEB9 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-29  39%  177 aa  ATPD_SHEB8 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-29  39%  177 aa  ATPD_SHEB5 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-29  39%  177 aa  ATPD_SHEB2 RecName: Full=ATP synthase subunit delta;AltName:
    1::183     1e-28  36%  185 aa  ATPD_COXBU RecName: Full=ATP synthase subunit delta;AltName:
    1::183     1e-28  36%  185 aa  ATPD_COXBR RecName: Full=ATP synthase subunit delta;AltName:
    1::183     1e-28  36%  185 aa  ATPD_COXB2 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-28  36%  177 aa  ATPD_JANMA RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-28  37%  177 aa  ATPD_HERAR RecName: Full=ATP synthase subunit delta;AltName:
    1::177     2e-28  36%  178 aa  ATPD_ACIBS RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-28  35%  177 aa  ATPD_HAEIE RecName: Full=ATP synthase subunit delta;AltName:
    1::180     3e-28  38%  182 aa  ATPD_HAES1 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-28  35%  177 aa  ATPD_HAEIN RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-28  35%  177 aa  ATPD_HAEIG RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-28  35%  177 aa  ATPD_HAEI8 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     3e-28  39%  178 aa  ATPD_AZOVD RecName: Full=ATP synthase subunit delta;AltName:
    1::177     4e-28  36%  178 aa  ATPD_ACIBY RecName: Full=ATP synthase subunit delta;AltName:
    1::177     4e-28  36%  178 aa  ATPD_ACIBT RecName: Full=ATP synthase subunit delta;AltName:
    1::177     4e-28  36%  178 aa  ATPD_ACIBC RecName: Full=ATP synthase subunit delta;AltName:
    1::177     4e-28  36%  178 aa  ATPD_ACIB3 RecName: Full=ATP synthase subunit delta;AltName:
    1::180     5e-28  37%  182 aa  ATPD_HAES2 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     5e-28  38%  179 aa  ATPD_BURCM RecName: Full=ATP synthase subunit delta;AltName:
    1::177     5e-28  38%  179 aa  ATPD_BURA4 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     9e-28  39%  178 aa  ATPD_LARHH RecName: Full=ATP synthase subunit delta;AltName:
    1::183     9e-28  36%  185 aa  ATPD_COXBN RecName: Full=ATP synthase subunit delta;AltName:
    1::183     9e-28  36%  185 aa  ATPD_COXB1 RecName: Full=ATP synthase subunit delta;AltName:
    1::178     1e-27  36%  180 aa  ATPD_DIAST RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-27  38%  179 aa  ATPD_BURCH RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-27  38%  179 aa  ATPD_BURCC RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-27  38%  179 aa  ATPD_BURCA RecName: Full=ATP synthase subunit delta;AltName:
    1::178     1e-27  36%  180 aa  ATPD_ACISJ RecName: Full=ATP synthase subunit delta;AltName:
    1::178     1e-27  35%  180 aa  ATPD2_VIBHB RecName: Full=ATP synthase subunit delta 2;AltName:
    1::175     1e-27  36%  177 aa  ATPD_COLP3 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-27  38%  181 aa  ATPD_BLOPB RecName: Full=ATP synthase subunit delta;AltName:
    1::177     2e-27  36%  178 aa  ATPD_ACIB5 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     2e-27  35%  178 aa  ATPD_ACIAD RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-27  38%  177 aa  ATPD_SHEDO RecName: Full=ATP synthase subunit delta;AltName:
    1::177     3e-27  37%  179 aa  ATPD_BURVG RecName: Full=ATP synthase subunit delta;AltName:
    1::179     3e-27  38%  180 aa  ATPD_ACIAC RecName: Full=ATP synthase subunit delta;AltName:
    1::175     7e-27  35%  177 aa  ATPD_NEIG2 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     7e-27  37%  179 aa  ATPD_BURXL RecName: Full=ATP synthase subunit delta;AltName:
    1::177     9e-27  38%  179 aa  ATPD_BURS3 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     9e-27  37%  179 aa  ATPD_BURPP RecName: Full=ATP synthase subunit delta;AltName:
    1::180     9e-27  34%  183 aa  ATPD2_VIBSL RecName: Full=ATP synthase subunit delta 2;AltName:
    1::177     1e-26  37%  179 aa  ATPD_BURTA RecName: Full=ATP synthase subunit delta;AltName:
    1::178     2e-26  39%  180 aa  ATPD_LEGPL RecName: Full=ATP synthase subunit delta;AltName:
    1::178     2e-26  39%  180 aa  ATPD_LEGPC RecName: Full=ATP synthase subunit delta;AltName:
    1::178     2e-26  39%  180 aa  ATPD_LEGPA RecName: Full=ATP synthase subunit delta;AltName:
    6::176     2e-26  39%  178 aa  ATPD_PSEMY RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-26  35%  177 aa  ATPD_NEIMF RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-26  35%  177 aa  ATPD_NEIMA RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-26  35%  177 aa  ATPD_NEIM0 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     2e-26  35%  177 aa  ATPD_NEIG1 RecName: Full=ATP synthase subunit delta;AltName:
    1::178     2e-26  38%  180 aa  ATPD_LEGPH RecName: Full=ATP synthase subunit delta;AltName:
    1::178     3e-26  36%  179 aa  ATPD_DELAS RecName: Full=ATP synthase subunit delta;AltName:
    1::175     6e-26  34%  177 aa  ATPD_NEIMB RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-25  36%  179 aa  ATPD_BURP6 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-25  36%  179 aa  ATPD_BURP0 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-25  36%  179 aa  ATPD_BURMA RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-25  36%  179 aa  ATPD_BURM9 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-25  36%  179 aa  ATPD_BURM7 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-25  36%  179 aa  ATPD_BURPS RecName: Full=ATP synthase subunit delta;AltName:
    1::177     1e-25  36%  179 aa  ATPD_BURP1 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     2e-25  36%  179 aa  ATPD_BURM1 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     2e-25  36%  179 aa  ATPD_BORPD RecName: Full=ATP synthase subunit delta;AltName:
   28::175     3e-25  40%  175 aa  ATPD_XANCP RecName: Full=ATP synthase subunit delta;AltName:
   28::175     3e-25  40%  175 aa  ATPD_XANCB RecName: Full=ATP synthase subunit delta;AltName:
   28::175     3e-25  40%  175 aa  ATPD_XANC8 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     3e-25  35%  179 aa  ATPD_BURP8 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     5e-25  31%  177 aa  ATPD_LEPCP RecName: Full=ATP synthase subunit delta;AltName:
    1::177     5e-25  35%  179 aa  ATPD_BURMS RecName: Full=ATP synthase subunit delta;AltName:
    1::177     5e-25  36%  179 aa  ATPD_BURCJ RecName: Full=ATP synthase subunit delta;AltName:
   27::175     9e-25  40%  175 aa  ATPD_XYLFM RecName: Full=ATP synthase subunit delta;AltName:
   27::175     2e-24  40%  175 aa  ATPD_XYLFT RecName: Full=ATP synthase subunit delta;AltName:
   27::175     2e-24  40%  175 aa  ATPD_XYLF2 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     2e-24  34%  178 aa  ATPD_CELJU RecName: Full=ATP synthase subunit delta;AltName:
   27::175     2e-24  40%  175 aa  ATPD_XYLFA RecName: Full=ATP synthase subunit delta;AltName:
    1::178     3e-24  34%  179 aa  ATPD_POLNA RecName: Full=ATP synthase subunit delta;AltName:
    2::179     3e-24  36%  183 aa  ATPD_RUTMC RecName: Full=ATP synthase subunit delta;AltName:
    1::177     3e-24  34%  179 aa  ATPD_BORPE RecName: Full=ATP synthase subunit delta;AltName:
    1::177     3e-24  34%  179 aa  ATPD_BORPA RecName: Full=ATP synthase subunit delta;AltName:
    1::177     3e-24  34%  179 aa  ATPD_BORBR RecName: Full=ATP synthase subunit delta;AltName:
   28::173     1e-23  38%  175 aa  ATPD_STRM5 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     1e-23  32%  178 aa  ATPD_METCA RecName: Full=ATP synthase subunit delta;AltName:
   28::173     5e-23  38%  175 aa  ATPD_STRMK RecName: Full=ATP synthase subunit delta;AltName:
    1::174     3e-22  34%  176 aa  ATPD_VARPS RecName: Full=ATP synthase subunit delta;AltName:
    1::175     3e-22  31%  176 aa  ATPD_POLSJ RecName: Full=ATP synthase subunit delta;AltName:
    6::175     3e-22  33%  177 aa  ATPD_BUCAT RecName: Full=ATP synthase subunit delta;AltName:
    6::175     3e-22  33%  177 aa  ATPD_BUCA5 RecName: Full=ATP synthase subunit delta;AltName:
    6::175     5e-22  33%  177 aa  ATPD_BUCAI RecName: Full=ATP synthase subunit delta;AltName:
    7::173     9e-22  27%  174 aa  ATPD_FRATM RecName: Full=ATP synthase subunit delta;AltName:
    7::173     1e-21  27%  174 aa  ATPD_FRATW RecName: Full=ATP synthase subunit delta;AltName:
    7::173     1e-21  27%  174 aa  ATPD_FRATT RecName: Full=ATP synthase subunit delta;AltName:
    7::173     1e-21  27%  174 aa  ATPD_FRATO RecName: Full=ATP synthase subunit delta;AltName:
    7::173     1e-21  27%  174 aa  ATPD_FRATN RecName: Full=ATP synthase subunit delta;AltName:
    7::173     1e-21  27%  174 aa  ATPD_FRATH RecName: Full=ATP synthase subunit delta;AltName:
    7::173     1e-21  27%  174 aa  ATPD_FRATF RecName: Full=ATP synthase subunit delta;AltName:
    7::173     1e-21  27%  174 aa  ATPD_FRAT1 RecName: Full=ATP synthase subunit delta;AltName:
    1::176     2e-21  34%  178 aa  ATPD_POLSQ RecName: Full=ATP synthase subunit delta;AltName:
    1::181     3e-21  34%  183 aa  ATPD_VEREI RecName: Full=ATP synthase subunit delta;AltName:
   11::178     3e-21  33%  186 aa  ATPD_ROSDO RecName: Full=ATP synthase subunit delta;AltName:
   15::186     3e-21  34%  190 aa  ATPD_METNO RecName: Full=ATP synthase subunit delta;AltName:
    1::173     6e-21  29%  174 aa  ATPD_FRAP2 RecName: Full=ATP synthase subunit delta;AltName:
    1::207     8e-21  35%  209 aa  ATPD_PSYWF RecName: Full=ATP synthase subunit delta;AltName:
   15::186     8e-21  32%  190 aa  ATPD_METS4 RecName: Full=ATP synthase subunit delta;AltName:
    6::177     1e-20  32%  186 aa  ATPD_SYMTH RecName: Full=ATP synthase subunit delta;AltName:
    1::179     1e-20  30%  184 aa  ATPD_DICNV RecName: Full=ATP synthase subunit delta;AltName:
    1::176     2e-20  34%  178 aa  ATPD_POLNS RecName: Full=ATP synthase subunit delta;AltName:
    6::172     2e-20  30%  177 aa  ATPD_BUCAP RecName: Full=ATP synthase subunit delta;AltName:
    1::177     2e-20  32%  179 aa  ATPD_BORA1 RecName: Full=ATP synthase subunit delta;AltName:
    1::205     2e-20  36%  207 aa  ATPD_PSYCK RecName: Full=ATP synthase subunit delta;AltName:
    1::205     2e-20  36%  207 aa  ATPD_PSYA2 RecName: Full=ATP synthase subunit delta;AltName:
   11::178     2e-20  33%  186 aa  ATPD_OLICO RecName: Full=ATP synthase subunit delta;AltName:
   19::190     3e-20  35%  194 aa  ATPD_PARL1 RecName: Full=ATP synthase subunit delta;AltName:
   15::178     5e-20  33%  186 aa  ATPD_NITWN RecName: Full=ATP synthase subunit delta;AltName:
    1::177     5e-20  31%  179 aa  ATPD_ACIF5 RecName: Full=ATP synthase subunit delta;AltName:
    1::177     5e-20  31%  179 aa  ATPD_ACIF2 RecName: Full=ATP synthase subunit delta;AltName:
   11::168     7e-20  36%  186 aa  ATPD_OCHA4 RecName: Full=ATP synthase subunit delta;AltName:
    3::177     7e-20  32%  178 aa  ATPD_DESHY RecName: Full=ATP synthase subunit delta;AltName:
    3::177     7e-20  32%  178 aa  ATPD_DESHD RecName: Full=ATP synthase subunit delta;AltName:
    1::175     9e-20  30%  177 aa  ATPD_METPP RecName: Full=ATP synthase subunit delta;AltName:
    9::168     9e-20  31%  185 aa  ATPD_GEMAT RecName: Full=ATP synthase subunit delta;AltName:
   11::178     1e-19  31%  186 aa  ATPD_SILST RecName: Full=ATP synthase subunit delta;AltName:
   18::175     1e-19  38%  193 aa  ATPD_AGRVS RecName: Full=ATP synthase subunit delta;AltName:
   11::178     2e-19  33%  186 aa  ATPD_RHOP5 RecName: Full=ATP synthase subunit delta;AltName:
    6::173     2e-19  31%  180 aa  ATPD_GEOLS RecName: Full=ATP synthase subunit delta;AltName:
   11::168     2e-19  35%  186 aa  ATPD_BRUSI RecName: Full=ATP synthase subunit delta;AltName:
   11::168     2e-19  35%  186 aa  ATPD_BRUO2 RecName: Full=ATP synthase subunit delta;AltName:
   11::168     2e-19  35%  186 aa  ATPD_BRUC2 RecName: Full=ATP synthase subunit delta;AltName:
   15::178     2e-19  31%  186 aa  ATPD_BRAJA RecName: Full=ATP synthase subunit delta;AltName:
   15::178     2e-19  32%  186 aa  ATPD_RHOPT RecName: Full=ATP synthase subunit delta;AltName:
   15::178     2e-19  32%  186 aa  ATPD_RHOPA RecName: Full=ATP synthase subunit delta;AltName:
    2::175     2e-19  34%  177 aa  ATPD_CARHZ RecName: Full=ATP synthase subunit delta;AltName:
    6::177     2e-19  30%  180 aa  ATPD_BACCR RecName: Full=ATP synthase subunit delta;AltName:
    6::177     2e-19  30%  180 aa  ATPD_BACCQ RecName: Full=ATP synthase subunit delta;AltName:
    6::177     2e-19  30%  180 aa  ATPD_BACC7 RecName: Full=ATP synthase subunit delta;AltName:
    6::177     2e-19  30%  180 aa  ATPD_BACC4 RecName: Full=ATP synthase subunit delta;AltName:
    6::177     2e-19  30%  180 aa  ATPD_BACC1 RecName: Full=ATP synthase subunit delta;AltName:
   11::178     3e-19  31%  186 aa  ATPD_SILPO RecName: Full=ATP synthase subunit delta;AltName:
    6::165     3e-19  30%  180 aa  ATPD_GEOSF RecName: Full=ATP synthase subunit delta;AltName:
   11::168     3e-19  34%  186 aa  ATPD_BRUSU RecName: Full=ATP synthase subunit delta;AltName:
    6::177     3e-19  30%  180 aa  ATPD_BACC2 RecName: Full=ATP synthase subunit delta;AltName:
    6::173     4e-19  30%  180 aa  ATPD_GEOMG RecName: Full=ATP synthase subunit delta;AltName:
   14::182     4e-19  36%  190 aa  ATPD_BEII9 RecName: Full=ATP synthase subunit delta;AltName:
    6::173     6e-19  30%  180 aa  ATPD_GEOUR RecName: Full=ATP synthase subunit delta;AltName:
    1::177     7e-19  33%  179 aa  ATPD_THIFE RecName: Full=ATP synthase subunit delta;AltName:
   13::170     7e-19  34%  188 aa  ATPD_RHIE6 RecName: Full=ATP synthase subunit delta;AltName:
   15::178     7e-19  31%  186 aa  ATPD_NITHX RecName: Full=ATP synthase subunit delta;AltName:
    7::177     7e-19  31%  181 aa  ATPD_CHLP8 RecName: Full=ATP synthase subunit delta;AltName:
   10::178     9e-19  30%  180 aa  ATPD_SYNP6 RecName: Full=ATP synthase subunit delta;AltName:
   10::178     9e-19  30%  180 aa  ATPD_SYNE7 RecName: Full=ATP synthase subunit delta;AltName:
   15::182     1e-18  32%  184 aa  ATPD_ZYMMO RecName: Full=ATP synthase subunit delta;AltName:
   13::170     1e-18  33%  188 aa  ATPD_RHIEC RecName: Full=ATP synthase subunit delta;AltName:
   15::178     1e-18  31%  186 aa  ATPD_DINSH RecName: Full=ATP synthase subunit delta;AltName:
    6::177     1e-18  30%  181 aa  ATPD_DESRM RecName: Full=ATP synthase subunit delta;AltName:
   11::168     1e-18  34%  186 aa  ATPD_BRUAB RecName: Full=ATP synthase subunit delta;AltName:
   11::168     1e-18  34%  186 aa  ATPD_BRUA2 RecName: Full=ATP synthase subunit delta;AltName:
   11::168     1e-18  34%  186 aa  ATPD_BRUA1 RecName: Full=ATP synthase subunit delta;AltName:
   15::178     1e-18  30%  186 aa  ATPD_BRASO RecName: Full=ATP synthase subunit delta;AltName:
    5::177     1e-18  33%  179 aa  ATPD_ANAD2 RecName: Full=ATP synthase subunit delta;AltName:
   10::182     2e-18  36%  185 aa  ATPD_GLOVI RecName: Full=ATP synthase subunit delta;AltName:
    5::172     2e-18  31%  175 aa  ATPD_BREBN RecName: Full=ATP synthase subunit delta;AltName:
    5::177     2e-18  32%  179 aa  ATPD_ANADE RecName: Full=ATP synthase subunit delta;AltName:
    1::174     2e-18  30%  176 aa  ATPD_RHOFD RecName: Full=ATP synthase subunit delta;AltName:
   11::168     2e-18  35%  186 aa  ATPD_RHILO RecName: Full=ATP synthase subunit delta;AltName:
   11::168     2e-18  34%  186 aa  ATPD_BRUME RecName: Full=ATP synthase subunit delta;AltName:
   11::168     2e-18  34%  186 aa  ATPD_BRUMB RecName: Full=ATP synthase subunit delta;AltName:
   15::178     2e-18  30%  186 aa  ATPD_BRASB RecName: Full=ATP synthase subunit delta;AltName:
   15::178     3e-18  32%  186 aa  ATPD_RHOPS RecName: Full=ATP synthase subunit delta;AltName:
   14::185     3e-18  30%  189 aa  ATPD_METEP RecName: Full=ATP synthase subunit delta;AltName:
    6::177     3e-18  30%  181 aa  ATPD_DESPS RecName: Full=ATP synthase subunit delta;AltName:
    6::177     4e-18  29%  180 aa  ATPD_BACWK RecName: Full=ATP synthase subunit delta;AltName:
    6::177     4e-18  29%  180 aa  ATPD_BACCN RecName: Full=ATP synthase subunit delta;AltName:
   15::178     5e-18  30%  186 aa  ATPD_RHOPB RecName: Full=ATP synthase subunit delta;AltName:
    6::184     5e-18  29%  187 aa  ATPD_PELTS RecName: Full=ATP synthase subunit delta;AltName:
   15::182     5e-18  31%  184 aa  ATPD_NOVAD RecName: Full=ATP synthase subunit delta;AltName:
    4::180     5e-18  36%  181 aa  ATPD_LACPL RecName: Full=ATP synthase subunit delta;AltName:
    8::179     5e-18  31%  182 aa  ATPD_LACJO RecName: Full=ATP synthase subunit delta;AltName:
    2::177     5e-18  27%  183 aa  ATPD_DESAH RecName: Full=ATP synthase subunit delta;AltName:
    9::180     6e-18  29%  184 aa  ATPD_SYNP1 RecName: Full=ATP synthase subunit delta;AltName:
   14::185     6e-18  29%  189 aa  ATPD_METPB RecName: Full=ATP synthase subunit delta;AltName:
    4::177     6e-18  26%  179 aa  ATPD_CHLCH RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-18  29%  180 aa  ATPD_BACHK RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-18  29%  180 aa  ATPD_BACCZ RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-18  29%  180 aa  ATPD_BACC3 RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-18  29%  180 aa  ATPD_BACC0 RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-18  29%  180 aa  ATPD_BACAN RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-18  29%  180 aa  ATPD_BACAH RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-18  29%  180 aa  ATPD_BACAC RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-18  29%  180 aa  ATPD_BACAA RecName: Full=ATP synthase subunit delta;AltName:
    9::177     8e-18  30%  183 aa  ATPD_ANTSP RecName: Full=ATP synthase subunit delta,
   13::170     1e-17  33%  188 aa  ATPD_RHIL3 RecName: Full=ATP synthase subunit delta;AltName:
    1::168     1e-17  28%  180 aa  ATPD_DEHE1 RecName: Full=ATP synthase subunit delta;AltName:
   11::172     1e-17  31%  178 aa  ATPD_BUCBP RecName: Full=ATP synthase subunit delta;AltName:
    8::179     1e-17  31%  182 aa  ATPD_TRIEI RecName: Full=ATP synthase subunit delta;AltName:
   15::182     1e-17  35%  184 aa  ATPD_SPHWW RecName: Full=ATP synthase subunit delta;AltName:
    8::181     1e-17  28%  184 aa  ATPD_CYAP7 RecName: Full=ATP synthase subunit delta;AltName:
   13::170     2e-17  32%  188 aa  ATPD_RHILW RecName: Full=ATP synthase subunit delta;AltName:
    5::177     2e-17  32%  179 aa  ATPD_ANASK RecName: Full=ATP synthase subunit delta;AltName:
   14::185     2e-17  29%  189 aa  ATPD_METC4 RecName: Full=ATP synthase subunit delta;AltName:
    7::176     2e-17  27%  178 aa  ATPD_CLONN RecName: Full=ATP synthase subunit delta;AltName:
    7::177     2e-17  29%  181 aa  ATPD_CHLL2 RecName: Full=ATP synthase subunit delta;AltName:
    1::179     3e-17  34%  180 aa  ATPD_LEUMM RecName: Full=ATP synthase subunit delta;AltName:
    8::179     3e-17  30%  182 aa  ATPD_LACGA RecName: Full=ATP synthase subunit delta;AltName:
    5::176     3e-17  26%  181 aa  ATPD_CLOD6 RecName: Full=ATP synthase subunit delta;AltName:
   13::170     3e-17  32%  188 aa  ATPD_AGRRK RecName: Full=ATP synthase subunit delta;AltName:
    6::169     4e-17  30%  185 aa  ATPD_HELMI RecName: Full=ATP synthase subunit delta;AltName:
    6::173     5e-17  29%  180 aa  ATPD_GEOSL RecName: Full=ATP synthase subunit delta;AltName:
    6::177     5e-17  27%  183 aa  ATPD_DESOH RecName: Full=ATP synthase subunit delta;AltName:
   44::220     7e-17  28%  220 aa  ATPO_NEUCR RecName: Full=ATP synthase subunit 5, mitochondrial;    
   10::181     7e-17  29%  186 aa  ATPD_PORPU RecName: Full=ATP synthase subunit delta,
    1::168     7e-17  28%  180 aa  ATPD_DEHSC RecName: Full=ATP synthase subunit delta;AltName:
    1::168     7e-17  28%  180 aa  ATPD_DEHSB RecName: Full=ATP synthase subunit delta;AltName:
   26::193     9e-17  32%  201 aa  ATPD_XANP2 RecName: Full=ATP synthase subunit delta;AltName:
   15::178     9e-17  30%  186 aa  ATPD_RHOP2 RecName: Full=ATP synthase subunit delta;AltName:
   10::181     9e-17  31%  185 aa  ATPD_CYAP8 RecName: Full=ATP synthase subunit delta;AltName:
   13::170     9e-17  33%  188 aa  ATPD_AGRT5 RecName: Full=ATP synthase subunit delta;AltName:
    8::179     1e-16  29%  180 aa  ATPD_LEUCK RecName: Full=ATP synthase subunit delta;AltName:
    6::151     2e-16  33%  183 aa  ATPD_VESOH RecName: Full=ATP synthase subunit delta;AltName:
    5::170     2e-16  25%  179 aa  ATPD_THEM4 RecName: Full=ATP synthase subunit delta;AltName:
   10::182     2e-16  30%  184 aa  ATPD_ERYLH RecName: Full=ATP synthase subunit delta;AltName:
    6::176     2e-16  28%  180 aa  ATPD_THERP RecName: Full=ATP synthase subunit delta;AltName:
   11::178     2e-16  30%  186 aa  ATPD_AZOC5 RecName: Full=ATP synthase subunit delta;AltName:
    5::163     3e-16  26%  179 aa  ATPD_CLOB8 RecName: Full=ATP synthase subunit delta;AltName:
    5::177     3e-16  31%  179 aa  ATPD_ANADF RecName: Full=ATP synthase subunit delta;AltName:
   10::181     3e-16  29%  185 aa  ATPD_CYAA5 RecName: Full=ATP synthase subunit delta;AltName:
    6::178     3e-16  27%  181 aa  ATPD_BACSK RecName: Full=ATP synthase subunit delta;AltName:
    7::174     4e-16  30%  179 aa  ATPD_RUBXD RecName: Full=ATP synthase subunit delta;AltName:
   14::181     4e-16  29%  184 aa  ATPD_PHEZH RecName: Full=ATP synthase subunit delta;AltName:
    7::176     4e-16  24%  179 aa  ATPD_CLOPE RecName: Full=ATP synthase subunit delta;AltName:
    7::176     4e-16  24%  179 aa  ATPD_CLOP1 RecName: Full=ATP synthase subunit delta;AltName:
   10::181     6e-16  29%  185 aa  ATPD_SYNY3 RecName: Full=ATP synthase subunit delta;AltName:
    8::181     6e-16  28%  186 aa  ATPD_PORYE RecName: Full=ATP synthase subunit delta,
    6::177     6e-16  27%  181 aa  ATPD_OCEIH RecName: Full=ATP synthase subunit delta;AltName:
    2::177     6e-16  27%  183 aa  ATPD_DESAA RecName: Full=ATP synthase subunit delta;AltName:
   15::186     1e-15  29%  190 aa  ATPD_METRJ RecName: Full=ATP synthase subunit delta;AltName:
   38::177     1e-15  26%  181 aa  ATPD_CHLPD RecName: Full=ATP synthase subunit delta;AltName:
    3::175     1e-15  27%  177 aa  ATPD_BAUCH RecName: Full=ATP synthase subunit delta;AltName:
    6::178     1e-15  32%  182 aa  ATPD_SYNS9 RecName: Full=ATP synthase subunit delta;AltName:
   13::170     1e-15  36%  188 aa  ATPD_SINMW RecName: Full=ATP synthase subunit delta;AltName:
    6::177     1e-15  25%  178 aa  ATPD_LYSSC RecName: Full=ATP synthase subunit delta;AltName:
    3::177     1e-15  28%  178 aa  ATPD_GEOSW RecName: Full=ATP synthase subunit delta;AltName:
   10::181     2e-15  27%  185 aa  ATPD_THEEB RecName: Full=ATP synthase subunit delta;AltName:
   11::178     2e-15  30%  186 aa  ATPD_RHOBL RecName: Full=ATP synthase subunit delta;AltName:
   38::177     2e-15  30%  178 aa  ATPD_PELPB RecName: Full=ATP synthase subunit delta;AltName:
    8::173     2e-15  29%  177 aa  ATPD_MACCJ RecName: Full=ATP synthase subunit delta;AltName:
    5::179     2e-15  29%  180 aa  ATPD_LACBA RecName: Full=ATP synthase subunit delta;AltName:
    5::175     2e-15  26%  180 aa  ATPD_CLOPD RecName: Full=ATP synthase subunit delta, sodium ion
    5::176     2e-15  26%  180 aa  ATPD_ALKMQ RecName: Full=ATP synthase subunit delta;AltName:
    9::180     2e-15  32%  184 aa  ATPD_MAGSA RecName: Full=ATP synthase subunit delta;AltName:
   13::189     2e-15  29%  194 aa  ATPD_BARBK RecName: Full=ATP synthase subunit delta;AltName:
    2::165     3e-15  27%  183 aa  ATPD_SYNFM RecName: Full=ATP synthase subunit delta;AltName:
   34::207     3e-15  28%  227 aa  ATPD_RHOBA RecName: Full=ATP synthase subunit delta;AltName:
   82::178     3e-15  36%  186 aa  ATPD_JANSC RecName: Full=ATP synthase subunit delta;AltName:
    7::176     3e-15  24%  179 aa  ATPD_CLOPS RecName: Full=ATP synthase subunit delta;AltName:
    6::173     4e-15  27%  181 aa  ATPD_SYNAS RecName: Full=ATP synthase subunit delta;AltName:
    1::173     4e-15  26%  179 aa  ATPD_LISMO RecName: Full=ATP synthase subunit delta;AltName:
    1::173     4e-15  26%  179 aa  ATPD_LISMF RecName: Full=ATP synthase subunit delta;AltName:
    1::173     4e-15  26%  179 aa  ATPD_LISMC RecName: Full=ATP synthase subunit delta;AltName:
    1::173     5e-15  26%  179 aa  ATPD_LISW6 RecName: Full=ATP synthase subunit delta;AltName:
    1::173     5e-15  26%  179 aa  ATPD_LISMH RecName: Full=ATP synthase subunit delta;AltName:
    1::173     5e-15  26%  179 aa  ATPD_LISIN RecName: Full=ATP synthase subunit delta;AltName:
    3::176     5e-15  28%  182 aa  ATPD_DESAP RecName: Full=ATP synthase subunit delta;AltName:
  120::272     5e-15  31%  273 aa  ATPD_CORDI RecName: Full=ATP synthase subunit delta;AltName:
    6::177     6e-15  28%  182 aa  ATPD_THELT RecName: Full=ATP synthase subunit delta;AltName:
    8::175     1e-14  34%  181 aa  ATPD_LACF3 RecName: Full=ATP synthase subunit delta;AltName:
    6::175     1e-14  27%  183 aa  ATPD_DESAD RecName: Full=ATP synthase subunit delta;AltName:
    6::177     1e-14  25%  181 aa  ATPD_BACME RecName: Full=ATP synthase subunit delta;AltName:
    6::178     1e-14  26%  183 aa  ATPD_BACHD RecName: Full=ATP synthase subunit delta;AltName:
   10::166     1e-14  29%  183 aa  ATPD_ANAVT RecName: Full=ATP synthase subunit delta;AltName:
   45::212     1e-14  35%  220 aa  ATPD_GLUOX RecName: Full=ATP synthase subunit delta;AltName:
    6::177     1e-14  28%  178 aa  ATPD_GEOKA RecName: Full=ATP synthase subunit delta;AltName:
    7::176     1e-14  25%  180 aa  ATPD_CHLPB RecName: Full=ATP synthase subunit delta;AltName:
    6::176     1e-14  25%  181 aa  ATPD_BACA2 RecName: Full=ATP synthase subunit delta;AltName:
    5::173     2e-14  26%  177 aa  ATPD_THETN RecName: Full=ATP synthase subunit delta;AltName:
   11::178     2e-14  30%  186 aa  ATPD_RHOSK RecName: Full=ATP synthase subunit delta;AltName:
   11::178     2e-14  30%  186 aa  ATPD_RHOS4 RecName: Full=ATP synthase subunit delta;AltName:
   11::178     2e-14  30%  186 aa  ATPD_RHOS1 RecName: Full=ATP synthase subunit delta;AltName:
    4::177     2e-14  25%  181 aa  ATPD_PROVI RecName: Full=ATP synthase subunit delta;AltName:
    6::178     2e-14  26%  180 aa  ATPD_PROM2 RecName: Full=ATP synthase subunit delta;AltName:
   34::176     2e-14  27%  180 aa  ATPD_PROA2 RecName: Full=ATP synthase subunit delta;AltName:
    6::178     2e-14  31%  182 aa  ATPD_PAUCH RecName: Full=ATP synthase subunit delta, organellar
    3::176     2e-14  26%  178 aa  ATPD_ANOFW RecName: Full=ATP synthase subunit delta;AltName:
   43::208     3e-14  31%  216 aa  ATPO_SCHPO RecName: Full=ATP synthase subunit 5, mitochondrial;    
   13::170     3e-14  36%  188 aa  ATPD_RHIME RecName: Full=ATP synthase subunit delta;AltName:
    6::178     3e-14  26%  180 aa  ATPD_PROMS RecName: Full=ATP synthase subunit delta;AltName:
   18::181     3e-14  29%  184 aa  ATPD_NOSP7 RecName: Full=ATP synthase subunit delta;AltName:
    4::179     3e-14  24%  180 aa  ATPD_LACSS RecName: Full=ATP synthase subunit delta;AltName:
   41::209     4e-14  28%  213 aa  ATPO_PIG RecName: Full=ATP synthase subunit O,
    6::178     4e-14  31%  182 aa  ATPD_SYNPX RecName: Full=ATP synthase subunit delta;AltName:
   10::178     4e-14  28%  185 aa  ATPD_PELUB RecName: Full=ATP synthase subunit delta;AltName:
    4::179     5e-14  28%  182 aa  ATPD_MYXXD RecName: Full=ATP synthase subunit delta;AltName:
    6::163     5e-14  32%  178 aa  ATPD_MOOTA RecName: Full=ATP synthase subunit delta;AltName:
    7::175     5e-14  27%  183 aa  ATPD_DESDG RecName: Full=ATP synthase subunit delta;AltName:
    6::176     5e-14  24%  184 aa  ATPD_BACLD RecName: Full=ATP synthase subunit delta;AltName:
   41::209     7e-14  28%  213 aa  ATPO_PONAB RecName: Full=ATP synthase subunit O,
   74::180     7e-14  34%  184 aa  ATPD_SOLUE RecName: Full=ATP synthase subunit delta;AltName:
    7::171     7e-14  23%  179 aa  ATPD_CLOPA RecName: Full=ATP synthase subunit delta;AltName:
    6::177     7e-14  28%  178 aa  ATPD_BACCA RecName: Full=ATP synthase subunit delta;AltName:
    5::175     7e-14  23%  180 aa  ATPD_ALKOO RecName: Full=ATP synthase subunit delta;AltName:
   41::209     9e-14  28%  213 aa  ATPO_HUMAN RecName: Full=ATP synthase subunit O,
   10::178     9e-14  30%  184 aa  ATPD_MAGSM RecName: Full=ATP synthase subunit delta;AltName:
   26::189     9e-14  32%  197 aa  ATPD_ACICJ RecName: Full=ATP synthase subunit delta;AltName:
    6::178     1e-13  30%  182 aa  ATPD_SYNSC RecName: Full=ATP synthase subunit delta;AltName:
    4::171     1e-13  30%  179 aa  ATPD_STACT RecName: Full=ATP synthase subunit delta;AltName:
    5::164     2e-13  26%  182 aa  ATPD_SYNWW RecName: Full=ATP synthase subunit delta;AltName:
   75::179     2e-13  31%  182 aa  ATPD_SULAA RecName: Full=ATP synthase subunit delta;AltName:
    3::177     2e-13  24%  189 aa  ATPD_RICBR RecName: Full=ATP synthase subunit delta;AltName:
    3::177     2e-13  24%  189 aa  ATPD_RICB8 RecName: Full=ATP synthase subunit delta;AltName:
    1::174     2e-13  27%  181 aa  ATPD_HYPNA RecName: Full=ATP synthase subunit delta;AltName:
   41::206     2e-13  30%  213 aa  ATPO_RHIFE RecName: Full=ATP synthase subunit O,
   41::209     2e-13  27%  213 aa  ATPO_RAT RecName: Full=ATP synthase subunit O,
   11::178     2e-13  29%  186 aa  ATPD_RHOCA RecName: Full=ATP synthase subunit delta;AltName:
    8::174     2e-13  25%  181 aa  ATPD_MYCGA RecName: Full=ATP synthase subunit delta;AltName:
    6::177     2e-13  26%  178 aa  ATPD_GEOTN RecName: Full=ATP synthase subunit delta;AltName:
    6::177     2e-13  28%  178 aa  ATPD_BACST RecName: Full=ATP synthase subunit delta;AltName:
   10::172     3e-13  27%  182 aa  ATPD_MICAN RecName: Full=ATP synthase subunit delta;AltName:
    4::177     3e-13  26%  180 aa  ATPD_EMIHU RecName: Full=ATP synthase subunit delta,
   41::209     3e-13  26%  213 aa  ATPO_SORAR RecName: Full=ATP synthase subunit O,
    5::178     3e-13  25%  180 aa  ATPD_SORC5 RecName: Full=ATP synthase subunit delta;AltName:
   11::178     3e-13  28%  186 aa  ATPD_RHOS5 RecName: Full=ATP synthase subunit delta;AltName:
    4::176     3e-13  25%  181 aa  ATPD_PELLD RecName: Full=ATP synthase subunit delta;AltName:
   14::181     3e-13  30%  184 aa  ATPD_CAUCR RecName: Full=ATP synthase subunit delta;AltName:
   14::181     3e-13  30%  184 aa  ATPD_CAUCN RecName: Full=ATP synthase subunit delta;AltName:
   47::172     5e-13  26%  190 aa  ATPD_SALRD RecName: Full=ATP synthase subunit delta;AltName:
   13::170     5e-13  31%  188 aa  ATPD_RHISN RecName: Full=ATP synthase subunit delta;AltName:
    4::169     5e-13  26%  175 aa  ATPD_CLOCE RecName: Full=ATP synthase subunit delta;AltName:
   14::181     5e-13  27%  184 aa  ATPD_CAUSK RecName: Full=ATP synthase subunit delta;AltName:
    6::178     6e-13  25%  181 aa  ATPD_SYNR3 RecName: Full=ATP synthase subunit delta;AltName:
   21::179     6e-13  30%  182 aa  ATPD_SULSY RecName: Full=ATP synthase subunit delta;AltName:
    6::178     6e-13  27%  182 aa  ATPD_PROM1 RecName: Full=ATP synthase subunit delta;AltName:
    6::178     6e-13  26%  180 aa  ATPD_PROM0 RecName: Full=ATP synthase subunit delta;AltName:
    6::175     6e-13  25%  183 aa  ATPD_DESVV RecName: Full=ATP synthase subunit delta;AltName:
    6::175     6e-13  25%  183 aa  ATPD_DESVH RecName: Full=ATP synthase subunit delta;AltName:
  118::270     6e-13  31%  271 aa  ATPD_CORA7 RecName: Full=ATP synthase subunit delta;AltName:
    7::177     6e-13  27%  181 aa  ATPD_CHLTE RecName: Full=ATP synthase subunit delta;AltName:
   10::166     6e-13  28%  183 aa  ATPD_ANASP RecName: Full=ATP synthase subunit delta;AltName:
   10::167     8e-13  31%  182 aa  ATPD_SYNJA RecName: Full=ATP synthase subunit delta;AltName:
    6::178     8e-13  26%  182 aa  ATPD_PROMT RecName: Full=ATP synthase subunit delta;AltName:
    6::178     8e-13  29%  182 aa  ATPD_PROM4 RecName: Full=ATP synthase subunit delta;AltName:
   12::172     8e-13  32%  183 aa  ATPD_OENOB RecName: Full=ATP synthase subunit delta;AltName:
   31::201     1e-12  29%  206 aa  ATPO_KLULA RecName: Full=ATP synthase subunit 5, mitochondrial;    
   10::174     1e-12  31%  186 aa  ATPD_CYAPA RecName: Full=ATP synthase subunit delta,
    6::178     1e-12  25%  182 aa  ATPD_BACPF RecName: Full=ATP synthase subunit delta;AltName:
    8::179     1e-12  32%  179 aa  ATPD_ACIBL RecName: Full=ATP synthase subunit delta;AltName:
   41::209     1e-12  25%  213 aa  ATPO_MOUSE RecName: Full=ATP synthase subunit O,
    2::171     1e-12  28%  179 aa  ATPD_STAAB RecName: Full=ATP synthase subunit delta;AltName:
   73::175     1e-12  31%  183 aa  ATPD_DESVM RecName: Full=ATP synthase subunit delta;AltName:
   32::210     1e-12  27%  219 aa  ATPD_CHLRE RecName: Full=ATP synthase delta chain,
   17::175     1e-12  27%  194 aa  ATPD_BART1 RecName: Full=ATP synthase subunit delta;AltName:
    6::167     2e-12  29%  182 aa  ATPD_SYNJB RecName: Full=ATP synthase subunit delta;AltName:
  118::269     2e-12  32%  271 aa  ATPD_CORGL RecName: Full=ATP synthase subunit delta;AltName:
  118::269     2e-12  32%  271 aa  ATPD_CORGB RecName: Full=ATP synthase subunit delta;AltName:
    6::176     2e-12  24%  181 aa  ATPD_BACP2 RecName: Full=ATP synthase subunit delta;AltName:
   41::209     2e-12  27%  213 aa  ATPO_BOVIN RecName: Full=ATP synthase subunit O,
    2::171     3e-12  27%  179 aa  ATPD_STAAW RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAAT RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAAS RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAAN RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAAM RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAAE RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAAC RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAA9 RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAA8 RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAA3 RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAA2 RecName: Full=ATP synthase subunit delta;AltName:
    2::171     3e-12  27%  179 aa  ATPD_STAA1 RecName: Full=ATP synthase subunit delta;AltName:
    4::179     3e-12  29%  180 aa  ATPD_PEDPA RecName: Full=ATP synthase subunit delta;AltName:
  194::271     3e-12  41%  272 aa  ATPD_CORU7 RecName: Full=ATP synthase subunit delta;AltName:
    4::179     4e-12  27%  180 aa  ATPD_LACRJ RecName: Full=ATP synthase subunit delta;AltName:
    4::179     4e-12  27%  180 aa  ATPD_LACRD RecName: Full=ATP synthase subunit delta;AltName:
    6::173     4e-12  26%  180 aa  ATPD_GEOBB RecName: Full=ATP synthase subunit delta;AltName:
    9::170     4e-12  28%  183 aa  ATPD_EHRCJ RecName: Full=ATP synthase subunit delta;AltName:
    7::183     4e-12  27%  183 aa  ATPD_CHLT3 RecName: Full=ATP synthase subunit delta;AltName:
    6::174     5e-12  24%  183 aa  ATPD_THEAB RecName: Full=ATP synthase subunit delta;AltName:
    6::178     5e-12  25%  180 aa  ATPD_PROM9 RecName: Full=ATP synthase subunit delta;AltName:
    5::177     5e-12  27%  180 aa  ATPD_PELPD RecName: Full=ATP synthase subunit delta;AltName:
    6::176     5e-12  23%  181 aa  ATPD_BACSU RecName: Full=ATP synthase subunit delta;AltName:
  107::209     7e-12  35%  213 aa  ATPO_CALMO RecName: Full=ATP synthase subunit O,
    5::177     7e-12  27%  180 aa  ATPD_PARD8 RecName: Full=ATP synthase subunit delta;AltName:
  107::209     9e-12  35%  213 aa  ATPO_CALJA RecName: Full=ATP synthase subunit O,
    2::171     9e-12  27%  179 aa  ATPD_STAAR RecName: Full=ATP synthase subunit delta;AltName:
   13::180     9e-12  29%  188 aa  ATPD_PARDP RecName: Full=ATP synthase subunit delta;AltName:
    6::173     9e-12  26%  180 aa  ATPD_GEOSM RecName: Full=ATP synthase subunit delta;AltName:
    6::177     9e-12  25%  182 aa  ATPD_BDEBA RecName: Full=ATP synthase subunit delta;AltName:
    4::175     9e-12  25%  180 aa  ATPD_ANATD RecName: Full=ATP synthase subunit delta;AltName:
   48::176     1e-11  31%  178 aa  ATPD_CLOTH RecName: Full=ATP synthase subunit delta;AltName:
    6::174     1e-11  22%  179 aa  ATPD_OCHNE RecName: Full=ATP synthase subunit delta,
    2::162     1e-11  31%  163 aa  ATPD_CYAME RecName: Full=ATP synthase subunit delta,
    6::178     2e-11  25%  182 aa  ATPD_SYNS3 RecName: Full=ATP synthase subunit delta;AltName:
    6::178     2e-11  23%  180 aa  ATPD_PROM5 RecName: Full=ATP synthase subunit delta;AltName:
   11::168     2e-11  29%  186 aa  ATPD_MESSB RecName: Full=ATP synthase subunit delta;AltName:
    9::171     2e-11  27%  185 aa  ATPD_EHRCR RecName: Full=ATP synthase subunit delta;AltName:
   10::181     2e-11  25%  185 aa  ATPD_CYAP4 RecName: Full=ATP synthase subunit delta;AltName:
    7::176     2e-11  21%  181 aa  ATPD_CLOK5 RecName: Full=ATP synthase subunit delta;AltName:
    7::176     2e-11  21%  181 aa  ATPD_CLOK1 RecName: Full=ATP synthase subunit delta;AltName:
   36::198     2e-11  26%  209 aa  ATPO_DROME RecName: Full=ATP synthase subunit O,
   10::182     2e-11  25%  185 aa  ATPD_SYNP2 RecName: Full=ATP synthase subunit delta;AltName:
   11::184     2e-11  29%  188 aa  ATPD_METSB RecName: Full=ATP synthase subunit delta;AltName:
    7::179     3e-11  26%  183 aa  ATPD_PROMA RecName: Full=ATP synthase subunit delta;AltName:
   10::175     3e-11  24%  177 aa  ATPD_FLAPJ RecName: Full=ATP synthase subunit delta;AltName:
    4::160     3e-11  24%  177 aa  ATPD_EXISA RecName: Full=ATP synthase subunit delta;AltName:
   17::175     3e-11  26%  194 aa  ATPD_BARQU RecName: Full=ATP synthase subunit delta;AltName:
   40::179     3e-11  27%  190 aa  ATPD_ANAMM RecName: Full=ATP synthase subunit delta;AltName:
   40::179     3e-11  27%  190 aa  ATPD_ANAMF RecName: Full=ATP synthase subunit delta;AltName:
    4::178     4e-11  27%  180 aa  ATPD_ENTHR RecName: Full=ATP synthase subunit delta;AltName:
   13::177     6e-11  28%  178 aa  ATPD_STRSV RecName: Full=ATP synthase subunit delta;AltName:
    3::175     6e-11  29%  180 aa  ATPD_RHDSA RecName: Full=ATP synthase subunit delta,
    6::178     6e-11  23%  180 aa  ATPD_PROMP RecName: Full=ATP synthase subunit delta;AltName:
  131::264     6e-11  29%  270 aa  ATPD_KOCRD RecName: Full=ATP synthase subunit delta;AltName:
    7::175     6e-11  27%  184 aa  ATPD_GRAFK RecName: Full=ATP synthase subunit delta;AltName:
    6::178     6e-11  26%  179 aa  ATPD_BACP3 RecName: Full=ATP synthase subunit delta;AltName:
   77::177     7e-11  29%  181 aa  ATPD_ORITB RecName: Full=ATP synthase subunit delta;AltName:
    8::179     7e-11  26%  181 aa  ATPD_LACC3 RecName: Full=ATP synthase subunit delta;AltName:
    4::171     9e-11  27%  179 aa  ATPD_STAES RecName: Full=ATP synthase subunit delta;AltName:
    4::171     9e-11  27%  179 aa  ATPD_STAEQ RecName: Full=ATP synthase subunit delta;AltName:
    4::143     9e-11  38%  158 aa  ATPD_ROSCS RecName: Full=ATP synthase subunit delta;AltName:
  200::272     9e-11  41%  274 aa  ATPD_COREF RecName: Full=ATP synthase subunit delta;AltName:
    8::179     2e-10  26%  181 aa  ATPD_LACCB RecName: Full=ATP synthase subunit delta;AltName:
    4::179     2e-10  30%  180 aa  ATPD_ENTFA RecName: Full=ATP synthase subunit delta;AltName:
   13::177     3e-10  28%  178 aa  ATPD_STRTD RecName: Full=ATP synthase subunit delta;AltName:
   13::177     3e-10  28%  178 aa  ATPD_STRT2 RecName: Full=ATP synthase subunit delta;AltName:
   13::177     3e-10  28%  178 aa  ATPD_STRT1 RecName: Full=ATP synthase subunit delta;AltName:
  182::268     5e-10  37%  269 aa  ATPD_NOCFA RecName: Full=ATP synthase subunit delta;AltName:
    6::175     5e-10  24%  175 aa  ATPD_LACLM RecName: Full=ATP synthase subunit delta;AltName:
   46::213     5e-10  26%  221 aa  ATPD_GRABC RecName: Full=ATP synthase subunit delta;AltName:
   27::190     5e-10  28%  198 aa  ATPD_GLUDA RecName: Full=ATP synthase subunit delta;AltName:
    9::179     6e-10  26%  181 aa  ATPD_THEYD RecName: Full=ATP synthase subunit delta;AltName:
    6::171     6e-10  22%  182 aa  ATPD_CYTH3 RecName: Full=ATP synthase subunit delta;AltName:
   31::202     8e-10  24%  207 aa  ATPO_ASHGO RecName: Full=ATP synthase subunit 5, mitochondrial;    
  209::274     8e-10  41%  275 aa  ATPD_RHOSR RecName: Full=ATP synthase subunit delta;AltName:
    8::181     8e-10  25%  187 aa  ATPD_PHATR RecName: Full=ATP synthase subunit delta,
    6::175     8e-10  23%  175 aa  ATPD_LACLS RecName: Full=ATP synthase subunit delta;AltName:
    6::178     8e-10  21%  181 aa  ATPD_FERNB RecName: Full=ATP synthase subunit delta;AltName:
  191::271     8e-10  41%  272 aa  ATPD_CORJK RecName: Full=ATP synthase subunit delta;AltName:
    6::177     1e-09  23%  183 aa  ATPD_THESQ RecName: Full=ATP synthase subunit delta;AltName:
    6::177     1e-09  23%  183 aa  ATPD_THEP1 RecName: Full=ATP synthase subunit delta;AltName:
    6::177     1e-09  23%  183 aa  ATPD_THEMA RecName: Full=ATP synthase subunit delta;AltName:
   53::143     1e-09  39%  158 aa  ATPD_ROSS1 RecName: Full=ATP synthase subunit delta;AltName:
   76::182     1e-09  28%  186 aa  ATPD_RHOCS RecName: Full=ATP synthase subunit delta;AltName:
   77::177     1e-09  27%  181 aa  ATPD_ORITI RecName: Full=ATP synthase subunit delta;AltName:
    3::172     1e-09  26%  179 aa  ATPD_NATTJ RecName: Full=ATP synthase subunit delta;AltName:
   23::176     1e-09  26%  179 aa  ATPD_ACIC5 RecName: Full=ATP synthase subunit delta;AltName:
    6::174     1e-09  21%  186 aa  ATPD_LEPIC RecName: Full=ATP synthase subunit delta;AltName:
    7::176     1e-09  20%  179 aa  ATPD_CLOBM RecName: Full=ATP synthase subunit delta;AltName:
   70::171     2e-09  35%  186 aa  ATPD_WOLTR RecName: Full=ATP synthase subunit delta;AltName:
   10::181     2e-09  26%  187 aa  ATPD_THAPS RecName: Full=ATP synthase subunit delta,
   15::177     2e-09  27%  178 aa  ATPD_STRZT RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRZP RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRZJ RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRR6 RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRPS RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRPN RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRPJ RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRPI RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRP7 RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRP4 RecName: Full=ATP synthase subunit delta;AltName:
   15::177     2e-09  27%  178 aa  ATPD_STRP2 RecName: Full=ATP synthase subunit delta;AltName:
    8::179     2e-09  24%  182 aa  ATPD_LACAC RecName: Full=ATP synthase subunit delta;AltName:
  132::234     2e-09  27%  244 aa  ATPO_IPOBA RecName: Full=ATP synthase subunit O,
    8::179     2e-09  24%  182 aa  ATPD_LACH4 RecName: Full=ATP synthase subunit delta;AltName:
    7::176     2e-09  20%  179 aa  ATPD_CLOBL RecName: Full=ATP synthase subunit delta;AltName:
    6::178     3e-09  23%  182 aa  ATPD_SYNPW RecName: Full=ATP synthase subunit delta;AltName:
    4::171     3e-09  27%  179 aa  ATPD_STAHJ RecName: Full=ATP synthase subunit delta;AltName:
   77::177     3e-09  26%  184 aa  ATPD_RICCK RecName: Full=ATP synthase subunit delta;AltName:
  218::277     3e-09  43%  278 aa  ATPD_RHOOB RecName: Full=ATP synthase subunit delta;AltName:
   10::175     3e-09  23%  177 aa  ATPD_FLAJ1 RecName: Full=ATP synthase subunit delta;AltName:
  174::258     3e-09  38%  263 aa  ATPD_CLAMS RecName: Full=ATP synthase subunit delta;AltName:
  174::258     3e-09  38%  263 aa  ATPD_CLAM3 RecName: Full=ATP synthase subunit delta;AltName:
  123::225     4e-09  30%  238 aa  ATPO_ARATH RecName: Full=ATP synthase subunit O,
  196::266     4e-09  37%  271 aa  ATPD_CORK4 RecName: Full=ATP synthase subunit delta;AltName:
    7::176     4e-09  20%  179 aa  ATPD_CLOBH RecName: Full=ATP synthase subunit delta;AltName:
    7::176     4e-09  20%  179 aa  ATPD_CLOB1 RecName: Full=ATP synthase subunit delta;AltName:
    4::178     5e-09  23%  178 aa  ATPD_STRU0 RecName: Full=ATP synthase subunit delta;AltName:
    7::176     5e-09  20%  179 aa  ATPD_CLOBK RecName: Full=ATP synthase subunit delta;AltName:
    7::176     7e-09  20%  179 aa  ATPD_CLOBJ RecName: Full=ATP synthase subunit delta;AltName:
    6::178     9e-09  26%  182 aa  ATPD_PROMM RecName: Full=ATP synthase subunit delta;AltName:
    6::178     9e-09  26%  182 aa  ATPD_PROM3 RecName: Full=ATP synthase subunit delta;AltName:
    6::177     9e-09  28%  187 aa  ATPD_LEPBP RecName: Full=ATP synthase subunit delta;AltName:
    6::177     9e-09  28%  187 aa  ATPD_LEPBA RecName: Full=ATP synthase subunit delta;AltName:
   73::169     9e-09  28%  180 aa  ATPD_ANAPZ RecName: Full=ATP synthase subunit delta;AltName:
   71::177     1e-08  23%  184 aa  ATPD_RICPU RecName: Full=ATP synthase subunit delta;AltName:
    3::137     1e-08  26%  174 aa  ATPD_FUSNN RecName: Full=ATP synthase subunit delta;AltName:
    6::175     1e-08  26%  183 aa  ATPD_DESDA RecName: Full=ATP synthase subunit delta;AltName:
    7::176     1e-08  19%  179 aa  ATPD_CLOB6 RecName: Full=ATP synthase subunit delta;AltName:
   75::239     2e-08  26%  248 aa  ATPD_TOBAC RecName: Full=ATP synthase delta chain,
  144::267     2e-08  29%  278 aa  ATPD_BIFLO RecName: Full=ATP synthase subunit delta;AltName:
  144::267     2e-08  29%  278 aa  ATPD_BIFLD RecName: Full=ATP synthase subunit delta;AltName:
   11::155     2e-08  28%  186 aa  ATPD_RHORU RecName: Full=ATP synthase subunit delta;AltName:
   11::155     2e-08  28%  186 aa  ATPD_RHORT RecName: Full=ATP synthase subunit delta;AltName:
    6::137     2e-08  27%  174 aa  ATPD_PROMO RecName: Full=ATP synthase subunit delta, sodium ion
    2::140     2e-08  22%  173 aa  ATPD_CAMLR RecName: Full=ATP synthase subunit delta;AltName:
  167::273     2e-08  28%  275 aa  ATPD_ARTCA RecName: Full=ATP synthase subunit delta;AltName:
    9::181     2e-08  22%  185 aa  ATPD_ACAM1 RecName: Full=ATP synthase subunit delta;AltName:
  159::264     3e-08  25%  271 aa  ATPD_STRGG RecName: Full=ATP synthase subunit delta;AltName:
   12::177     3e-08  22%  178 aa  ATPD_STREM RecName: Full=ATP synthase subunit delta;AltName:
   71::177     3e-08  23%  184 aa  ATPD_RICRS RecName: Full=ATP synthase subunit delta;AltName:
   71::177     3e-08  23%  184 aa  ATPD_RICRO RecName: Full=ATP synthase subunit delta;AltName:
   10::177     3e-08  20%  181 aa  ATPD_PARUW RecName: Full=ATP synthase subunit delta;AltName:
    6::175     3e-08  23%  175 aa  ATPD_LACLA RecName: Full=ATP synthase subunit delta;AltName:
  144::267     3e-08  28%  278 aa  ATPD_BIFLI RecName: Full=ATP synthase subunit delta;AltName:
  133::254     3e-08  29%  262 aa  ATPD_TROWT RecName: Full=ATP synthase subunit delta;AltName:
  133::254     3e-08  29%  262 aa  ATPD_TROW8 RecName: Full=ATP synthase subunit delta;AltName:
   71::177     3e-08  23%  184 aa  ATPD_RICAE RecName: Full=ATP synthase subunit delta;AltName:
   68::154     3e-08  37%  157 aa  ATPD_CHLAD RecName: Full=ATP synthase subunit delta;AltName:
  144::248     4e-08  33%  257 aa  ATPD_SPIOL RecName: Full=ATP synthase delta chain,
    6::174     4e-08  20%  186 aa  ATPD_LEPBL RecName: Full=ATP synthase subunit delta;AltName:
    6::174     4e-08  20%  186 aa  ATPD_LEPBJ RecName: Full=ATP synthase subunit delta;AltName:
    6::177     4e-08  21%  177 aa  ATPD_AZOPC RecName: Full=ATP synthase subunit delta;AltName:
  188::267     6e-08  34%  269 aa  ATPD_THEFY RecName: Full=ATP synthase subunit delta;AltName:
   12::177     6e-08  21%  178 aa  ATPD_STRA1 RecName: Full=ATP synthase subunit delta;AltName:
    4::171     6e-08  29%  179 aa  ATPD_STAS1 RecName: Full=ATP synthase subunit delta;AltName:
   76::177     6e-08  25%  184 aa  ATPD_RICAH RecName: Full=ATP synthase subunit delta;AltName:
   13::173     6e-08  25%  189 aa  ATPD_EHRRW RecName: Full=ATP synthase subunit delta;AltName:
   13::173     6e-08  25%  189 aa  ATPD_EHRRG RecName: Full=ATP synthase subunit delta;AltName:
    7::176     6e-08  21%  179 aa  ATPD_CLOBB RecName: Full=ATP synthase subunit delta;AltName:
    7::176     6e-08  21%  179 aa  ATPD_CLOBA RecName: Full=ATP synthase subunit delta;AltName:
   12::177     8e-08  21%  178 aa  ATPD_STRA5 RecName: Full=ATP synthase subunit delta;AltName:
   12::177     8e-08  21%  178 aa  ATPD_STRA3 RecName: Full=ATP synthase subunit delta;AltName:
    3::177     8e-08  22%  183 aa  ATPD_RICPR RecName: Full=ATP synthase subunit delta;AltName:
  206::269     8e-08  36%  276 aa  ATPD_KINRD RecName: Full=ATP synthase subunit delta;AltName:
    7::176     8e-08  21%  179 aa  ATPD_CLOAB RecName: Full=ATP synthase subunit delta;AltName:
   36::204     1e-07  25%  212 aa  ATPO_YEAST RecName: Full=ATP synthase subunit 5, mitochondrial;    
   12::177     1e-07  21%  178 aa  ATPD_STRS7 RecName: Full=ATP synthase subunit delta;AltName:
   12::177     1e-07  21%  178 aa  ATPD_STRE4 RecName: Full=ATP synthase subunit delta;AltName:
   71::177     1e-07  23%  184 aa  ATPD_RICM5 RecName: Full=ATP synthase subunit delta;AltName:
  131::262     1e-07  26%  263 aa  ATPD_PROAC RecName: Full=ATP synthase subunit delta;AltName:
   79::150     1e-07  33%  183 aa  ATPD_DESMR RecName: Full=ATP synthase subunit delta;AltName:
   91::179     1e-07  35%  182 aa  ATPD_PERMH RecName: Full=ATP synthase subunit delta;AltName:
   10::181     1e-07  22%  187 aa  ATPD_ODOSI RecName: Full=ATP synthase subunit delta,
   17::175     1e-07  23%  197 aa  ATPD_BARHE RecName: Full=ATP synthase subunit delta;AltName:
    6::147     1e-07  27%  171 aa  ATPD_ACHLI RecName: Full=ATP synthase subunit delta;AltName:
    4::149     1e-07  18%  182 aa  ATPD1_BRAHW RecName: Full=ATP synthase subunit delta 1;AltName:
   66::169     2e-07  32%  184 aa  ATPD_WOLPP RecName: Full=ATP synthase subunit delta;AltName:
    6::177     2e-07  21%  183 aa  ATPD_THENN RecName: Full=ATP synthase subunit delta;AltName:
  210::271     2e-07  35%  274 aa  ATPD_SALAI RecName: Full=ATP synthase subunit delta;AltName:
   99::199     2e-07  27%  207 aa  ATPO_CANGA RecName: Full=ATP synthase subunit 5, mitochondrial;    
  298::436     2e-07  26%  445 aa  ATPFD_MYCVP RecName: Full=ATP synthase subunit b-delta;Includes:
    6::122     2e-07  24%  191 aa  ATPD_HALOH RecName: Full=ATP synthase subunit delta;AltName:
    6::167     3e-07  22%  188 aa  ATPD_LAWIP RecName: Full=ATP synthase subunit delta;AltName:
  378::443     4e-07  36%  445 aa  ATPFD_MYCUA RecName: Full=ATP synthase subunit b-delta;Includes:
  378::443     4e-07  36%  445 aa  ATPFD_MYCMM RecName: Full=ATP synthase subunit b-delta;Includes:
    7::179     4e-07  22%  180 aa  ATPD_LACS1 RecName: Full=ATP synthase subunit delta;AltName:
    5::162     4e-07  23%  177 aa  ATPD_EXIS2 RecName: Full=ATP synthase subunit delta;AltName:
   23::150     4e-07  31%  157 aa  ATPD_CHLSY RecName: Full=ATP synthase subunit delta;AltName:
   23::150     4e-07  31%  157 aa  ATPD_CHLAA RecName: Full=ATP synthase subunit delta;AltName:
    4::175     5e-07  24%  179 aa  ATPD_CALS8 RecName: Full=ATP synthase subunit delta;AltName:
  141::261     5e-07  26%  275 aa  ATPD_ARTS2 RecName: Full=ATP synthase subunit delta;AltName:
   77::177     6e-07  24%  183 aa  ATPD_RICTY RecName: Full=ATP synthase subunit delta;AltName:
    7::178     6e-07  19%  190 aa  ATPD_PETMO RecName: Full=ATP synthase subunit delta;AltName:
   54::176     8e-07  26%  182 aa  ATPD_HYDS0 RecName: Full=ATP synthase subunit delta;AltName:
   87::197     1e-06  29%  201 aa  ATPD_VAULI RecName: Full=ATP synthase subunit delta,
    1::171     1e-06  24%  177 aa  ATPD_GALSU RecName: Full=ATP synthase subunit delta,
  201::267     1e-06  31%  277 aa  ATPD_BIFA0 RecName: Full=ATP synthase subunit delta;AltName:
  366::436     1e-06  34%  445 aa  ATPFD_MYCS2 RecName: Full=ATP synthase subunit b-delta;Includes:
  278::444     1e-06  33%  446 aa  ATPFD_MYCPA RecName: Full=ATP synthase subunit b-delta;Includes:
   70::171     1e-06  29%  186 aa  ATPD_WOLWR RecName: Full=ATP synthase subunit delta;AltName:
   70::171     1e-06  29%  186 aa  ATPD_WOLPM RecName: Full=ATP synthase subunit delta;AltName:
    5::89      1e-06  31%  175 aa  ATPD_SULNB RecName: Full=ATP synthase subunit delta;AltName:
   12::177     1e-06  25%  178 aa  ATPD_STRMU RecName: Full=ATP synthase subunit delta;AltName:
    9::176     1e-06  21%  179 aa  ATPD_MARMM RecName: Full=ATP synthase subunit delta;AltName:
    5::134     2e-06  31%  176 aa  ATPD_NITSB RecName: Full=ATP synthase subunit delta;AltName:
   10::150     2e-06  26%  183 aa  ATPD_MYCS5 RecName: Full=ATP synthase subunit delta;AltName:
    8::180     2e-06  24%  185 aa  ATPD_GUITH RecName: Full=ATP synthase subunit delta,
  194::264     2e-06  32%  273 aa  ATPD_STRAW RecName: Full=ATP synthase subunit delta;AltName:
   10::176     2e-06  20%  183 aa  ATPD_CYACA RecName: Full=ATP synthase subunit delta,
  201::267     3e-06  30%  275 aa  ATPD_BIFAA RecName: Full=ATP synthase subunit delta;AltName:
  278::444     4e-06  33%  446 aa  ATPFD_MYCA1 RecName: Full=ATP synthase subunit b-delta;Includes:
  207::271     4e-06  32%  273 aa  ATPD_STRLI RecName: Full=ATP synthase subunit delta;AltName:
  208::272     4e-06  32%  274 aa  ATPD_STRCO RecName: Full=ATP synthase subunit delta;AltName:
  210::266     4e-06  33%  274 aa  ATPD_SALTO RecName: Full=ATP synthase subunit delta;AltName:
   73::176     4e-06  24%  181 aa  ATPD_AQUAE RecName: Full=ATP synthase subunit delta;AltName:
  278::444     5e-06  26%  446 aa  ATPFD_MYCLE RecName: Full=ATP synthase subunit b-delta;Includes:
  278::444     5e-06  26%  446 aa  ATPFD_MYCLB RecName: Full=ATP synthase subunit b-delta;Includes:
    2::138     5e-06  21%  176 aa  ATPD_ARCB4 RecName: Full=ATP synthase subunit delta;AltName:
  371::434     7e-06  34%  443 aa  ATPFD_MYCSS RecName: Full=ATP synthase subunit b-delta;Includes:
  371::434     7e-06  34%  443 aa  ATPFD_MYCSK RecName: Full=ATP synthase subunit b-delta;Includes:
  371::434     7e-06  34%  443 aa  ATPFD_MYCSJ RecName: Full=ATP synthase subunit b-delta;Includes:
  384::446     7e-06  33%  448 aa  ATPFD_MYCA9 RecName: Full=ATP synthase subunit b-delta;Includes:
   10::175     7e-06  20%  186 aa  ATPD_MYCAP RecName: Full=ATP synthase subunit delta;AltName:
    5::139     1e-05  22%  173 aa  ATPD_CAMJR RecName: Full=ATP synthase subunit delta;AltName:
    5::139     1e-05  22%  173 aa  ATPD_CAMJJ RecName: Full=ATP synthase subunit delta;AltName:
    5::139     1e-05  22%  173 aa  ATPD_CAMJE RecName: Full=ATP synthase subunit delta;AltName:
    5::139     1e-05  22%  173 aa  ATPD_CAMJ8 RecName: Full=ATP synthase subunit delta;AltName:
  374::432     2e-05  36%  446 aa  ATPFD_MYCTU RecName: Full=ATP synthase subunit b-delta;Includes:
  374::432     2e-05  36%  446 aa  ATPFD_MYCTA RecName: Full=ATP synthase subunit b-delta;Includes:
  374::432     2e-05  36%  446 aa  ATPFD_MYCBT RecName: Full=ATP synthase subunit b-delta;Includes:
  374::432     2e-05  36%  446 aa  ATPFD_MYCBP RecName: Full=ATP synthase subunit b-delta;Includes:
  374::432     2e-05  36%  446 aa  ATPFD_MYCBO RecName: Full=ATP synthase subunit b-delta;Includes:
   72::158     2e-05  29%  176 aa  ATPD_WOLSU RecName: Full=ATP synthase subunit delta;AltName:
  219::265     2e-05  36%  279 aa  ATPD_FRASN RecName: Full=ATP synthase subunit delta;AltName:
   13::177     3e-05  22%  177 aa  ATPD_STRSY RecName: Full=ATP synthase subunit delta;AltName:
   13::177     3e-05  22%  177 aa  ATPD_STRS2 RecName: Full=ATP synthase subunit delta;AltName:
    9::176     3e-05  18%  180 aa  ATPD_MYCMO RecName: Full=ATP synthase subunit delta;AltName:
  141::273     5e-05  24%  275 aa  ATPD_SACEN RecName: Full=ATP synthase subunit delta;AltName:
    5::139     6e-05  24%  173 aa  ATPD_CAMJD RecName: Full=ATP synthase subunit delta;AltName:
  226::267     8e-05  43%  275 aa  ATPD_NOCSJ RecName: Full=ATP synthase subunit delta;AltName:
    6::137     8e-05  21%  174 aa  ATPD_ILYTA RecName: Full=ATP synthase subunit delta, sodium ion
  136::264     8e-05  20%  271 aa  ATPD_BEUC1 RecName: Full=ATP synthase subunit delta;AltName:
    6::173     8e-05  22%  185 aa  ATPD_BACV8 RecName: Full=ATP synthase subunit delta;AltName:
   10::178     1e-04  26%  188 aa  ATPD_MYCPE RecName: Full=ATP synthase subunit delta;AltName:
   13::177     1e-04  24%  178 aa  ATPD_STRGC RecName: Full=ATP synthase subunit delta;AltName:
   76::177     1e-04  24%  178 aa  ATPD_STREI RecName: Full=ATP synthase subunit delta;AltName:
   67::158     1e-04  25%  176 aa  ATPD_CAMC5 RecName: Full=ATP synthase subunit delta;AltName:
    5::156     2e-04  20%  176 aa  ATPD_CAMC1 RecName: Full=ATP synthase subunit delta;AltName:
  144::222     2e-04  28%  247 aa  ATPD_SORBI RecName: Full=ATP synthase delta chain,
   77::177     2e-04  22%  184 aa  ATPD_RICFE RecName: Full=ATP synthase subunit delta;AltName:
    9::178     2e-04  23%  180 aa  ATPD_LACDB RecName: Full=ATP synthase subunit delta;AltName:
    9::178     2e-04  25%  180 aa  ATPD_LACDA RecName: Full=ATP synthase subunit delta;AltName:
   62::158     3e-04  25%  174 aa  ATPD_NEOSM RecName: Full=ATP synthase subunit delta;AltName:
   12::177     4e-04  26%  178 aa  ATPD_STRP1 RecName: Full=ATP synthase subunit delta;AltName:
   71::177     4e-04  21%  184 aa  ATPD_RICCN RecName: Full=ATP synthase subunit delta;AltName:
   31::108     5e-04  33%  387 aa  PGK_PSEF5 RecName: Full=Phosphoglycerate kinase;       
   76::177     5e-04  30%  178 aa  ATPD_STRPZ RecName: Full=ATP synthase subunit delta;AltName:
   76::177     5e-04  30%  178 aa  ATPD_STRPM RecName: Full=ATP synthase subunit delta;AltName:
   76::177     5e-04  30%  178 aa  ATPD_STRPG RecName: Full=ATP synthase subunit delta;AltName:
   76::177     5e-04  30%  178 aa  ATPD_STRPD RecName: Full=ATP synthase subunit delta;AltName:
   76::177     5e-04  30%  178 aa  ATPD_STRPC RecName: Full=ATP synthase subunit delta;AltName:
   76::177     5e-04  30%  178 aa  ATPD_STRPB RecName: Full=ATP synthase subunit delta;AltName:
   76::177     5e-04  30%  178 aa  ATPD_STRP8 RecName: Full=ATP synthase subunit delta;AltName:
   76::177     5e-04  30%  178 aa  ATPD_STRP6 RecName: Full=ATP synthase subunit delta;AltName:
   76::177     5e-04  30%  178 aa  ATPD_STRP3 RecName: Full=ATP synthase subunit delta;AltName:
    1::175     5e-04  25%  181 aa  ATPD_MYCMS RecName: Full=ATP synthase subunit delta;AltName:
    5::101     9e-04  22%  177 aa  ATPD_SULDN RecName: Full=ATP synthase subunit delta;AltName:
   76::177     9e-04  30%  178 aa  ATPD_STRPF RecName: Full=ATP synthase subunit delta;AltName:
    1::178

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAEKITIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILIDDPRYTSEQLIGLFVEIGGDTV
ATPD_NITOC      MAEKITIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILIDDPRYTSEQLIGLFVEIGGDTV
ATPD_ALHEH      MAEQTTLARPYAKAVFELTKDAKTRNTWSKRLQALGTVAADDQVAALVGNPRVSREQLIGLLLDVGEDTL
ATPD_HALHL      MAERSTLARPYARAVFELAGDDATERQWSRRLAAVAEVVQVPQLASLLTHPRISAEQLAGIVCEAAGD-L
ATPD_THISH      MSELTTLARPYAKAVFEVAQGAGDLARWSDQLGFMAAVVHDPTMKAFLDSPKLTREAAADTVIGVCEGRI
ATPD_PSEAE      MAELTTLARPYAKAAFEYAQAHQQLADWSAALGVLAAVSQDDTVRQLLKEPQLTSSAKAQSLIDVCGDKL
ATPD_PSEAB      MAELTTLARPYAKAAFEYAQAHQQLADWSAALGVLAAVSQDDTVRQLLKEPQLTSSAKAQSLIDVCGDKL
ATPD_PSEA8      MAELTTLARPYAKAAFEYAQAHQQLADWSAALGVLAAVSQDDTVRQLLKEPQLTSSAKAQSLIDVCGDKL
ATPD_PSEA7      MAELTTLARPYAKAAFEYAQAHQQLADWSAALGVLAAVSQDDTVRQLLKEPQLTSSAKAQSLIDVCGDKL
ATPD_PSEPW      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTMQRLLKAPRLTSAEKAATFIDVCGDKF
ATPD_PSEPK      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTMQRLLKAPRLTSAEKAATFIDVCGDKF
ATPD_PSEPG      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTMQRLLKAPRLTSAEKAATFIDVCGDKF
ATPD_PSEP1      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTMQRLLKAPRLTSAEKAATFIDVCGDKF
ATPD_PSEPF      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTMQRVLKAPRLTSAEKAATFIDVCGDKF
ATPD_PSEF5      MAELTTLARPYAKAAFEHAQAHQQLASWSAMLGLAAAVSQDDTMQRVLKAPRLTSAEKASTFIEVCGDKF
ATPD_PSEU2      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTMQRMLKAPRLTSAQKATTFIEVCGEKF
ATPD_PSESM      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTMQRMLKAPRVTSAQKATTFIEVCGEKF
ATPD_PSEFS      MAELTTLARPYAKAAFEHAQAHQQLASWSAMLGLAAAVSQDDTMQRVLKAPRLTSADKAATFIEVCGDKF
ATPD_PSE14      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTMQRMLKAPRLTSAQKATTFIEVCGEKF
ATPD_PSEE4      MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSEDGTMQRLLKAPQLTSAEKAAAFIEVCGDKF
ATPD_HAHCH      MAESTTLARPYAKAAFELARDAGQLSEWSALLALTAAVAGDSNMHKVLNHPALTSAQKGQTFLDVCEGKL
ATPD_PECCP      MSEFVTVARPYAKAAFDFAVENQALDRWQNMLAFSAEVARNEQIAELLSGAVAPIE-LAKTFIAVCGDQL
ATPD_YERE8      MSEFVTVARPYAKAAFDFAVEHQAVDRWQDMLAFTAQVTRNEQIAELLSGA-VAPETMSKTFIAVCGDQL
ATPD_TERTT      MAEPITLARPYAKAAFEAARDASALQSWSDALVEAAAITRDSKVKALLSSPSLTAVQKAAAFIDLCGDTL
ATPD_PHOLL      MSEFATVARPYAKAAFDFAVEKQSLEQWQNMLAFTAEVTRNEQVGELLSGS-LASETLANTFIAICGEQV
ATPD_ALCBS      MAELTTIARPYAKAAFVFAKEHDALEQWEKMLGLAAAVAGDASMRAYLDQPELDDATKVSAFAEVCGDEL
ATPD_PROMH      MSEIATVARPYAKAAFDFAVENQAVDKWQVMLAFTAEVARNEQVTELLSGS-LASEKLADIFIDLCGDQI
ATPD_EDWI9      MSEFITVARPYAKAAFDFAVEHNSLDRWQNMLTFSAEVTRNESVAEMLSGA-LAPETLAAFFIDICGDQL
ATPD_YERPY      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_YERPS      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_YERPP      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_YERPN      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_YERPG      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_YERPE      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_YERPB      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_YERPA      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_YERP3      MSEFVTVARPYAKAAFDFAVEHQAVERWQNMLAFTAQVTRNEQIAELLSGA-VAPETMSTTFIAVCGDQL
ATPD_VIBVY      MADFTTIARPYAKAAFDFAVEKGQLDQWGQMLSFAAEVAQNEQISELLSGSM-SADKLAELFIAICGEQV
ATPD_VIBVU      MADFTTIARPYAKAAFDFAVEKGQLDQWGQMLSFAAEVAQNEQISELLSGSM-SADKLAELFIAICGEQV
ATPD_VIBPA      MSDLTTIARPYAKAAFDFAVDKGQLDQWGQMLSFAAEVAKNEQMNELLTSS-FSAEKMAEIFVAVCGEQV
ATPD_ENT38      MSEFVTVARPYAKAAFDFAVEHQNVDRWQDMLAFAAEVTKNEQMAEMLSGA-LAPETLAASFIAVCGEQL
ATPD_ENTS8      MSEFVTVARPYAKAAFDFAVEHQSLDRWQDMLAFAAEVAKNEQMAELLSGA-LAPETLAESFIAICGDQL
ATPD_ERWCT      MSEFVTVARPYAKAAFDFAVENQALDRWQSMLAFSAEVARNEQIAELLSGAIAPIE-LAKTFIAVCGDQL
ATPD_SERP5      MSEFVTVARPYAKAAFDFAVEHQSLDRWQDMLAFAADVTRNEQISELLAGA-VAPETLSRTFIAVCGEQL
ATPD_SALAR      MSEFVTVARPYAKAAFDFAVEHQSVDRWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALTY      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALTI      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALSV      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALPK      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALPC      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALPB      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALPA      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALNS      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALHS      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALG2      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALEP      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALDC      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALCH      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SALA4      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SHESR      MAELTTIARPYAKAAFDVAVEHNAVDTWAEMLTFAALVSENETMQPLLTGS-LASTKLAALFISVCGEQI
ATPD_SHIDS      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SHISS      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SHIF8      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SHIBS      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SHIB3      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SHESM      MAELTTIARPYAKAAFDVAVEHNAVDTWAEMLTFAALVSENETMQPLLTGS-LASTKLAALFISVCGEQI
ATPD_MARMS      MAELKTVARPYAKAVFEVAREQGHIVEWADMLNVLASVTVEPKLKKALGNPAFSAEEKANALADVCAEVT
ATPD_ESCF3      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ERWT9      MSEFTTVARPYAKAAFDFAVEHQSVDRWQQMLAFAASVASNEQMTDLLSGA-LAPEALSETFIAICGDQL
ATPD_ECOUT      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECOSM      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECOSE      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECOLU      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECOLI      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECOLC      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECOL5      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECOHS      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECODH      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECOBW      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO8A      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO7I      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO5E      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO57      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO55      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO45      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO27      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO24      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SHIFL      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLTFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_SHEPW      MAEITTIARPYAKAAFDFALEQNAIENWVEMLNFAALVSENETMQPLLSGS-LASNQLAELFIGVCGEQI
ATPD_SHEHH      MAEITTIARPYAKAAFEFALEQKAVESWAEMLNFAALVSENETMQPLLSGS-VASGKLAELFIGVCGEQI
ATPD_ECOL6      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_ECO81      MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_THIDA      MSELSTLARPYAEAVFRMAQDENDLAGWSSRVTTLATIVSDTQVARLIADPAVPADRVAELIVSVAGDGL
ATPD_SHEPA      MAEITTIARPYAKAAFDFALEQKAVESWAEMLNFAALVSENETMQPLLSGS-VASGKLAELFIGVCGEQI
ATPD_NITEU      MAEAITIARPYAEAVFKLARESGSLFSWSETLDAVNSIVRESQIRELISNPLISSVKLREIIFSVCGKKL
ATPD_NITMU      MAETRTIARPYAEAVFKLAKNQNDLARWADTLQLXXXXXXDENVRSLIGNPKISSRKLGELFLSVCGNRL
ATPD_HAEPS      MSQLTTVARPYAKAAFDFALEQGQLDKWQEMLQFSALVAENEDVQHFIHSSS-AATQVADTFIAICGDQL
ATPD_XANC5      MSQALTLARPYGRAAFAIAREGGNFAPWSDALAFSAQVAGDPRVAALLLNPALGQEQAVTL---LAPPQA
ATPD_VIBF1      MSEMATIARPYAKAAFDFAVEKGELSQWAQMLTFCSEVAKNEDVAQLLDGA-IASEQLAEIFISICGEQL
ATPD_SHEFN      MAELSTIARPYAKAAFDFAVEHKAVESWTEMLT-FASLVSENESIKPLLNGTLASTQLATLFIKVCGEQV
ATPD_METFK      MAEAITIARPYAVAVYRLAKEKNALADWSQMXXXXXXXXXDEQMRAFIDNPKVDAADLERVFLSVSGDRL
ATPD_ACTPJ      MSELSTVARPYAKAAFDFALEQGQLDKWQEMLQFSAFVAENEQVAEYINSS-LASGQISETFIKICGDQL
ATPD_ACTP7      MSELSTVARPYAKAAFDFALEQGQLDKWQEMLQFSAFVAENEQVAEYINSS-LASGQISETFIKICGDQL
ATPD_ACTP2      MSELSTVARPYAKAAFDFALEQGQLDKWQEMLQFSAFVAENEQVAEYINSS-LASGQISETFIKICGDQL
ATPD_SODGM      MSELVTVARPYAKAAFDFAVEHQAVAHWQAMLTFCAEVSRNERIAELLSGA-VVPEKLAETFIAVCGEEL
ATPD1_VIBSL     MSDLTTIARPYAKAAFDFAVDKGELDQWGQMLTFAAEVAQNDDVHNLLSGSM-TAEKLAEVFIVICGEQF
ATPD_AERS4      MSELTTIARPYAKAAFEFAVEHKAVDQWLGMLGFAAQVAENETIHNLVHGS-VAAEELANLFVGVCGEQL
ATPD_XANAC      MSQALTLARPYGRAAFAIAREGGNFAPWSDALAFSAQVAGDPRVAALLLNPALGQEQAVTL---LAPPQA
ATPD_NITEC      MAEAITIARPYAEAVFRLAQGSGSLSLWSEMLGIVSSVIQESQVNALIGNPQIPSIKLREIVFSICDKEL
ATPD_SHEWM      MAEITTIARPYAKAAFDFAIEKNAVDSWAEMLNFAAMVSENETMKPLLSGS-LASHQLAELFIGVCGEQV
ATPD_VIBFM      MSEMATIARPYAKAAFDFAVEKGELSQWAQMLTFCSEVAKNKDVAQLLDGA-VASEQLAEIFISICGEQL
ATPD_SACD2      MAEFTTLARPYAKAAFIAARDASDLGGWSKALATAAAVSQVDRVKTVLSAPGLTAQQKADAFVALCGEEL
ATPD2_PHOPR     MSDLKTIAQPYAKAAFDFALANKSLDQWAYMLMTTAEVASQQEIKEIDFKGAKNAEAFTQMFLDICEGLL
ATPD_VIBCM      MSDLTTIARPYAKAAFDFAVEKQQLGHWSQMLAFTAEVAKNEQMHELLTSSG-SANKLAEIFIAVCGEQL
ATPD_VIBCH      MSDLTTIARPYAKAAFDFAVEKQQLGHWSQMLAFTAEVAKNEQMHELLTSSG-SANKLAEIFIAVCGEQL
ATPD_VIBC3      MSDLTTIARPYAKAAFDFAVEKQQLGHWSQMLAFTAEVAKNEQMHELLTSSG-SANKLAEIFIAVCGEQL
ATPD_RALEJ      MAETATIARPYAEALFRVASEAGNLGAWSELVSEMGQIAANPDIKALADDPNVPGDKLGDLFLSVVKSPV
ATPD_MARAV      MAELTTLARPYAKAVFDAAQDQNAVDQWDXXXXXXXXXXXXXEVKNILANPGLSEQRKAELFAECFEEPL
ATPD_CHRVO      MAELITVARPYAEAVYSLATEQGKLDQWSDALSWLAAMVNNPDLAQVVTNPKHTAQEVEALMLDVLGSRG
ATPD_XANOR      MSQALTLARPYGRAAFAIAREGGTFAPWSDALAFSAQVAGDPRVAALLLNPALGQEQAVTL---LAPPQA
ATPD_XANOM      MSQALTLARPYGRAAFAIAREGGTFAPWSDALAFSAQVAGDPRVAALLLNPALGQEQAVTL---LAPPQA
ATPD_HAEDU      MSELSTVARPYAKAAFDFALEQGQLDKWQEMLQ-FSALVAENEQVVEYITSSLASGQISEIFLQICDDQL
ATPD_VIBAL      MSDLTTIARPYAKAAFDFALEKDQLDQWGQMLSFAAEVAKNEQMNELLTGS-VSADKMAEIFVAVCGEQV
ATPD_SHESW      MAELTTIARPYAKAAFDFAIEHNAVDNWAEMLTFAALVSENETMQPLLNGA-LANTKLAALFINVCGEQI
ATPD_SHEPC      MAELTTIARPYAKAAFDFAIEHNAVDNWAEMLTFAALVSENETMQPLLNGA-LANTKLAALFINVCGEQI
ATPD_IDILO      MSELTTVARPYAKAAFDFALEQGALDKWAEMLSFAAAVAQDETIASFLSSSS-TVGKTTEVFLGVCGDEL
ATPD_XANOP      MSQALTLARPYGRAAFAIAREGGTFAPWSDALAFSAQVAGDPRVAALLLNPALGQEQAVTLLAQAGEDYL
ATPD_ACTSZ      MSELTTIARPYAKAAFDFAVEQSAVEKWHEMLAFIAEVAKDEQIQQFLTSS-LSPEKVADTVISICGEHL
ATPD1_VIBHB     MSDMTTIARPYXXXXXXXXXXXXQLDQWGQMLSFATEVTKNEQMNELLKGS-VSADKLAEIFVAVCGEQV
ATPD_ALISL      MSTMTTIARPYAKAAFDFAVEKNELNQWVQMLTFCSEVTKNKDMAQLLDGA-VAPEKLAEIFISICGEQL
ATPD_PSEHT      MSELTTIARPYAKAAFELAVEKGTIESWNEMLFFAGHVASNEKASALLAGMPTATTQA-ELFIQICAEQL
ATPD_HAMD5      -----TIARPYAKAIFDFAVEHHSIEHWQNMLAFSAQVSAHKQVTQWLSGVMH-SEKTAQIFISLCSDHL
ATPD_TOLAT      MSEVTTIARPYAKAAFDFAVEQKAVDSWLSMLLFAAEVSKDDTVQQVIHSSM-APEQLAQLFNQICGEQL
ATPD_RALEH      MAETATIARPYAEALFRVASESSNLGAWSELVSEMGQVAANPDMKAVAGDPNVPGDKLAELFLSVLKSPL
ATPD_RALME      MAETATIARPYAEALFRVASGAGNLGAWSELVSEMGQVAANPDMQALATDPNISGDKLEEVFLSVLKSPV
ATPD_PSYIN      MSELTTVARPYARAAFEFAVDSNKIEAWSEMLFFTAEVVNNPTMKILTSDK--TAQELAELFLNVCEDQL
ATPD_PSEA6      MSELTTIARPYAKAAFDYAVEQKIIAGWQEMLVFAAQVAQNPDIKNLMSGA-VAPESLAEIFNKICGEQL
ATPD_CUPTR      MAETATIARPYAEALFRVASESSNLGAWSELVSEMGQVAANPDMKAVADDPNVPGDKLAELFLSVLKSPV
ATPD_AZOSE      MAENVTIARPYADAAFELARGAGALGPWSEXXXXXXXXXXXXSMKACISNPKLSADQLYQLFIDVAGQGF
ATPD_THICR      MAELITIARPYAEAAFEVAKEEGKLVEWSEQLANLSAIVSDETMTAYMVNPSVTSEDVLKLLVDVMDSNL
ATPD_SHESH      MAEITTIARPYAKAAFDFAIENNAVDSWAEMLNFAAMVSENETIKPLLAGG-LASNKLAELFIGVCGEQV
ATPD_SHEAM      MAELTTIARPYAKAAFDFAVEKQAVDSWAEMLG-FAALVSENETMRPXXXXXXXXXXXXXXFIDVCGEQL
ATPD_AZOSB      MAENVTIARPYADAAFELARGAGALGPWSEALDRLAAVAADSSMRACINDPKLSADQLNTLVQEVGGN-L
ATPD_PSEU5      -----TLARPYXXXXXXXXXXXGQTDSWSKMXXXXXXXXXXXXXXXXXXDPRLTSESKVQALVRVLGDDA
ATPD_CHRSD      MAETSTVARPYAKAAFEYARDHKALEAWSQLASXXXXXXXXXXXXXXXSNPKLSHDQKTALLLEVCGE-L
ATPD_RALPJ      MAELATVARPYAEALFRVAKAG-NLGAWSELVSEMGQIAAVPDMKAVADDPKLSKADVAGIFLSALKSPV
ATPD1_PHOPR     MSDMTTIARPYAKAAFDFAVENGELAQWAEMLTFASEVVKNEAMQDILRSG-FSADKLTEIIVSVCDEQL
ATPD_KLEP3      MSEFVTVARPYAKAAFDFAVEHNSVERWQDMLAFAAEVTKNDQMAELLSGA-LAPETLSEAFIAICGEQL
ATPD_KLEP7      MSEFVTVARPYAKAAFDFAVEHNSVERWQDMLAFAAEVTKNDQMAELLSGA-LAPETLSEAFIAICGEQL
ATPD_SHELP      MAELSTIARPYAKAAFDFAIEKNAVESWAEMLSFAAQVSENETMKPXXXXXXXXXXXXXX-FIKVCGEQI
ATPD_RALSO      MAELATVARPYAEALFRVAKAG-NLGAWSELVSEMGQIAAVPDMKAVADDPKLSKADVAGIFLSALKSPV
ATPD_AERHH      MSELTTIARPYAKAAFEFAVEHKAVDQWLGMLGFAAQVAENETIHNLVNGS-VAAEELASIFVGICGEQL
ATPD_CITK8      MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA-LAPETLAESFIAVCGEQL
ATPD_PASMU      MSELTTIARPYAKAAFDFAIEQNAVEKWANMLHFSSELIKDETMQTFXXXXXXXXXXX-DTVISICGEQL
ATPD_SHEON      MAELTTIARPYAKAAFDIAVEHNAVDNWAEMLT-FAALVSENETMKPLLTGSLASTKLAALFISVCGEQI
ATPD_DECAR      MAESVTIARPYAEALFRTAKESGNLAKWSEQVSLLGQVAANPDVSSAIGDPNVAAPQLVDLFRSACGTAV
ATPD_SHESA      MAELTTIARPYAKAAFDVAVEHNAVDTWAEMLTFAALVSENETMQPLLTGS-LASTKLAALFISVCGEQI
ATPD_MANSM      MSELTTIARPYAKAAFDFAVEQSATDKWTEMLGFAAQVADNEQIRDFFANT-FSVQKAADAMVSICGEQL
ATPD_SHEB9      MAELTTIARPYAKAAFDFAIEQDAVDSWAEMLTFAALVSENETMQPLLAGS-LASTKLAALFISVCGEQV
ATPD_SHEB8      MAELTTIARPYAKAAFDFAIEQDAVDSWAEMLTFAALVSENETMQPLLAGS-LASTKLAALFISVCGEQV
ATPD_SHEB5      MAELTTIARPYAKAAFDFAIEQDAVDSWAEMLTFAALVSENETMQPLLAGS-LASTKLAALFISVCGEQV
ATPD_SHEB2      MAELTTIARPYAKAAFDFAIEQDAVDSWAEMLTFAALVSENETMQPLLAGS-LASTKLAALFISVCGEQV
ATPD_COXBU      MALHLTLARPYAKAAFADGQKANQLEAWLAVFTAFSKIIKNKEVARQIINPKFSDKEIKTLLFDLIQTIE
ATPD_COXBR      MALHLTLARPYAKAAFADGQKANQLEAWLAVFTAFSKIIKNKEVARQIINPKFSDKEIKTLLFDLIQTIE
ATPD_COXB2      MALHLTLARPYAKAAFADGQKANQLEAWLAVFTAFSKIIKNKEVARQIINPKFSDKEIKTLLFDLIQTIE
ATPD_JANMA      MAELATIARPYAEALFRVAKAA-DLNSWANLVSEMAQVAANPDVYALAHNPKVSDDLISSTFISALKSPV
ATPD_HERAR      MAELATIARPYAEALFRVAKAA-DLNGWSELVSEMAQVAAHPDVYALAHNPKISDDVISSAFISALKSPV
ATPD_ACIBS      MAELLTLXXXXXXXXXXXXSEQGATDNWSNALQVLSAAVQDEAFSAYLNRPEHTPAEQVKLFAKVLGEDQ
ATPD_HAEIE      MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSS-LSAQKLADTVISICGEQL
ATPD_HAES1      MSELTTIARPYAKAVFDFAVEQSEKDKWANMLEFLSELIRHDKVQTYLTSTSSTFK-LADTVISICSEQL
ATPD_HAEIN      MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSS-LSAQKLADTVISICGEQL
ATPD_HAEIG      MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSS-LSAQKLADTVISICGEQL
ATPD_HAEI8      MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSS-LSAQKLADTVISICGEQL
ATPD_AZOVD      MINNQTLARPYXXXXXXXXXXXNGSDAWSGMLGXXXXXXXXXXXXXXXRNPRLTRESKVEAVLRLFADDV
ATPD_ACIBY      MAELLTLXXXXXXXXXXXXSEQGATDNWSNALQVLSAAVQDEAFSAYLNRPELTPAEQVKLFAKVLGEDQ
ATPD_ACIBT      MAELLTLXXXXXXXXXXXXSEQGATDNWSNALQVLSAAVQDEAFSAYLNRPELTPAEQVKLFAKVLGEDQ
ATPD_ACIBC      MAELLTLXXXXXXXXXXXXSEQGATDNWSNALQVLSAAVQDEAFSAYLNRPELTPAEQVKLFAKVLGEDQ
ATPD_ACIB3      MAELLTLXXXXXXXXXXXXSEQGATDNWSNALQVLSAAVQDEAFSAYLNRPELTPAEQVKLFAKVLGEDQ
ATPD_HAES2      MSELTTIARPYAKAVFDFAVEQSEKDKWTNMLEFLSELIRHDKVQSYLTSTSSTFK-LADTVILICGEQL
ATPD_BURCM      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVARLPEVLSVASSPKVTRTQVVELLLAAVKSPV
ATPD_BURA4      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVARLPEVLSVASSPKVTRTQVVELLLAAVKSPV
ATPD_LARHH      MAELITVARPYAEAVFRLAKDEGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEAEVVTLLGGILGDKA
ATPD_COXBN      MALHLTLARPYAKAAFADGQKANQLEAWLAVFTAFSKIIKNKEVARQIINPKFSDKEIKTLLFDLIQTIE
ATPD_COXB1      MALHLTLARPYAKAAFADGQKANQLEAWLAVFTAFSKIIKNKEVARQIINPKFSDKEIKTLLFDLIQTIE
ATPD_DIAST      MAELATIARPYAEALYKACTDQAGVDLNGATVDELAAIAANPQLRQLADNPKVTGEQVFDVIVGVARSAL
ATPD_BURCH      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVARLPEVLSVASSPKVTRTQVAELLLAAVKSPV
ATPD_BURCC      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVARLPEVLSVASSPKVTRTQVAELLLAAVKSPV
ATPD_BURCA      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVARLPEVLSVASSPKVTRTQVAELLLAAVKSPV
ATPD_ACISJ      MAELATIARPYAEALYKACTDQAGVDLNGATVDELAAIAANPQLRQLADNPKVTGEQVFDVIVGVARSAL
ATPD2_VIBHB     MSELTVVAQPYAKAAFDYARDVECLDDWQQMFAITVVLEQPNTLLVLNDLDEDGSEQLLDLILHAGGEWL
ATPD_COLP3      MSELTTVARPYXXXXXXXXXXXXXIDSWLVQLTFAAEVAKDETIKGFLSSGA-SVEQAQTLFLNVCGEQV
ATPD_BLOPB      MSSMLVVARTYAQAIFDIAVEQKNINKWKSVLDLFSEISLNRLVQSLFFEPKRLSDIFIAICEDYQKKQV
ATPD_ACIB5      MAELLTLXXXXXXXXXXXXSEQGATDNWSNALQVLSAAVQDEAFSAYLNRPELTPAEQVKSFAKVLGEDQ
ATPD_ACIAD      MAELLTLXXXXXXXXXXXXSEQGATDNWSTALQVLSAAVQDEAFSAYLNRPELTPSEQVELFAKILGEDQ
ATPD_SHEDO      MAELTTIARPYAKAAFDFAIENNAVDSWAEMLNFAALVSENESMKPLLTGG-LASGKLAALFISVCGEQV
ATPD_BURVG      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVAHLPEVLSVASSPKVTRKQVAELLLVAVKSPL
ATPD_ACIAC      MAELATIARPYAEALFKACAAQPGADLGSTVVDELAAIAADPQVRQLADNPKIESGQLFDLIAGVVRAPL
ATPD_NEIG2      MAEFATIARPYAKALFGLAQEKNQIESWLGGLEKLAAVVQEGKVALLIDRPETNASEKADILIDLVG-LK
ATPD_BURXL      MAELATIARPYAEALFGVAEAG-DIAAWSTLVQELAQVARLPEVLSIASSPKVSRAQVSELLLTAVKSPL
ATPD_BURS3      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVARLPEVLSVASSPKVTRTQVAELLLAAVKSPL
ATPD_BURPP      MAELATIARPYAEALFGVAEAG-DIAAWSTLVQELAQVARLPEVLSIASSPKVSRAQVSELLLAAVKSPL
ATPD2_VIBSL     MSDYTNIAHPYAKASFDFALGENKLQEWHSMLSILVTVAEEETIQISSAEGVHTSEELVNLIIHVCQGLV
ATPD_BURTA      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRAQVAELLLATLKSPL
ATPD_LEGPL      MSDSTTIARPYAKAIFEHALAEKKLSEWSEYLTLLAQVVLTPQATQFIANPASTDEQQIELLIEICGSKF
ATPD_LEGPC      MSDSTTIARPYAKAIFEHALAEKKLSEWSEYLTLLAQVVLTPQATQFIANPASTDEQQIELLIEICGSKF
ATPD_LEGPA      MSDSTTIARPYAKAIFEHALAEKKLSEWSEYLTLLAQVVLTPQATQFIANPASTDEQQIELLIEICGSKF
ATPD_PSEMY      -----TLARPYXXXXXXXXXXXXXXXXWLNMLSLSXXXXXXXXXXXXXXNPALTDEQKVNVLAQICAGHI
ATPD_NEIMF      MAEFATIARPYAKALFGLAQEKNQIESWLGGLEKLAAVVQEGKVASLIDRPETNASEKADILIDLVG-LK
ATPD_NEIMA      MAEFATIARPYAKALFGLAQEKSQIESWLGGLEKLAAVVQEGKVASLIDRPETNASEKADILIDLVG-LK
ATPD_NEIM0      MAEFATIARPYAKALFGLAQEKSQIESWLGGLEKLAAVVQEGKVASLIDRPETNASEKADILIDLVG-LK
ATPD_NEIG1      MAEFATIARPYAKALFGLAQEKNQIESWLGGLEKLAAVVQEGKVASLIDRPETNASEKADILIDLVG-LK
ATPD_LEGPH      MSDSTTIARPYAKAIFEHALAEKKLSEWSEYLTLLAQVVLTPQATQFIANPASTDEQQIELLIEVCGSKF
ATPD_DELAS      MAELATIARPYADALFK-ASTQQGADLSGTVXXXXXXXXXXXNPQLLADDPKVTDEQLFDVISGVAGSAL
ATPD_NEIMB      MAEFATIARPYAKALFGLAQEKNQIESWLGGLEKLAAVVQEGKVASLIDRPETNASEKADILIDLVG-LK
ATPD_BURP6      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVXXXXXXXXXXXX
ATPD_BURP0      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVXXXXXXXXXXXX
ATPD_BURMA      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVXXXXXXXXXXXX
ATPD_BURM9      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVXXXXXXXXXXXX
ATPD_BURM7      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVXXXXXXXXXXXX
ATPD_BURPS      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVXXXXXXXXXXXX
ATPD_BURP1      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVXXXXXXXXXXXX
ATPD_BURM1      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVARLPEVLSVASSPKVTRAQVXXXXXXXXXXXX
ATPD_BORPD      MAELSTVARPYAEALFSAARDDKGLPAWADLIGELAQVAGNPDVREAMTDPRLGDAQRIELFTGLVKTQL
ATPD_XANCP      ---------------------------WSDALAFSAQVAGDPRVAALLLNPALHQDQAVTLLAPPAAEA-
ATPD_XANCB      ---------------------------WSDALAFSAQVAGDPRVAALLLNPALHQDQAVTLLAPPAAEA-
ATPD_XANC8      ---------------------------WSDALAFSAQVAGDPRVAALLLNPALHQDQAVTLLAPPAAEA-
ATPD_BURP8      MAELATIARPYAEALFGVAEAG-DIAAWSTLVQELAQVARLPDVLSIASSPKVSRAQISDLLLAAVKSPL
ATPD_LEPCP      MAELATVARPYAEALYQVAR-QGDVAVWVEQVSALAQVAENAELRQFAGSPKVSAEQVYDVVAAAAGVSL
ATPD_BURMS      MAELATIARPYAEALFRVAEGG-DISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVXXXXXXXXXXXX
ATPD_BURCJ      MAELATIARPYAEALFRVAEGG-DIAAWSTLVQELAQVARLPEVLSVASSPKVTRTQVXXXXXXXXXXXX
ATPD_XYLFM      --------------------------QWSQALTFSAQVANNPIAATLLSHPQLDHEQAAALLSPEGADP-
ATPD_XYLFT      --------------------------QWSQALTFSAQVANNPIVATLLSHPQLDHEQAAALLSPEGADP-
ATPD_XYLF2      --------------------------QWSQALTFSAQVANNPIVATLLSHPQLDHEQAAALLSPEGADP-
ATPD_CELJU      MAELTTLARPYXXXXXXXXXXXNQLQSWYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVQVCGDQL
ATPD_XYLFA      --------------------------QWSQALTFSAQVANNPIAAALLCHPQIDHEQAAALLSPEGADP-
ATPD_POLNA      MAELATIARPYADALYK-AQGS-DLATTALWVDKLAAVAGNAQLLQFADSPKVSVDQVFDVVAGVASDPL
ATPD_RUTMC      --ELVVIAKPYANAIFELAQQDKSYLQWKMVLDAGAQLLIDEQMCKFIAFPNVLKQDKLSVIKELLKSIL
ATPD_BORPE      MAELSTVARPYAEALFGAARDDKGLAVWADLVSEMAQVAANPDVREAMADPRLDDKQRSEVFTGLIKSQL
ATPD_BORPA      MAELSTVARPYAEALFGAARDDKGLAVWADLVSEMAQVAANPDVREAMADPRLDDKQRSEVFTGLIKSQL
ATPD_BORBR      MAELSTVARPYAEALFGAARDDKGLAVWADLVSEMAQVAANPDVREAMADPRLDDKQRSEVFTGLIKSQL
ATPD_STRM5      ---------------------------WSDALAFSAHVAADPRVAALLANPELGRDDAVALLAPV---TH
ATPD_METCA      MSELTTLARPYAVAVFKAAKEAGNIQEWADMLEFLKQVMADPLMQRAASDPKAGKDRFIAKFLDLCKGHV
ATPD_STRMK      ---------------------------WSDALAFSAHVAVDPRVAALLANPELGRDDAVALLAPVSHG--
ATPD_VARPS      MAELATIARPYAEALFKASSSDAGTSAW---LEKMAVIAASPELQQFADNPKATAEQVLGVVAGAFGAPL
ATPD_POLSJ      MAELATIARPYAEALFKASGS--DXXXXXXXXXXXXXXXXNVQLQQFAGNPGVTVTQTFDVISGVAKSQL
ATPD_BUCAT      -----TIARPYAQAIFEIAIENNTIEKWKNILIFIKTIASHKKFKNFLSSPKYLSL----IFITIGTNII
ATPD_BUCA5      -----TIARPYAQAIFEIAIENNTIEKWKNILIFIKTIASHKKFKNFLSSPKYLSL----IFITIGTNII
ATPD_BUCAI      -----TIARPYAQAIFEIAIENNTIEKWKNILIFIKTIASHKKFKNFLSSPKYLSL----IFITIGTNII
ATPD_FRATM      ------IAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVAAIVSSPTISQIEVVDALKK----QL
ATPD_FRATW      ------IAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVAAIVSSPTISQIEVVDALKK----QL
ATPD_FRATT      ------IAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVAAIVSSPTISQIEVVDALKK----QL
ATPD_FRATO      ------IAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVAAIVSSPTISQIEVVDALKK----QL
ATPD_FRATN      ------IAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVAAIVSSPTISQIEVVDALKK----QL
ATPD_FRATH      ------IAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVAAIVSSPTISQIEVVDALKK----QL
ATPD_FRATF      ------IAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVAAIVSSPTISQIEVVDALKK----QL
ATPD_FRAT1      ------IAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVAAIVSSPTISQIEVVDALKK----QL
ATPD_POLSQ      MAELATIARPYAEALFQSAKPAE-LAGCXXXXXXXXXXXXXPEVAALSNNPKVSADDLSKLLSGMVKTKL
ATPD_VEREI      MAELATIARPYAEALFK-ATTGAGVDPVSXXXXXXXXXXXXXELRQLAGNPKVTADQVFALFTQVLKDAL
ATPD_ROSDO      ------VAARYATAVYDIAKDSKSVKTLEDDINVLQGLAESADFGALIMSPIYTREEISALAAKMG---L
ATPD_METNO      ------VAGRYASALFELAREERAVDAVSEGLDRFDALLKESDLQRLVRSPVFTSEQVKAIDAVLARAGI
ATPD_FRAP2      MTNLSVIAKPYAKAAFEFANEYNLLQEWSKQLKSFAELVQDDXXXXXXSSPEISQTEIINTVK----DQL
ATPD_PSYWF      MAELSTLARPYAKAAFDYAHENSVIGEWEDFLFIASSVVGDSAFVQMLENPAITAEQKADMLVSIYDEQV
ATPD_METS4      ------VAGRYASALFELARDERAVDAVTEGLDRFDALLRESDLQRLVRSPVFTEEQVKAVEAVLARAGI
ATPD_SYMTH      ------VARRYARALFELAQEKGLLDQVNRELELVVSMYEDSYLRAFMNDQRISPSQKRKVLASVLEGKV
ATPD_DICNV      MSQTETIARPYAKAVFEQAVETESVANWIDFLEIASTFVSNEAVKEHLASASFMENFLVWFLVESRGEAL
ATPD_POLNS      MADLATIARPYAEALFQSAKPAE-LAGCXXXXXXXXXXXXXPEVAALSNNPKVSADDLSKLLSGMVKTKL
ATPD_BUCAP      -----TIARPYAKAIFELAIENQSIEKWKKTLIFINEIIRSKKIE-KXXXXXXXXXXXXXXXIFVAGDHI
ATPD_BORA1      MAELSTVARPYAEALFGAACDDKGLVSWADLVGELAQVAANADVREAMTDPRLNDAQRAQVFTSLIKSPL
ATPD_PSYCK      MADLSTLARPYAKAAFDYANENGAVNEWEDFLFVAATVVNDKSFSTWLDNPAVSAEHKSAALVDLY-DTQ
ATPD_PSYA2      MADLSTLARPYAKAAFDYANENGAVNEWEDFLFVAATVVNDKSFSTWLDNPAVSAEHKSAALVDLY-DTQ
ATPD_OLICO      ------VAGRYATALFELARDQKSIDAVRADVDKFAALLADNDLVRLVRSPVFTAEQGKALDAVLTKAGI
ATPD_PARL1      ------VAGRYATALFELADAEGALDAVAGDLEISAMLNESSDLVRLVRSPIFSAEKAFGAVLEKAG--I
ATPD_NITWN      ----------YATALFELAREDKSIDAVKADLDKFAMLAESPELVRLVRSPVFSADQSKALAAVLSKAGI
ATPD_ACIF5      MADLITVARPYAEALYGLAKESGQEXXXXXXXXXXXXXXXXVQAQAFLTDPERADAEKVSLLSAVPVAVD
ATPD_ACIF2      MADLITVARPYAEALYGLAKESGQEXXXXXXXXXXXXXXXXVQAQAFLTDPERADAEKVSLLSAVPVAVD
ATPD_OCHA4      ------VAQRYAGSLFELALDAKSVAAVEKDLDRFEALLSGSELKRLISSPVFSSEDAIGALADKAG--I
ATPD_DESHY      ---KGAIAQRYAQALFELA-VQENLDGIEAELQELVQVEQNAEVAHVLYHPHISLSEKKDLMNKIFAGEL
ATPD_DESHD      ---KGAIAQRYAQALFELA-VQENLDGIEAELQELVQVEQNAEVAHVLYHPHISLSEKKDLMNKIFAGEL
ATPD_METPP      MAELATIARPYAEALFRAAPKGEAAG-WXXXXXXXXXXXXXXXLRQFADSPKVAAQQVFDLVAGVTKQTL
ATPD_GEMAT      -----SVARNYAEALLVLARKADDAEGWGALLRQVADINNDVNLSRFLESPRIAAEQKSVVLSKALGDKV
ATPD_SILST      ------IADRYATAIFEIAAESNALDNLETSINLAASLADSEDLRTLITSPLVSREEQAAAISAVADKML
ATPD_AGRVS      ------VAERYASSLFELAREAGSVDAVAGDLNRFQAMIDESDLQRLVTSPAFTSEQQASAIAEIGG---
ATPD_RHOP5      ------VAGRYATALFELARDQKSVDAVKADLDRFAMLAESPDLTRLVRSPVFSADALVAVLAKAG---I
ATPD_GEOLS      ------IARRYAKALVQLGSEKDLIDRFSQELKVVSGVAGNAELRAAFGNPAFTADQKKQIMRDIARMQC
ATPD_BRUSI      ------VAQRYAGSLFELALDANSVASVEKDLGRFEALLSGSELRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BRUO2      ------VAQRYAGSLFELALDANSVASVEKDLGRFEALLSGSELRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BRUC2      ------VAQRYAGSLFELALDANSVASVEKDLGRFEALLSGSELRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BRAJA      ----------YATALFELARDQKAVDEVKADLDRFALLGESADLKRLVRSPVFAADQSRALTAVLDKVGI
ATPD_RHOPT      ----------YATALFELARDEKSIDAVTADLDKFAMLAGSPDLVRLVRSPVFASEQGKALAAVLDKAGI
ATPD_RHOPA      ----------YATALFELARDEKSIDAVTADLDKFAMLAGSPDLVRLVRSPVFASEQGKALAAVLDKAGI
ATPD_CARHZ      --KSLAVAKRYASALFELAREKGAIDSISHDFEVLEKAIQETDVKKVLDNPAAKKELLEKLFPDFNPIT-
ATPD_BACCR      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVVKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACCQ      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVVKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACC7      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVVKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACC4      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVVKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACC1      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVVKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_SILPO      ------IAQRYATAIFAIAQDNNDLKGLETGINLTAALGESADLRSLIASPLVSAEQEAAITAVAKKMKL
ATPD_GEOSF      ------IAKRYAKALVQIGAEEGNVDKFSGELSQFTGLAGSTSLTAVFSNPAYGIEAKKEILKEIMTKLL
ATPD_BRUSU      ------VAQRYAGSLFELALDANSVASVEKDLGRFALLSGSKDLRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BACC2      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVVKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_GEOMG      ------IARRYAKALVQLGAEEDAVDRFGAELGQFAALLENADIDSVLKSPAYRIEAKREILKDVLAKSL
ATPD_BEII9      ------MAGRYAQALFSLAKESGTIDQVASDLQRLREIYRESELQRFIGSPAFSSEQVKVLNALLNKVEI
ATPD_GEOUR      ------IARRYAKALVQIGAEEGQVDKFNSELTQFNTLAANAGLTSVFSNPAYGIEAKREILKEIIGKAL
ATPD_THIFE      MADLITVARPYAEALMGWRKAARNRPGRMHCRRLPAMIA-DVQAQAFLTDPERRDAEKVSLLSAVPVAVD
ATPD_RHIE6      ------VAERYASSLFELALEHGAVDSVTADLDRFAMLDESAELKRFVASPVFSAEDQLKAIVAISERAI
ATPD_NITHX      ----------YATALFELAREDKSIDAVKADLDRFDAMLADSELARLVRSPVFSADQAKALAAVLDKAGF
ATPD_CHLP8      -------SRRYALALLEVAIEANFLDTVTELLKIQEVLSGSRELLLALRSPLINVDLKSRILEEIFGKEV
ATPD_SYNP6      ---------PYAEALMAIAREQGLEDRFGEDAALFSTLAASADLRHLLENPTLFSSQKKAVLNQVFGSSV
ATPD_SYNE7      ---------PYAEALMAIAREQGLEDRFGEDAALFSTLAASADLRHLLENPTLFSSQKKAVLNQVFGSSV
ATPD_ZYMMO      ----------YALALFEVAQEKGQIDTVAASLGKFDEFAQARELRLLANNQIFSREKAIAALVPVLA--I
ATPD_RHIEC      ------VAERYASSLFELALEQGAVDSVTADLDRFAMLDESAELKRFVASPVFSAEDQLKAIIAISERAI
ATPD_DINSH      ----------YATAIFELAKEENNIXXXXXXXXXXXXXXKESEFRDLISSPVYSRDEQAGAIGAIAKKLL
ATPD_DESRM      ------VARRYAQALYEIAQEKNALEAMEQELKGVAEAIEGTELQKVLYHPQVLPGEKKNLLKALFTDKV
ATPD_BRUAB      ------VAQRYAGSLFEHALDANSVASVEKDLGRFEALLSGSELRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BRUA2      ------VAQRYAGSLFEHALDANSVASVEKDLGRFEALLSGSELRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BRUA1      ------VAQRYAGSLFEHALDANSVASVEKDLGRFEALLSGSELRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BRASO      ----------YATALFELARDEKSVDAVKADLDKFNALLDESDLKRLVRSPVFGADQLKALNAVLDKAGI
ATPD_ANAD2      -----SIARRYARALFSLAVEQGRVEPWNDALQVLKNAVEGSDLRDVLSNPVYSKEQRRAIVEKLASALK
ATPD_GLOVI      ------IAQRYAEALKELALSETG------LLEQFGN-DTDGMLQVMEESPRFLVVPIIALLVEAFGGKV
ATPD_BREBN      ------VGKRYARALFEVASERSKIDQVEADLGAIVEAVEGNELKKIMLHPHIAADAKATLADELFKSHV
ATPD_ANADE      -----SIARRYARALFSLAVEQGRVEPWNDALQVLKNAVEGSDLRDVLSNPVYSKEQRRAIVEKLASALK
ATPD_RHOFD      MAELATIARPYAEALFKASLSDLNGAAWVEELET---IAKNPQLLQFADNPNVTAAQVYELIAGIAQGAL
ATPD_RHILO      ------VAERYAGSLFELALQANSVAKVESDLNSFAMLAGSSDLTRLINSPVFSGEQXXXXXXXXXXXGI
ATPD_BRUME      ------VAQRCAGSLFELALDANSVASVEKDLGRFEALLSGSELRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BRUMB      ------VAQRCAGSLFELALDANSVASVEKDLGRFEALLSGSELRRLISSPVFSSEQLHXXXXXXXXXXX
ATPD_BRASB      ----------YATALFELARDEKSVDAVKADLDKFNALLDESDLKRLVRSPVFGADQLKALNAVLDKAGI
ATPD_RHOPS      ----------YATALFELARDEKVIDAVKADLDKFAMLVESPELLRLVRSPVFGAEKALGAVLDKAG--I
ATPD_METEP      ------VAGRYALALYELAHDQGQVDDVAKNLDAFDALYRESDLRRLVRSPAYSAAEAVGALLDRAG--I
ATPD_DESPS      ------LARRYAKAVFSIGADSGKYGEYNDALQAVANLMTNPDVVDALTNPLYPLELMVGIVKSMDIDAV
ATPD_BACWK      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVTKNGELHSFLTQPNISKEQKKTFLANVFA-SV
ATPD_BACCN      ------VAKRYAVALFQIAKEKHVLEMFEEELGLVQSVMKNEELHSFLTKPNISKEQK-KMFLSNVFSSV
ATPD_RHOPB      ----------YATALFELARDEKAVDAVKADLDRFKAMLADSELTRLVRSPVFSAEQSKALAAVLDKAGF
ATPD_PELTS      ------VAVRYAEALYEIASREKVLPKYKSMVDRVEEIRENSDLQKLLYHPRITAEEKKDLLQKLFKGKI
ATPD_NOVAD      ----------YASALFDLANDQGFVSAVEGDLEKLAALRESADLKGLINNPQLGRDEAGRAMDAVAGLLL
ATPD_LACPL      --DNLTIASRYSKALFELAVEK---DQTEAFLAELKQLR-----QVFVDNPQL-AEVLSGSLLPVDQDHA
ATPD_LACJO      ------IASRYSKALFAYAQDANSLDAVHEDMNVLLQVAKENDMLRLLSDPIIRKNQKEE-FLSSFSDKF
ATPD_DESAH      --KSVSVSRRYATALMLIGKEDGNTDQYRKELDIVQFFDANPELEQTISNPLYDKNDRKNVLIAVGG--L
ATPD_SYNP1      ------LVEPYAEALLSLAQSHNLADQFQQDSGLILDLAASAELQEFLANPLINPDAKKNVLRQLTVDKV
ATPD_METPB      ------VAGRYALALYELARDEGQVDDVAKNLDAFDALYRESDLRRLVKSPAFSAEEAVGALLDRAG--I
ATPD_CHLCH      ----VIASRRYANALLSVVEESNTIDKTLDEMNAISEVLHHSDLVHALKSPLISYDKKIHIVEEVFKGRV
ATPD_BACHK      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVEKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACCZ      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVEKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACC3      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVEKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACC0      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVEKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACAN      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVEKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACAH      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVEKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACAC      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVEKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_BACAA      ------VAKRYAVALFKIAKEKHVLEMFEEELRLVQNVEKNGELHSFLTQPNISKEQKKTFLANVFG-SV
ATPD_ANTSP      ------IANPYADALLELSLLNNAMDKASSDLSMILEISKSADLKLFLSNPLVEDNLKKNVLNQLFKDKV
ATPD_RHIL3      ------VAERYASSLFELALEQGAVDSVTADLDHFAMLDESADLKRFVASPVFSAEDQLKAIVAISEKAI
ATPD_DEHE1      MAKRVAIAMRYAQALYELAKEQKSLDKWQEDLQDLSSLTEDASVAEFLSNPKIASARKHKVLAKLSN--I
ATPD_BUCBP      ----------YAKAIYNCAISNQSLDHWKTMLQLMAXXXXXXXXXXXXSKA-YFSQHVISLFIDLCCNKV
ATPD_TRIEI      ------IVEPYAAALMSLAQSKDLTDKFAEDVRSLINILDESEFKQFVGNPVIKQEDKKAVVKRMLGEQV
ATPD_SPHWW      ----------YATALFGLARDEKAIDAVSASLSLKAALTESDDFRRLTTSPLVSRDEAMATAASLGIDPL
ATPD_CYAP7      ----LEIAEPYAQALMSVSQSNNLTERFGEDIRSLLDLLNNSELREFLSNPVIREENKKEILQRIMGDQT
ATPD_RHILW      ------VAERYASSLFDLALEQGAVDSVTADLDRFAMLDESADLKRFVASPVFSAEDQLKAIVAISEKAI
ATPD_ANASK      -----SIARRYARALFSLAVEQGRVEPWNDALQVLKNAVEGSDLRDVLSNPVYSKEQRRAIVEKLASALK
ATPD_METC4      ------VAGRYALALYELAHDQGQVDDVAKNLDAFDALYRESDLRRLVRSPAYSAAEAVGALLDRAG--I
ATPD_CLONN      --------RRYALALYEVAEKNGKIDQYIEELKQIVDLIKNNELSKIVHHPQITTSKKKKIFKEIFTGKI
ATPD_CHLL2      -------SRRYAWALLSAAEEGQFLDQATDALNSIKELANSRDLVHVLRSPLINGDKKTHILEEVFKEIA
ATPD_LEUMM      MAKNIKIANQYAKAIFELAGEQDNVDEVLTDLRTIKTVLDENQNFITIADVAIASRD--DLLKTLTGNS-
ATPD_LACGA      ------IASRYSKALFAYAQDAKKLDEVHEDMNVLLQVAKENDMLRLLSDPIIRKNQKXXXXXXXXXXXX
ATPD_CLOD6      ------IANRYAEALFQLGEEENSTDVLFKELEKVVDMMTSKDFYKVLKSPLVSKSEKKNLVEIIFSKEV
ATPD_AGRRK      ------VAERYASSLFELALEEGAVPAVTADLDRFQAMLDDSDLKRFISSPVFSAEEQVGAVQALATKAG
ATPD_HELMI      ------VARRYAQALLEIGIQTKTLDALEGELGRFVEMIGHPELQRFLFHPSIVKKDLVGRLLATGA--F
ATPD_GEOSL      ------IARRYAKALVQLGAEEGAVDRFGVELGQFALLDGNADLASVLKSPAYRIEAKREILRDVLAKNL
ATPD_DESOH      ------IQRRYAKALLLIGKEDNNAEQYKEELNGFVSLDMEKAFESAITNPLYPVEKVLDMVIEKLG--V
ATPO_NEUCR      ----------YATALYTAAVKTSALEPTAKAISSLGNLAKDPKLASILETPTLSPADKSAIVAELQKSVS
ATPD_PORPU      ------IAQPYASALLDLANEKKAIEQISQDMKLIKDLLQSGKLKYFLANPLKTIEAKKQVIAATFGDQI
ATPD_DEHSC      MAKRVAIAMRYAQALHELAKEQKSLDKWQEDLQNLSRLTEDASVDEFLSNPKIVSARKHAVLAKLSD--I
ATPD_DEHSB      MAKRVAIAMRYAQALHELAKEQKSLDKWQEDLQNLSRLTEDASVDEFLSNPKIVSARKHAVLAKLSD--I
ATPD_XANP2      ------MAGRYATALFELASVKADLDRLSALIAESADLAR------LVKSPVFSAEQLKAISAVLDQAGI
ATPD_RHOP2      ----------YATALFELARDEKVVDAVTADLDKFKAMLADSDLLRLVRSPVFGAEKALGAVLDKAG--I
ATPD_CYAP8      ------IAEPYAQALMSVAQAHNLTEQFGDCRSLIAILEESRDLQGLILSPVIKETDKKAVLRRMMGDRT
ATPD_AGRT5      ------VAERYASSLFELALEAGTVEAVQVELDKFGALLDESDLKRLVASPVFSAEKAISAICEKAG--I
ATPD_LEUCK      ------IADQYAKAIFELSSEQGNVEDTRKDLDTLKVVFENNPNFVIVSSNDINSEARDGLLTTLTTGA-
ATPD_VESOH      ------IAKPYANAIFELAQQDNSHLQWKMVLDVGAYLLLDKKMRRLIASPNILEQDKLALLMSILNREL
ATPD_THEM4      -----TISSKYVNALLMVGKKVNKIEDYGELLKALCDVY--VQFKDFFDNPAVKVWKKVETIKESFGTSI
ATPD_ERYLH      -----SLAGRYASALFELAAEEGVVTAVESDLDLHAALGESDDLKAVTNNPEISRKDQASAIEGVAGVLL
ATPD_THERP      ------VAKRYAQAAFAVAKEHGQLDFWEQRLTDLEALARDSAVEEFIQNPAIPLEAKVQVIDRLFPGDX
ATPD_AZOC5      ------MAGRYATALFELAEEAGSTDAVAADLDRLKGLAESADLERLVKSPVFTAEEQVXXXXXXXXXXX
ATPD_CLOB8      ------LEKRYALALYEIAEKNNKVDEYLRDLTDICDIFDENEFYEVINHPKINTAKKKQLFTDLFKGKI
ATPD_ANADF      -----SIARRYAKALFSLAVEKGRVEPWSESLQSLKEGVEGSDLREVLSNPVYSREQRRAIVEKLAAALR
ATPD_CYAA5      ------IAEPYAQALMSLAQSRDITRSIGEDCRSILDILEESELREFISSPIIKDEDKRGVLNRLLGNDI
ATPD_BACSK      ------VANRYAVALFELAEEKGQTDVFERELELVQEVFETTQLETVLAQPGLAADKKQALLRDAFQAHL
ATPD_RUBXD      ----------YAEALFGAAREKDELERVLDDLREFCRALRESEELALFFYGEQIPEREKRRAIEALTEGM
ATPD_PHEZH      ----------YAQALFDLASEQKEVPAVEADLSLKAAIADSRDLRVLLASPAFADDKRKGLSAIADKAKF
ATPD_CLOPE      --------RRYALALYEVAEEKNKVEEYLNDLREICDIIYNNELYEIIKHPQISTVRKKKTFRNIFEGKI
ATPD_CLOP1      --------RRYALALYEVAEEKNKVEEYLNDLREICDIIYNNELYEIIKHPQISTVRKKKTFRNIFEGKI
ATPD_SYNY3      ------IAEPYAQALIGLAQQQNLTEVFGDNLRSLLTLLQDSDLSAVLSSPVVKDEDKKSVLRSVLGDGG
ATPD_PORYE      ----IKIAQPYAVALLDLAKTKKVTEKVSQDIQSIQNLAQSDKLKIFLANPLKTVEAKKEVIIATVGDQI
ATPD_OCEIH      ------VAKRYADALFQLGREKNSLDQLADFLEVRQIFTNDQKLNVFLKHPKIDNEKKKQFLADVGADPV
ATPD_DESAA      --KNLKVARRYAKALLLIGKEDGQAEVYREELEAFSSLFKNPDLEAAISNPIYEAQALLRSVVEKSG--V
ATPD_METRJ      ------VAGRYASALFELARDERQVDAVAESLNQFDGLLKESDLRRLVRSPVFSAEEAIGAVLDKAG--I
ATPD_CHLPD      -------------------------------------LDQSRELVHVLRSPVINADKKTHILQEVFADTV
ATPD_BAUCH      ---EITISRPYAKAVFEFAIEHNTVASWQSMLLYASKLNSNPYIAKLLSSTVITNTKIADIFIAVCGNKL
ATPD_SYNS9      -----SLATPYAEALLQVTEARSESEQCKQLLSVWDSSARDAMVSPVLE-PSSKKKALQGLLAE----QV
ATPD_SINMW      ------VAERYASSLFELALEAGSIEA------VGADLTRSADLKRLIVSPVFSADKAISALVEKFG--V
ATPD_LYSSC      ------VAKRYAQALFELAQQKNILAEVGADLNELTKIVQESDFLTLLNAPKFSIERKKQMVAEIFAGAT
ATPD_GEOSW      ---KEIIAKRYALALFQIATEKQLLDQLEEEIRVWQVFAENDKFLSLLTYPKLSLEKKKALIKETFA-AV
ATPD_THEEB      ------VVEPYAEALLSLAQTHNLIDQFQQDTQLMVELVASSELQQFLANPLIKPEAKKNVLRQLTVDKV
ATPD_RHOBL      ------IAERYATALFELSKETGALKTLETDIDALKDLAGSPDLGAMIASPVISRGDQAKAVAAIAGKML
ATPD_PELPB      -------------------------------------LEHSRDLVYALRSPLVKGDRKIHILEEIFKDSV
ATPD_MACCJ      ----------YAQSLFEVAQAQGVHESVRQLVEIKEGLAGNKAFFAFAEDPKVSSEKRHA-FVEATFSGV
ATPD_LACBA      ---RATVAKRYSQALFDLLQLESGYTELQELRRIFQDNPQLSTMLSDASLQVADREALLQPLLKQASPYI
ATPD_CLOPD      ------VATRYASAIFEVGVELNKEEMFYEELKIISSNFEENEKFFMLKTPILSKQEKKELIENIYKDKA
ATPD_ALKMQ      ------VAKRYAKALFQVAFEMNRYEDVTEELAFVAELKQHSDLNELLKSPVITLGEKKEILSTIFKEQI
ATPD_MAGSA      ------IADRYATALFELADSSGSLDQVAGDLKTLQAMLRESDLRRVVDSPRNDQGKAISAVAKAAG--F
ATPD_BARBK      ------VSQRYAHALFDLVQKEGYVGDVEKALASFVILEQDKALKHLVQSPFLSVKEQVKAVCAVAHKKA
ATPD_SYNFM      --KNLIIAKRYSKALFNLAEEGRMIEQYGEELDNFVRLGKLPELADALRNPLFPEATRKAIFAAVAEQAL
ATPD_RHOBA      -AEKL--GKTYARALLAATQADGSTDAVVSDLNAICDLLHNPKLQLAFQSPQIDADEKCRVVDRLFGGNS
ATPD_JANSC      ----------------------------------------------------------------------
ATPD_CLOPS      --------RRYALALYEVAEEKNKVEEYLNDLREICEIIYNNELYEVIKHPQISTVRKKKTFRNIFEGKI
ATPD_SYNAS      ------IAKRYARAFFDIAGEDXXXXXXXXXXSGFARIVQDRNLKEFLANPVFNAEKKAVVEAIIQKIRM
ATPD_LISMO      MSKDLEVAGRYANALFQVAQDKDLVDVFSEELELKAALKANKDFVKLLENPTFTTEQKKNLASAV-FEKI
ATPD_LISMF      MSKDLEVAGRYANALFQVAQDKDLVDVFSEELELKAALKANEDFVKLLENPTFTTEQKKNLASAV-FEKI
ATPD_LISMC      MSKDLEVAGRYANALFQVAQDKDLVDVFSEELELKAALKANEDFVKLLENPTFTTEQKKNLASAV-FEKI
ATPD_LISW6      MSKDLEVAGRYANALFQVAQDKDLVDVFSEELELKAALNANKDFVKLLENPTFTTEQKKNLASAV-FEKI
ATPD_LISMH      MSKDLEVAGRYANALFQVAQDKDLVDVFSEELELKAALNANKDFVKLLENPTFTTEQKKNLASAV-FEKI
ATPD_LISIN      MSKDLEVAGRYANALFQVAQDKDLVDVFSEELELKAALNANKDFVKLLENPTFTTEQKKNLASAV-FEKI
ATPD_DESAP      ---KGAVAARYAQALFDVARDNNRIAETENELRGFMRLLDESDLQQVLYNPQVPVELKKEIVREAFGKEL
ATPD_CORDI      ----------------QLGQVEDELFRLSRILD------KEPELTLLLDDRSTDGAKKRELLAKVLYGKV
ATPD_THELT      ------IAAKYARALLNVAVELEKTEEYGDILAVVVQLYQKAKQ--FFDDPTIGAAERITKFINQIGAHF
ATPD_LACF3      -----TVANRYARAIFELAQEDGQLDQ------TYQELV--SVRQVFLDNPSL-APLLAGVDLGIKEDQV
ATPD_DESAD      ------VSRRYAKALFSVGQKQGEEDAYGLALTELSQILEDSEALRLFQNPVFSADXXXXXXXXXXXXTS
ATPD_BACME      ------VAKRYALALFQLATEKQMIDEMQDQLQIVEEVAKTPELMDVLTHPKITIERK-KQFVSEAFAEL
ATPD_BACHD      ------VANRYAVALFELAQEKGLHESFVSELELIKAVFQDTELMQFLTHPKTELTQKRELLEKTFKGKV
ATPD_ANAVT      ------VAQPYAQALLSIAKSKSLTEEFGTDARTLLNLAENQQLRNFIDNPFIAAENKKALIKQILSEA-
ATPD_GLUOX      ------LAQRYARALYDLASEQGNLDVLGEVKALRAAIAESDDLRKFLADARMDIRQSNVLMSKLGGDVL
ATPD_GEOKA      ------IAKRYASALFQIALEQGQLDRIEEVRAVRQALAENGEFLSLLSYPKLSLDQKKALIREAFAG-V
ATPD_CHLPB      -------SRRYAKALLDVAEEGGYVDQMVNDLDAVREVVAESDLLTMLRSPVVNGDLKARILKEVFNGAV
ATPD_BACA2      ------VSKRYASALFDIAVETSQINEIEEELTVLKEVFREAGLQEVLSHPKVSAAKKKELIQQSFG-AL
ATPD_THETN      ------IAKRYASALFDVAKKEDRVKEYYEELKKAVEILQEAVWKIFVNKSIDKTKKM--KFVEEVLEGF
ATPD_RHOSK      ------IAARYAAAVFELAKDEGALPALEKDMDALAAWSESADLRDLATSPVYAREEIAAVAAKMGLSTV
ATPD_RHOS4      ------IAARYAAAVFELAKDEGALPALEKDMDALAAWSESADLRDLATSPVYAREEIAAVAAKMGLSTV
ATPD_RHOS1      ------IAARYAAAVFELAKDEGALPALEKDMDALAAWSESADLRDLATSPVYAREEIAAVAAKMGLSTV
ATPD_PROVI      ----VIASRRYAYAFLSAAEAGGFLETVTGEMQMVGELAASRDLQRALASPLINADRKTHLLEEIFAEAV
ATPD_PROM2      -----SVTTPYAEALLQVVNENLQTEEMVSEVKQLLELINDSELEKALSSPILETDAKKKIIIEIFSNKV
ATPD_PROA2      ---------------------------------ISATIADSHDLVVMLKSPLIKGDTKAKALKAVFHGML
ATPD_PAUCH      -----SIATPYSEALLQVAEARGESEQTANQVKELLQIWESSPMTSQVLEPEAKKAALMKLFSE----QL
ATPD_ANOFW      ---KQVVAKRYASALFEIAKXXXXXXXXXXXXRVVKQVAQNETLLSVLNHPKIALAKKKALVQEAFAN-I
ATPO_SCHPO      ----------YASSLYTAAVKESKLDNVEKALNKLSGLQQRPEFEQYISSPWLTREDLVSSLTQMTGNEP
ATPD_RHIME      ------VAERYASSLFELALDAGSIEA------VGADLTRSDDLKRLIVSPVFSADKAISALVEKFG--F
ATPD_PROMS      -----SVTTPYAEALLQVVNENSQTEEMVSEVKQLLELVNDSELEKALSSPILETDAKKKIIIEIFSNKV
ATPD_NOSP7      --------------LLSIAQSKNLTEEFGEDARTFLGLLRDKQLHNFFSNPFIQAENKKALIKQILGEGS
ATPD_LACSS      --DKYAVGQRYAKALFSLAEQEQQFESIHDEIQALETIFNDNKLGTVLTDTTLSGLKQRNLLESLSNDFS
ATPO_PIG        ----------YATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASIMNPYVKSVKVKSLSDMTAKEKF
ATPD_SYNPX      -----SLATPYAEALLQVTEAQTVADQCKQLLEIWADFRNAMVSPVLEPDAKKMALQALV------GEQV
ATPD_PELUB      -----TSAGRYSLALYELAVEANNLNEIEVHSASIINLITSSEFKSLIKDPTNNKEDQLNALSKISEQKL
ATPD_MYXXD      ----VSIARRYARALLDVASEAGRTDAVAEQLTAFADIAKNAELTDVLVNPAYTREQRLRVVESVGG--V
ATPD_MOOTA      ------VARRYARALFNIAREQGTAGEFANGLEVSRTLAENSDFRRVLYHQLIPVREKQKLIDTIFPD-I
ATPD_DESDG      -------ARRYARALFAIGQKQAELDAFGSELSAVAKAVEESPLARLFRNPLFSEEKRXXXXXXXXXXXX
ATPD_BACLD      ------VSKRYAAALFDIALESKLVNEIEEELTVVKKIIEHKDLNAVLGHPKVPAEKKKQILKDSFG-SV
ATPO_PONAB      ----------YATALYSAASKQNKLEQVEKELLRVAQILKEPKVAAPVLNPYVKRSIKVKSLNDITAERF
ATPD_SOLUE      ---------------------------------------------------------------------I
ATPD_CLOPA      --------RRYAVALYNIASAENKVEEYIADLKQINDLIKNNELNQIISNPKISTTKKREIFTSIFEDKI
ATPD_BACCA      ------IAKRYASALFQIALEQGQLDRIEEVPAVRQALAENGEFLSLLSYPKLSLDQKKALIREAFAGAS
ATPD_ALKOO      ------VSKRYASALFELAEEQKHHKVQEELAFIRSCIEDEPSFFELLKSPLITADEKKDIISNIFRDRV
ATPO_HUMAN      ----------YATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAERF
ATPD_MAGSM      -----TIAKRYATALAELASELNILDSIRDELAHFALLAESPEMHEMMVSPTVSKEKLISTYLEYAKPN-
ATPD_ACICJ      ----------YARALYELADERKQLDEVVSEMAALGRLAEDPSLRRLIAS-RSIDAREAGRAMELASQGV
ATPD_SYNSC      -----SLATPYAEALLQVTEARGESDQCKQLLAIWNDSERDAMVSPVLE-PDAKKQALKALV----GEDV
ATPD_STACT      ------IAKKYAQALYETSLDKDMYDEFAAVDE--AVIPNQDKLKAFDSDPKNIAEDRNSL-VESAFKGI
ATPD_SYNWW      -----SVARRYAEAFFSIARETGKVDELQQELEKLVSIIETTE-----NLPEYFAHLLIPAKAKLFGGQV
ATPD_SULAA      ----------------------------------------------------------------------
ATPD_RICBR      ---KDILTQNYAVALFDNAKSDNTQDKILEEVNLVTSIIEDNEVKELLSSPIVNKVDKIGVINSLVKNII
ATPD_RICB8      ---KDILTQNYAVALFDNAKSDNTQDKILEEVNLVTSIIEDNEVKELLSSPIVNKVDKIGVINSLVKNII
ATPD_HYPNA      MIQTSETAQRYARALFELAQDKGDLATIHKDFRAFAALIKTSDLRKLLDSPAFSRDVKVSALAEIAKKAY
ATPO_RHIFE      ----------YATALYSAASKQNKLEQVEKELLRVAQLLKEPKMAASIMNPYIKRS----IKVKSLNDMT
ATPO_RAT        ----------YATALYSAASKQKRLDQVEKELLRVGQLLKDPKVSLAVLNPYIKRSIKVKSLKDITTEKF
ATPD_RHOCA      ------IAGRYATAIFDLAQEAKGIDALSADVDALAALAGSAELRDLISSPVYTREEQGDAIAAVAAKML
ATPD_MYCGA      ----------FARALVDLAHEEDKVHLFYDNLKVVFDLVKENQLMSLMNSQVLSKNQKHEIIDVVFKDHL
ATPD_GEOTN      ------IAKRYASALFXXXXXXXXXXXXXXXXRAVRQLAENGEFLSLLSNPKLSLDKKKALVREAFAG-V
ATPD_BACST      ------IAKRYASALFQIALEQQQLDRIEEVRAVRQALAENGEFXXXXXXXXXXXEKKKALVREVFAG-V
ATPD_MICAN      ------IAEPYAQALLSVAQSSGQLEAIGGEIKSLLELLENADLRAFIGNPVIKEEAKKAVLSQVMGSSA
ATPD_EMIHU      ----VKIAVPYXXXXXXXXXXXXXXKETTNDINIVSQLANSSDLKKFLGNPLITRDAKKGVLKDVLGEQI
ATPO_SORAR      ----------YATALYSAASKQNKLDQVEKELLRVAQLLKEPKLAASILNPHVKRAIKVKSIGDLTAEKL
ATPD_SORC5      -----SVARRYGRAIFEIGKETGTLAALAREIDASAMYSASEELRLVLDNPLIPEASREELLRELGGRAA
ATPD_RHOS5      ------IAARYAAAVFELAKDEGALPALEKDMDALAAWAESADLRDLATSPVYAREDXXXXXXXXXXXMG
ATPD_PELLD      ----VIASRRYAYALLSAADEGGFLDDVTAEMEMIGELAGSRDLVRVLASPLINGDRKTHILEEIFRGRV
ATPD_CAUCR      ----------YAQSLFELTIENGSLQKVEADLKSLKAMVADSDLRRLIASPAFSAEDLTAVAKKAGFQPL
ATPD_CAUCN      ----------YAQSLFELTIENGSLQKVEADLKSLKAMVADSDLRRLIASPAFSAEDLTAVAKKAGFQPL
ATPD_SALRD      ----------------------------------------------VFESPVIPQDKKDSIVRELLGDRV
ATPD_RHISN      ------VAERYASSLFELALEAGSVEAVGADLDRVQALIDGSELKRLVVSPVFSADKAISALVEKFG--F
ATPD_CLOCE      ------VEKRYAQALLELSGSDINSEEFGDFTNLYNS---DKDFRDFLNNPVVKTDKKQALIRSVFTDRL
ATPD_CAUSK      ----------YAQSLFELTIENNQLTKVEADLSLRAMVAASTDLRRLLESPAFSAEDLTAVAAKAGFQLL
ATPD_SYNR3      -----TLATPYADALLQVGESRKQSDALAEAKALLSAWSSSQDLQDAMRSPVLSVEGKKKALDSLFSESI
ATPD_SULSY      -------------------KSEENLLKISSILDILNKLFKENQFRNIVLNPKASMEDKEKLMEKVGVDA-
ATPD_PROM1      -----TITTPYAEAFLQVAESRNEVDEVVTQAKSILELWNSCEFSDAMSSPVLEVNQKKAALEKLFSSQV
ATPD_PROM0      -----SVTTPYAEALLQVVNENSQTEEMVSEVKQLLELINNSELEKALSSPILETDAKKKIINEIFSKKV
ATPD_DESVV      ------VARRYARALFALGKKSSDLETFGNDLAALAGLETAPELVRMFRNPVFTPDEKRNVIAKLLDKLV
ATPD_DESVH      ------VARRYARALFALGKKSSDLETFGNDLAALAGLETAPELVRMFRNPVFTPDEKRNVIAKLLDKLV
ATPD_CORA7      ----------------KLGQVEDELFSLSRVLD------REGELTQLLSDRTATSDRKVGLLASVLYGKV
ATPD_CHLTE      -------SRRYAVALLEVAVEGNFLEKVTEDLQKIQEVLSGSELVLALKSPLINVDLKSKILEEIFRNKV
ATPD_ANASP      ------VAQPYAQALLSIAKSKSLTEEFGTAXXXXXXXXXXXXXXNFIDNPFIAAENKKALIKQILSEA-
ATPD_SYNJA      ------VVDPYAEALVSLASAQGLLDTFEADIRFIAAVVQATELGQFLASPLVKAEAKKNLLQQVFADQI
ATPD_PROMT      -----TVTTPYAEAFLQVAESRNEVDEVVTQAKSILELWNSCEFSDAMSSPVLEVNQKKAALEKLFSSQV
ATPD_PROM4      -----TITTPYAEAFLQVAESKKEVEKIAQAKSILQLWDESSELREAMGSPVLEVESKKAALEKIFSGKV
ATPD_OENOB      ----------YAEALMEVSQTAKVLSELQVIELVFE---RNKELAQTLDDVSVSSQQQEA-FIGILGKGC
ATPO_KLULA      ----------YATALFTAASKTTSVEAAASSLNALKEVAKDTKLTSILENPALSAEDR-----NIVVDTL
ATPD_CYAPA      ------ITQPYAEALLEMAQ---KYDIVETVNNILNCLQNSTKLQQFLANPLVKKSSKKNFFEKTLAKEI
ATPD_BACPF      ------VANRYAYALFQLAEEKSILSQVVQEMELVKEVVNTTEFLQLLSHPKVTTEKKRAFIENSFKDXX
ATPD_ACIBL      ----------YANALADVVLSNRDVTTAVRDLNNIVSMTIESELRKVWENPSIAVAQLDGLVGMVGTPRI
ATPO_MOUSE      ----------YATALYSAASKEKKLDQVEKELLRVGQLLKDPKVSLAVLNPYIKRTVKVKSLNDITKEKF
ATPD_STAAB      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQINGVFIDIN----
ATPD_DESVM      ---------------------------------------------------------------------V
ATPD_CHLRE      MARKNEVSESYAKALVELADEKGKLEAVHADVDAVAGLMKENKLSALIMNPVVESDKKRAVLAKIAKEAF
ATPD_BART1      ----------YAQALFNCVQEAGNVEKIERAVEDFLFLEQNEDLKHFVLSPFFSVKEQIKVMIKFADKEA
ATPD_SYNJB      MAEKVV--DPYAEALIALGSGQGLLDTFAADMRFIAEVLRATELGQFLANPVIKAEAKKNLLQQVFADQI
ATPD_CORGL      ----------------QLGQVEDELFRLSRILD------RESKLTQLLSDRTQEIGGRRDLLAKVLYGKV
ATPD_CORGB      ----------------QLGQVEDELFRLSRILD------RESKLTQLLSDRTQEIGGRRDLLAKVLYGKV
ATPD_BACP2      ------VSKRYASALFDIVLASSAVDETEKELNEIKKVLKDQELNDFLVHPKITADKKKHLIAE-AFKGV
ATPO_BOVIN      ----------YATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKSVKVKSLSDMTAKEKF
ATPD_STAAW      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAAT      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLRMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAAS      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAAN      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAAM      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAAE      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLRMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAAC      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLRMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAA9      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAA8      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLRMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAA3      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLRMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAA2      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQRRELINGVFTD-I
ATPD_STAA1      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQRRELINGVFTD-I
ATPD_PEDPA      --DKTTIAKRYSKALFEIVSEKGQRDETRAELNQIQQVFNDNEGKILTDKGLEQNQKLEILNI------L
ATPD_CORU7      ----------------------------------------------------------------------
ATPD_LACRJ      --DKKTVADRYAKALFELVDADNELDQTYQELIALRQVFEDNEVQLSLDEKKSLIKDL--------QQGA
ATPD_LACRD      --DKKTVADRYAKALFELVDADNELDQTYQELIALRQVFEDNEVQLSLDEKKSLIKDL--------QQGA
ATPD_GEOBB      ------IAKRYAKALVQLGSEAGSVDSFNAELTRFSALLTDSDLSAVFANPAYGIESKREVMKELVAKLL
ATPD_EHRCJ      ------IASCYAQALFSVSDVNSICKDVEFVISV---LENDNNVAMFLSSPRVSKESKISL-IKVIGDYI
ATPD_CHLT3      ------VGRRYALALMEVAVDQNIVGQVMADFELIEQMVEAKQLRLAIQSPLIQAYKKAALLKEVFGGKV
ATPD_THEAB      ------IASKYVKALLIVGQKLNKIEKYGEFLNIYESFATFFNNPIV--KPEQKTLVIKQAFEEVFKESP
ATPD_PROM9      -----SVTTPYAEALLQVVNENLQTEEMVSEVKQLLELLNDSELEKALSSPXXXXXXXXXXXXXXFSNKV
ATPD_PELPD      -----TIAKRYALSLVQLGAECGLVDRFRGELADVEDLGTTPEIPAAFADPALSHERKKNIMREVGSCAC
ATPD_BACSU      ------VSKRYASALFDIANESAQLNQVEEELIVVKQVFQNEKLNDVLNHPKVPAAKKKELIQNAFG-SL
ATPO_CALMO      ----------------------------------------------------------------------
ATPD_PARD8      -----TISSRYAKALFSLA---KDKEQESRVMKMLADFSMEPELRGALSNPIVSVPEKVKLLTAAGGIEV
ATPO_CALJA      ----------------------------------------------------------------------
ATPD_STAAR      ----VKVANKYAKALFDVSLDTNNLETINEELTVINEAVKDKQLKMVDSNPTQTAEQRRELINGVFTD-I
ATPD_PARDP      ------IAGRYAQALFDLVRDSGGIDALSSQIDDLASALRDLTLSPLYD--RQQQEAAVGALSERMG--L
ATPD_GEOSM      ------IAKRYAKALVQLGSEAGTVDSFNTELDRFSALLTESDLSAVFANPAYGIESKREVMKELVAKLL
ATPD_BDEBA      ------ISKRYAKALLAVAKQKGIHTQVHAELQALVSFAGDVSVKNYFENPMIGSDQKIAAVASLSGKGV
ATPD_ANATD      -------AKRYAEALIKLGQEEGKLEIYEQLFKMFEIIKNNNEFNIWFDLEMKRSEKKQRIKVFFGGD-I
ATPD_CLOTH      -------------------------------------------------DPQIQKESRKEAIIKVFEGRI
ATPD_OCHNE      ------IADAYXXXXXXXXNSNKSLKETTNDMNIVSQLANSSDLKKFLGNPLITRERKKNVLKDVLGEQI
ATPD_CYAME      ---KQKIVEPYAQALFRLKDDIDLTPLW--------EMARDSKFMQLLMNPSIPKEKKWQLFQPF--DKL
ATPD_SYNS3      -----SLATPYADALLQVTDVRQESEEVANQCKDLLSAWESSELRDAMTSPVLEPEAKKKALTSLLSEQV
ATPD_PROM5      -----SVTTPYAEALLQVVNENDQTEEMVNEVKQLLTLINDAELEKTLSSPVLXXXXXXXXXXXXFSDRI
ATPD_MESSB      ------VAGRYARSLFELAQETGAVSVVEGDLVRFEEMLEGSELKRLIKSPVFSAEQLKALGAVLDRARI
ATPD_EHRCR      ------IASCYAQALFSVSSNVNSICKNAEF--VVSVLENCNDISLFLSNPRVSREDKVKL-VEVIGDYI
ATPD_CYAP4      ------ILEPYAEALMSLAQSNNLTGRFGEDVAFILDLLKTSELQQVLANPFVKPESKKAILRQLVAPQV
ATPD_CLOK5      --------RRYALALYKIAXXXXXXXXXXXXXXDVTDIINDTQFLEFIEHPEISTAEKKKTFINVFKGKI
ATPD_CLOK1      --------RRYALALYKIAXXXXXXXXXXXXXXDVTDIINDTQFLEFIEHPEISTAEKKKTFINVFKGKI
ATPO_DROME      ----------YATALYSAASKLSQLDQVEKDLTALATIRSDKKLREYVTSPIINKKVMATALKEASEKLF
ATPD_SYNP2      ------VVEPYAGALMTLAQETNKVEAFAENCRALLSLFQESEFRSFVMNPLVKAEDKKGVLQGVCGQDV
ATPD_METSB      ------MAGRYAQALFALAQERGATEGVATDLATFAAMLDESELRNFVRSPVFSAEQLDALLDRAGLSGT
ATPD_PROMA      -----TITTPYAEAFLQVAENRNEVDEVVAQSKSLLELGQSSEFSEAMASPVLEVETKKAVLEKIFSKEI
ATPD_FLAPJ      ----------YAKAIIEIATSKNAANEVSNDMFLIATINSNSELDTFIQNPTIKVEAKENALLEVFANT-
ATPD_EXISA      -----SLAKRYAKALFDLAREQGTLDQVEAEVRLLDEVLHATELMDLLTNPAVSDSELAQLLKDSFGD-M
ATPD_BARQU      ----------YAQALFDFVQEARSVENVEKAVASFVVLDQHEDLKRFVQSPFFSIKEQIKVMIKFADQGA
ATPD_ANAMM      ---------------------------------VRAALTADGEVRAFFANPVTPKENKIAVLQALGKSCL
ATPD_ANAMF      ---------------------------------VRAALTADGEVRAFFANPVTPKENKIAVLQALGKSCL
ATPD_ENTHR      --DKYTVGRRYGKALFELASAEEIYQELLSLRQIYSEIPGLSDVRLEPHEKRIIMDKLVSGFDGI-----
ATPD_STRSV      -------ALPFVQTVFEKGQQEDVFEKLSQIKAVFAETGADFLSHIGISD--HEKEKSLRLFQNSGSQLL
ATPD_RHDSA      -SKNVKVAKPYADAFIEIA----NKGSVINDLNCIATLSESKDLQKAIANPLVSSAAKKDIIKSIFAGNV
ATPD_PROMP      -----SVTTPYAEALLQVVSENDQTEEMVKEVKQLLSLINDSDLEKTLSSPVLETDTXXXXXXXXXXXXX
ATPD_KOCRD      -------------------------------------LDRSADVQRAFSDSRASAEAKVTLARRLA-HTE
ATPD_GRAFK      -------AQRYAKAILSLAKDKNSAEAVNEMISISKTVVNSRDLENMLTSPVIKDSTKKSALLEIFKDTI
ATPD_BACP3      ------IAKRYASALFQIALEQGQLDRIEEVRAVRQALAENGEFLSLLSYPKLSLDQKKALIREAFAG-V
ATPD_ORITB      ----------------------------------------------------------------------
ATPD_LACC3      ------VAPRYAKALLEAAQDQNQVETVHEELQALQSVFNDNPTILTIDNARITAADKDALMTTLTKDA-
ATPD_STAES      ------VAKKYAKALFDVALDTNQLDVVYEDLETISHSSFDKQLKAIDSNPSLTANQREE-FVERVYNEA
ATPD_STAEQ      ------VAKKYAKALFDVALDTNQLDVVYEDLETISHSSFDKQLKAIDSNPSLTANQREE-FVERVYNEA
ATPD_ROSCS      -----------------------------------------SEAQVLFDSLTGAALQALHTATSINGEVT
ATPD_COREF      ----------------------------------------------------------------------
ATPD_LACCB      ------VAPRYAKALLEAAKDQNQVETVHEELQALQSVFNDNPTILTIDNARITAADKDALMTTLTKDA-
ATPD_ENTFA      --DKYTVGKRYGKALFELAQAEAIYQELLTLREVYHQVPGIGD--ILSDDEPYEKDSIMEKLVT----GF
ATPD_STRTD      -------ARSLVEVAFEQDAVSTIQEEVRQILTVFAE----TNLKTFLSQVNVTSEESLSFFQE----SC
ATPD_STRT2      -------ARSLVEVAFEQDAVSTIQEEVRQILTVFAE----TNLKTFLSQVNVTSEESLSFFQE----SC
ATPD_STRT1      -------ARSLVEVAFEQDAVSTIQEEVRQILTVFAE----TNLKTFLSQVNVTSEESLSFFQE----SC
ATPD_NOCFA      ----------------------------------------------------------------------
ATPD_LACLM      -------SQKYSKALLEVAQEKGQLEAILTEVSEMIQLFKENNLGAFLANEVYSKSELIDTLLQ----TS
ATPD_GRABC      ------LAKRYASALYSYAGDSGDLDGVIARIEALGRLIDESDLRSLLGSPLVVNRARDAVLAVLDRQGF
ATPD_GLUDA      ----------YATALYELAA-----DRW--LLNEVLPQAENADFRALLSDRTLDIKDITALLAVLDAQGF
ATPD_THEYD      -------AKKYAKQFLSLVNIDQVPEIVSKLETVVMLMQKEKQFRNMLTSPSFKDEERVGLCEKLG---L
ATPD_CYTH3      ------VAYRYAKSLIDLAAENGVLDRVNAMAGIESVFKQNHQLVAVMKNPIVQGDKKHAILEALFGGKV
ATPO_ASHGO      ----------YASALFTAASKTTSIESAGKALSLSKTIAKDAKLGAILANPALPAGDRTVVVQTLAQKTM
ATPD_RHOSR      ----------------------------------------------------------------------
ATPD_PHATR      ----LKIASPYARALFDFS-VEKNHQITADFQNLEIFLKENTELTEYLDNPVVSKNAKCEILAKTLQAQL
ATPD_LACLS      -------SQKYSKALLEVAQEKGQLEAILTEVSEMIQLFKENNLGAFLANEVYSKSELIDTLLQ----TS
ATPD_FERNB      ------IASKYALALYNISKTNGKTETYKELLNILGDIYNLAS--VYLNNQAIKPENRVQFVLNIMKELY
ATPD_CORJK      ----------------------------------------------------------------------
ATPD_THESQ      ------VAGRYARALLNVAIEKEKEEEYLRFLDLVCQIYESSRE--LFDNPILKPEKKISLIKEIMGQEM
ATPD_THEP1      ------VAGRYARALLNVAIEKEKEEEYLRFLDLVCQIYESSRE--LFDNPILKPEKKISLIKEIMGQEM
ATPD_THEMA      ------VAGRYARALLNVAIEKEKEEEYLRFLDLVCQIYESSRE--LFDNPILKPEKKISLIKEIMGQEM
ATPD_ROSS1      ----------------------------------------------------------------------
ATPD_RHOCS      ---------------------------------------------------------------------V
ATPD_ORITI      ----------------------------------------------------------------------
ATPD_NATTJ      ------IPKRYAEALFQLAKEREKINEITQSFNQLIERLRSNEEVFLLSYPVVDIAEKKQVADELTAD-L
ATPD_ACIC5      -----------------LEQVQQQLDDFMATWNGAADLRE------VFLDPSFPAEEKVAILDRMNQKLL
ATPD_LEPIC      ------VSKTYASALLGATNVPEEVEQ--ELGDLAQLLFKDEKVKNFFLSPTVSNEEKEKVLIKNLRGKI
ATPD_CLOBM      --------RRYALALYEVAEENNKVDEYLRDLKEVVNIIKNSEICKILKHPEISTSRKKEIFTEIFKDKV
ATPD_WOLTR      ---------------------------------------------------------------------L
ATPD_THAPS      ------IASPYARALYDFSVEQNIMHQVTQNLDVF--LAEVPTLMEYLGNPIVTATQKEALLTKTLKSQL
ATPD_STRZT      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRZP      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRZJ      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRR6      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRPS      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRPN      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRPJ      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRPI      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRP7      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRP4      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_STRP2      ---------PFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLQVAVDES--DKEKTIAFFQ----DSV
ATPD_LACAC      ------VAARYGTALFGYAQDNKVLDTYDEMMALKKAAIANPKFISVLSDPILSSKDKKSILTAVEKD-F
ATPO_IPOBA      ----------------------------------------------------------------------
ATPD_LACH4      ------VAARYGAALFGYAQDNKVLDNYDEMMELKKAVIATPQVISVLSDPILNSKDKKDFLTAIEKN-F
ATPD_CLOBL      --------RRYALALYEVAEENNKVDEYLRDLKEVVNIIKNSEICKILKHPEINTSRKKEIFTELFKDKV
ATPD_SYNPW      -----TLATPYAEALLQVTDGRSESDDVAQCKELLAVWDSSTALRDAMTSPVLEPXXXXXXXXXXXXEQI
ATPD_STAHJ      ------VANKYAKALFDVARLDLMYDELSEVSEATKNYGED--LRAIDSNPNQPASERRKFVGIVFGDA-
ATPD_RICCK      ----------------------------------------------------------------------
ATPD_RHOOB      ----------------------------------------------------------------------
ATPD_FLAJ1      ----------YAKAILDLANSKGVAEAVNNDMKSIASIETNTELSTFIQNPTTTVEVKESALLEVFAD-V
ATPD_CLAMS      ----------------------------------------------------------------------
ATPD_CLAM3      ----------------------------------------------------------------------
ATPO_ARATH      ----------------------------------------------------------------------
ATPD_CORK4      ----------------------------------------------------------------------
ATPD_CLOBH      --------RRYALALYEVAEENNKVDEYLRDLKEVVNIIKNSEICKILKHPEINTSRKKEIFTELFKDKV
ATPD_CLOB1      --------RRYALALYEVAEENNKVDEYLRDLKEVVNIIKNSEICKILKHPEINTSRKKEIFTELFKDKV
ATPD_STRU0      --KELALIEQYAKSLVEVAIEKDFLNALKEDVYAILETMKASNLDKILSSLAYAPDDKANL-VRLLKDSS
ATPD_CLOBK      --------RRYALALYEVAEENNKVDEYLRDLKEVVNIIKNSEICKILKHPEINTSRKKEIFTELFKDKV
ATPD_CLOBJ      --------RRYALALYEVAEENNKVDEYLRDLKEVVNIIKNSEICKILKHPEINTSRKKEIFTELFKDKV
ATPD_PROMM      -----TITTPYAEAFLQVAESRKEVDQVVDQAKAVLALWNDCELSGAMASPVLEVEAKKAALQKLFANQV
ATPD_PROM3      -----TITTPYAEAFLQVAESRKEVDQVVDQAKAVLALWNDCELSGAMASPVLEVEAKKAALQKLFANQV
ATPD_LEPBP      ------ISKVYATALLELAQEANXXXXXXXXVGVFFDTIRHYFLSPLVDPSE--KEQTAAKSVQ---GKA
ATPD_LEPBA      ------ISKVYATALLELAQEANXXXXXXXXVGVFFDTIRHYFLSPLVDPSE--KEQTAAKSVQ---GKA
ATPD_ANAPZ      ----------------------------------------------------------------------
ATPD_RICPU      ---------------------------------------------------------------------I
ATPD_FUSNN      ---KSQVGRRYSKAIFEIAEEKKQVKEIYEMLNSAMVLYRDKEFKHFILNPLIDNEQKKSVLNEIFGKDN
ATPD_DESDA      ------VARRYANAIFALGKKDGDDALSSRXXXXXXDMTLKSPV-IGVEEKKAVLDKLLGKL------KA
ATPD_CLOB6      --------RRYALALYEVAEENNKVDEYLKDLKEVVNIIKNSEICKILKHPEINTSRKKEIFTELFKDKV
ATPD_TOBAC      ----------------DIAKSNGTLEQTTADLEKIEKISDDEAVFNFFVSPIVGEEKKRELVDEISSSSI
ATPD_BIFLO      -------------------------------------------------DYQATSEARVKLFREVSGKTL
ATPD_BIFLD      -------------------------------------------------DYQATSEARVKLFREVSGKTL
ATPD_RHORU      ------VAERYATALYELAEDRGALDQVSADLSLKAMLDESGDLRRVIASPRDDQRKALTALAEKAG--F
ATPD_RHORT      ------VAERYATALYELAEDRGALDQVSADLSLKAMLDESGDLRRVIASPRDDQRKALTALAEKAG--F
ATPD_PROMO      ------VGRRYAEAIYEIAESNDNVKELYETLNGVMELYNDKEFKTLVDHPLIKREDKKEFAKKIFGE-L
ATPD_CAMLR      --EKV-IAKTYAKAILERNDFENFYSNLLELSSAFAS----NKFIDILNSYEIKQDKKLELILSLL-DNP
ATPD_ARTCA      ---------------------------------------------------------------------V
ATPD_ACAM1      -----TIVEPYAEALMSVAQSNNLTNQIGEDVSFVLSLLQTSDLKDFLVNPLTPADAQKAVLRQLAESRV
ATPD_STRGG      ----------------------------------------------------------------LGGKAQ
ATPD_STREM      ----------YAKSLVQVCQERDTLEALQADVLAILEVFKATNLAKTLSSLAVPRAKKLELVRQLQGDNI
ATPD_RICRS      ---------------------------------------------------------------------I
ATPD_RICRO      ---------------------------------------------------------------------I
ATPD_PARUW      ----------YSKALVDIATNPEQIKSHLLALEEFVGILETPKLKELLFDPHLSTLTKKSILQRLFKDRL
ATPD_LACLA      -------SQKYSKALLEVAQEKGQLEAILSEVSEMIQLFKEDNLVAFLSSEVYSKSELIDTLLQ----TS
ATPD_BIFLI      -------------------------------------------------DYQATSEARVKLFREVSGKTL
ATPD_TROWT      --------------------------------------------------PAYSKKQLIGVFA--GAHEG
ATPD_TROW8      --------------------------------------------------PAYSKKQLIGVFA--GAHEG
ATPD_RICAE      ---------------------------------------------------------------------I
ATPD_CHLAD      ----------------------------------------------------------------------
ATPD_SPIOL      ----------------------------------------------------------------------
ATPD_LEPBL      ------VSKIYASALLGAVNSPEEVEQ--ELGDLVQLLFKEEKIRNFFLSPTVSIEEKENILEKNLRGKI
ATPD_LEPBJ      ------VSKIYASALLGAVNSPEEVEQ--ELGDLVQLLFKEEKIRNFFLSPTVSIEEKENILEKNLRGKI
ATPD_AZOPC      ------ISTRYARAIYEYALEQGNETILYKGMQSLAKFAMYPVLKKSINDPTLSDENKIKLLIAACRIDS
ATPD_THEFY      ----------------------------------------------------------------------
ATPD_STRA1      ----------YSKSLVEVAIEHKIVEKIQQEVAALIDIFETSELEGVLSSLAVSHDEKQH-FVKTLQTSC
ATPD_STAS1      ------IAKKYAKALFDTAKLDDMYDEFSTINE--AVQSENKKLQALDADPQKDVEQR-RRFVSIVFGQT
ATPD_RICAH      ----------------------------------------------------------------------
ATPD_EHRRW      ----------YAQALFNASVSKLN-DICKGIKFIF-NLSENGNNQFLLANPTANLKDKISV-IELITNHI
ATPD_EHRRG      ----------YAQALFNASVSKLN-DICKGIKFIF-NLSENGNNQFLLANPTANLKDKISV-IELITNHI
ATPD_CLOBB      --------RRYALALYQVAEKKGKVDEYLQDLREICELIENNEFYEVIKHPQXXXXXXXXXXXXXXXXXX
ATPD_CLOBA      --------RRYALALYQVAEKKGKVDEYLQDLREICELIENNEFYEVIKHPQXXXXXXXXXXXXXXXXXX
ATPD_STRA5      ----------YSKSLVEVAIEHKIVEKIQQEVAALIDIFETSELEGVLSSLAVSHDEKQH-FVKTLQTSC
ATPD_STRA3      ----------YSKSLVEVAIEHKIVEKIQQEVAALIDIFETSELEGVLSSLAVSHDEKQH-FVKTLQTSC
ATPD_RICPR      ---KDNLIQNYAVALFNNALLDNIQVKICEEITLLNSIIEDSEIKKFLFSPLVNKIDKINVFNSLVKTTF
ATPD_KINRD      ----------------------------------------------------------------------
ATPD_CLOAB      --------RRYALALYEVGEKNQKLEEY---INDFGELKNDENINQVVNHPQISTSEKKKIFMEIFKGKI
ATPO_YEAST      ----------YATALYQAAAKNSSIDAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVI-----DAI
ATPD_STRS7      ----------YAKSLVQVCQERDTLEALQADVLAILEVFKATNLAKTLSSLAVPRAKRLELVRQLQGDNI
ATPD_STRE4      ----------YAKSLVQVCQERDTLEALQADVLAILEVFKATNLAKTLSSLAVPRAKRLELVRQLQGDNI
ATPD_RICM5      ---------------------------------------------------------------------I
ATPD_PROAC      -------------------------------------------LQVALGDPNRSVADRQELLMKLVGGQV
ATPD_DESMR      ----------------------------------------------------------------------
ATPD_PERMH      ----------------------------------------------------------------------
ATPD_ODOSI      ------IAAPYARALFDFSVDQNLMHQITADFNLEVFLNKTPDLTEYLSNPLISAKSKEEVLNKTLKSQI
ATPD_BARHE      ----------YAQALFDLAQEEGLVEILEKAVESFLMLDQDEDLKHFVQSPFFSVKEQVKVMIPFADEGA
ATPD_ACHLI      ----------YSDALFKLALKEDAIESIIEQFETFVSLARDPDWIVLLDSPMIRNRVKNKMLTELG--IF
ATPD1_BRAHW     -SDKLQILKPTASAIFDIARELGMIKEIYNELSECSKLFQDIDXXXXXXXXXXXXXXXXXXXXXXXXPIL
ATPD_WOLPP      -------------------------------------------------------------------ENL
ATPD_THENN      ------VAGRYARAFLNIAIENEKEDEYLRFLDFVCNVYESNKD--LFDNPVVKPEKKVTLIKSVXXXXX
ATPD_SALAI      ----------------------------------------------------------------------
ATPO_CANGA      ----------------------------------------------------------------------
ATPFD_MYCVP     --------------------------RFGRVLDAQSQLSR------LLADPVIPADKRVALLKKVSGGGV
ATPD_HALOH      ------VSRKYSSALLEVALESDNLSRFKEELEISKALKQYDDLKKILYHPRVLPDDKKEVIHQVFSDKV
ATPD_LAWIP      ------IAQRYAQALFDLGKEQSLHEVYDTALSQIEELLMTSELTYFLHAPIFTIYEKQGVLLKLLEIDA
ATPFD_MYCUA     ----------------------------------------------------------------------
ATPFD_MYCMM     ----------------------------------------------------------------------
ATPD_LACS1      -----TIVHRYGKALFELAEEMKIRNKFHSELQEYKKLQNEPQLKVFMSSNQISPEAKLKI-MEILKKDS
ATPD_EXIS2      ------VAGRYAKALFDLALEHHVLDQAEADVRTLGEVLHATELASVLENPSISAEELKQVLQTTGFNTI
ATPD_CHLSY      ------------------------------------------------------AEQIRAAAPRIAGLSA
ATPD_CHLAA      ------------------------------------------------------AEQIRAAAPRIAGLSA
ATPD_CALS8      -------AKRYAEGLLKLAQEEKFYEDLFKIYDLFVDVLFDLEMKVS------NKKEKIKQFLD---ESI
ATPD_ARTS2      ------------------------------------------EVQRALSEPQASPAAKIALAEKLVPNA-
ATPD_RICTY      ----------------------------------------------------------------------
ATPD_PETMO      ------LASKYAQALLGTLEEKGEISRLDEYVEAFQRLKKALELRDMVYSPLIPPKHIVSRMKDVSDDTI
ATPD_HYDS0      ----------------------------------------------------FVSNEQKKLFIKIQKGNI
ATPD_VAULI      ----------------------------------------------------------------------
ATPD_GALSU      MHNNYKIAKVYAEGLFEIANTKNSLAEINEQLNSIKSVLKQMEFYYFLVNPLISQQIKKNTIKIVFNNNL
ATPD_BIFA0      ----------------------------------------------------------------------
ATPFD_MYCS2     ----------------------------------------------------------------------
ATPFD_MYCPA     -------------ALLEVAERENKVDEFSRILDVQPRLA------ILLGDYAVPVEGRVGL---------
ATPD_WOLWR      ---------------------------------------------------------------------L
ATPD_WOLPM      ---------------------------------------------------------------------L
ATPD_SULNB      ------IAKRYATA---LSSVSKDVKSIASVLNVLSEAISVPEVHEALTSPIVSAEKKTDMILSAIGKEA
ATPD_STRMU      ----------YAKSLVEVALERDSYDEVRAILSVLDDQQVQDFLASKAIDLSAKSE-VVRLFQE----SC
ATPD_MARMM      ----------YATALFELAKSEGXXXXXXXXXXXXXXMLTESELADALASPLHAVEVKAGILSALAKKAF
ATPD_NITSB      ------IAKRYAKALMESC-SEKELQAIEDALVAIAALFRDWKVKEFIISPEVEKEILLAPFKDAGKKFV
ATPD_MYCS5      ----------YSVAIYEIAKESNKHEQFSFVKKV---IEKNPQLITFLKNDEIALEKRFELIDEIFGSLE
ATPD_GUITH      ------LAQPYAMAFLEFSDAKQTLDTTIADLTQIKTILHDSDLSKTLSNPLLSIKAKKEVIKAIFEPNI
ATPD_STRAW      ----------------------------------------------------------------------
ATPD_CYACA      ------IIYPYSEALFSIAKDQEKFEVIKNDMELFVTFTKNNGFKKFLETPLXXXXXXXXXXXDVFSKIL
ATPD_BIFAA      ----------------------------------------------------------------------
ATPFD_MYCA1     -------------ALLEVAERENKVDEFSRILDVQPRLA------ILLGDYAVPVEGRVGL---------
ATPD_STRLI      ----------------------------------------------------------------------
ATPD_STRCO      ----------------------------------------------------------------------
ATPD_SALTO      ----------------------------------------------------------------------
ATPD_AQUAE      ---------------------------------------------------------------------V
ATPFD_MYCLE     -------------ALLEVAEREDQIDEFSRILDVAPRLA------ILLDDYAVPADSRVRLLCNVASSVV
ATPFD_MYCLB     -------------ALLEVAEREDQIDEFSRILDVAPRLA------ILLDDYAVPADSRVRLLCNVASSVV
ATPD_ARCB4      ---KDLVAKRYVKALID-GRNSESINTISNKLNQVASAFADERFNSIISSPEISDKSKVDLIISFV-DGT
ATPFD_MYCSS     ----------------------------------------------------------------------
ATPFD_MYCSK     ----------------------------------------------------------------------
ATPFD_MYCSJ     ----------------------------------------------------------------------
ATPFD_MYCA9     ----------------------------------------------------------------------
ATPD_MYCAP      ----------YALALYDLHKEEKHVSSYENILSFYELLSNDKEVFSFFNSSKIGLEEKHKIADELVQENK
ATPD_CAMJR      ------IARRYAKAIASRADINDFYQNLCILNSAFVL----PKFKNIIESNEIKKERKME-FLDSFFDIK
ATPD_CAMJJ      ------IARRYAKAIASRADINDFYQNLCILNSAFVL----PKFKNIIESNEIKKERKME-FLDSFFDIK
ATPD_CAMJE      ------IARRYAKAIASRADINDFYQNLCILNSAFVL----PKFKNIIESNEIKKERKME-FLDSFFDIK
ATPD_CAMJ8      ------IARRYAKAIASRADINDFYQNLCILNSAFVL----PKFKNIIESNEIKKERKME-FLDSFFDIK
ATPFD_MYCTU     ----------------------------------------------------------------------
ATPFD_MYCTA     ----------------------------------------------------------------------
ATPFD_MYCBT     ----------------------------------------------------------------------
ATPFD_MYCBP     ----------------------------------------------------------------------
ATPFD_MYCBO     ----------------------------------------------------------------------
ATPD_WOLSU      ----------------------------------------------------------------------
ATPD_FRASN      ----------------------------------------------------------------------
ATPD_STRSY      -------ALSFVEKVSDHADIWDMYDQISDLISII----HDSKLNRILLSATVSREEKAD-FVRTVRQSS
ATPD_STRS2      -------ALSFVEKVSDHADIWDMYDQISDLISII----HDSKLNRILLSATVSREEKAD-FVRTVRQSS
ATPD_MYCMO      ----------YALALFEIANEELKLEQYFQEVKKLNEIINENELVXXXXXXXXXXXXXXXXXXNIFTNHF
ATPD_SACEN      ------------------------------------------DLERLLSDPTTSAEGKATVVDQLISGKV
ATPD_CAMJD      ------IARRYAKAIASRADINDFYQNLAFVLPKFKNIIESNEIK------KERKMEFLDSFFHIKNS--
ATPD_NOCSJ      ----------------------------------------------------------------------
ATPD_ILYTA      ------VGKRYAEAIYGIAEANNKVKELYDSLNIVMELYKDKEFKNLVDHPLVKKEEKKEFINKVFSE-F
ATPD_BEUC1      ------------------------------------------ELRIALSNRELPVENRVALVDALLEGKV
ATPD_BACV8      ------ISMRYAKALLAYADEKGTEDTVYEEAGILADFSRIPELRQALDNPVLPAETKLKLICEAGGGKV
ATPD_MYCPE      ----------YANALYSLELDKKNKIIFSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFD-L
ATPD_STRGC      -------AAPFVQIVLEKNQQRDVFRELSQIKGIFEETYL-ADFLSHIGVSQAEKSKVLRLFQTCDSVLV
ATPD_STREI      ----------------------------------------------------------------------
ATPD_CAMC5      ----------------------------------------------------------------------
ATPD_CAMC1      ------VAKKYVKAILSDVKSNELNAFVENLSELAAAFASD-KFKSIISLPTLKASQKVEFVLSLVKNQD
ATPD_SORBI      ----------------------------------------------------------------------
ATPD_RICFE      ----------------------------------------------------------------------
ATPD_LACDB      -------ARRYGTAIFDFAKSGKTELMYSELTELKKAVQAEPRFVQVLSNPVLDAKQKKSLLVEQGFSAE
ATPD_LACDA      -------ARRYGTAIFDFAKSGKTELMYSELTELKKAVQAEPRFVQVLSNPVLDAKQKKSLLVEQGFSAE
ATPD_NEOSM      ----------------------------------------------------------------------
ATPD_STRP1      ----------YAKSLVEVASEHHSLDALQAVLAILETFVTTNLDQSLSSQAVPHAEKIKLLTLLKGNNSV
ATPD_RICCN      ---------------------------------------------------------------------I
PGK_PSEF5       ----------------------------------------------------------------------
ATPD_STRPZ      ----------------------------------------------------------------------
ATPD_STRPM      ----------------------------------------------------------------------
ATPD_STRPG      ----------------------------------------------------------------------
ATPD_STRPD      ----------------------------------------------------------------------
ATPD_STRPC      ----------------------------------------------------------------------
ATPD_STRPB      ----------------------------------------------------------------------
ATPD_STRP8      ----------------------------------------------------------------------
ATPD_STRP6      ----------------------------------------------------------------------
ATPD_STRP3      ----------------------------------------------------------------------
ATPD_MYCMS      MILKETTINNYATALFNIAVKEKLVDDYIQVDALIKSLADKDEFNKLVTYSNKEQKKQAILIIEFGFDIY
ATPD_SULDN      ------IAKRYLKAIKQGSNAE-SMREIALIFSILSEAFNDKKFIQIINNPDVSRDQKSEILLAAVKSAG
ATPD_STRPF      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIISAKPLAEEQLNEIASALKRRLGREVTF
ATPD_NITOC      TESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIISAKPLAEEQLNEIASALKRRLGREVTF
ATPD_ALHEH      GQEGKNLVQLLADNGRLGLLPEIAALYEHLRAEAEGVVDVQVTSASKLTKEQQDQIAGALKKRLGRKVRL
ATPD_HALHL      GQTGENFVRLLASNRRLQYAPEVARVYEELRAEAEGIVDVEVLSATQLEDAQQERLAEALRKRLGREVRL
ATPD_THISH      DDQGKNFVRLLAENGRLTLLPEIAAIYEVMRAEAEGKVEALVVSAQPVSDAQKSAIAQSLAKRLGREVEL
ATPD_PSEAE      NAPAQNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLSKEQQDKLAKALSARLSREVRL
ATPD_PSEAB      NAPAQNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLSKEQQDKLAKALSARLSREVRL
ATPD_PSEA8      NAPAQNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLSKEQQDKLAKALSARLSREVRL
ATPD_PSEA7      NAPAQNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLSKEQQDKLAKALSARLSREVRL
ATPD_PSEPW      NAQAQNFIRVAAENDRLLLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRL
ATPD_PSEPK      NAQAQNFIHVAAENDRLLLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRL
ATPD_PSEPG      NAQAQNFIHVAAENDRLLLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRL
ATPD_PSEP1      NAQAQNFIHVAAENDRLLLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRL
ATPD_PSEPF      DAKAQNFINVVAENDRLPLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLNREVRL
ATPD_PSEF5      DAQAQNFIHVAAENDRLLLLPEISALFDLYKAEQEKSVDVDVTSAFALNQEQQDKLAKVLSARLGREVRL
ATPD_PSEU2      DAKAQNFIHVVAENDRLPLLPEIAELFDLYKAEQEKSVDVDVTSAFALNQEQQDKLAKVLSARLGREVRL
ATPD_PSESM      DAKAQNFIHVVAENDRLPLLPEIAELFDLYKAEQEKSVDVDVTSAFALNQEQQDKLAKVLSARLGREVRL
ATPD_PSEFS      DVKVQNFIHVVAENDRLPLLPEIAALFDLYKAEAEKSVDVEVTSAFALNQEQQDKLAKVLSARLNREVRL
ATPD_PSE14      DAKAQNFIHVVAENDRLPLLPEIAELFDLYKAEQEKSVDVDVTSAFALNQEQQDKLAKVLSARLGREVRL
ATPD_PSEE4      DAQAQNFIHVAAENDRLLLLPEISALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRL
ATPD_HAHCH      NEAGANFVRVLAENNRLVLLPEIAALFEQLKAQQEATIEVTIESAFEMNDEQENKLAQALQKKLSRNVNL
ATPD_PECCP      DEAGQNLIKVMAENGRLPVLPEVLEQFIQLRAALESTVDVDVISANTLSEQQLSKIAAAMEKRLSRKVKL
ATPD_YERE8      DEPAQNFIRVMAENGRLLVLPEVLLQFIQLRASLESTVDVEVSSASPLNDEQLAKIAAAMEKRLSRKVKL
ATPD_TERTT      NEAQKNFIRVLADNNRLPLFPQVSQLFELYKANQEKAVDVELQTAYDIDDAVLAKLATSLTEKLDRKVSL
ATPD_PHOLL      DEHAQNFIRVMAENGRLLALPEVLQQFIQLRASLESTVDVEVISATELREQQLAKISVAMEKRLSRKVKL
ATPD_ALCBS      DESGRNFVAQLTQNKRLPLLPIILQLFHELLAEQQQFTDVEMISAFELDDAATDKLVAALKKRLGTEVNV
ATPD_PROMH      DEHAQNLIRVMAENDRLSTLPEVLSQFIQLRAVLESTVDVEVTSAIELTKQQLANISAAMEKRLSRKVKL
ATPD_EDWI9      DESGQNFIKVMAENGRLQVIPDVLQQFIALRDAMEATADVEVTSAAPLTQAQLDKISAAMEQRLSRKVKL
ATPD_YERPY      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_YERPS      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_YERPP      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_YERPN      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_YERPG      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_YERPE      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_YERPB      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_YERPA      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_YERP3      DEPAQNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKL
ATPD_VIBVY      DEFGQNLLKVMAENGRLAALPDVCTLFFVLKKEHEKEIDVEVISATELSDEQCANISQKLEQRLERKVKL
ATPD_VIBVU      DEFGQNLLKVMAENGRLAALPDVCTLFFVLKKEHEKEIDVEVISATELSDEQCANISQKLEQRLERKVKL
ATPD_VIBPA      DAHGQNLLKVMAENGRLAALPDVCEQFFILKKEHEKEIDVEVISASELSDEQLANIGSKLEARLERKVKL
ATPD_ENT38      DTSGQNLIKVMAENGRLRVLPDVLEQFEHLRALSEATAEVEVTSANELSEEQLAKITAAMEKRLSRKVKL
ATPD_ENTS8      DANGQNLIRVMAENGRLKVLPDVLEQFIQLRAALEATVEVEVTSASALSDEQLAKISAAMEKRLSRKVKL
ATPD_ERWCT      DEAGQNLIRVMAENGRLLVLPEVLEQFIQLRAALESTVDVDVISASTLNEQQLSKIAAAMEKRLSRKVKL
ATPD_SERP5      DEHGQNFIRVMAENGRLLVLPAVLQQFIELRALLESTVEVEVLSASALNDKQLANIAAAMEKRLSRKVKL
ATPD_SALAR      DEHGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALTY      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALTI      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALSV      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALPK      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALPC      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALPB      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALPA      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALNS      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALHS      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALG2      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALEP      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALDC      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALCH      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SALA4      DENGQNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKL
ATPD_SHESR      NEQGQNLIKVMAENGRLKVLPAVSELFAQYRNEWAKEVEADVVSAAELSSEQKQQISNSLEKRLARKVKL
ATPD_SHIDS      DENSQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_SHISS      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_SHIF8      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_SHIBS      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_SHIB3      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_SHESM      NEQGQNLIKVMAENGRLKVLPAVSELFAQYRNEWAKEVEADVVSAAELSSEQKQQISISLEKRLARKVKL
ATPD_MARMS      TEQGKAFLLALAVNKRLSLLPAISELFLQFKLNFEKAVNVQFTSAFELTAEQTQALAASLAKKLDRTVNL
ATPD_ESCF3      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ERWT9      DEAGQNLIKVMAENGRLPTLTAVLEQFIQLRAAHDATAEVEVISSTTLSDEQLTKISAAMEKRLSRKVKL
ATPD_ECOUT      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECOSM      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECOSE      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECOLU      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECOLI      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECOLC      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECOL5      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECOHS      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECODH      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECOBW      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO8A      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO7I      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO5E      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO57      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO55      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO45      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO27      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO24      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_SHIFL      DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_SHEPW      NEQAQNLLKVMAENGRLVVLPAVAQLFVEMQHEYAKEVEAQVVSATELTSEQQQEMSASLEKRLARKVKL
ATPD_SHEHH      NEQAQNLLKVMAENGRLVVLPAVAQQFVELQREYAKEVEAQIVSATELTSEQLQALSVSLEKRLARKVKL
ATPD_ECOL6      DENGQNLIRVMAENGRLKALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_ECO81      DENGQNLIRVMAENGRLKALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKL
ATPD_THIDA      GERGANFVKVLSANDRLTLLPEISTQFETLKAGAEGTLEATITSAQELSQAQVDDLVAGLKAKFQRAVNV
ATPD_SHEPA      NEQAQNLLKVMAENGRLVVLPAVAQQFVEMQREYAKEVEAQIVSATELTSEQLQALSVSLEKRLARKVKL
ATPD_NITEU      NEDGKRLVSLLIDNQRLLVMPQIHELFEQLKAQHESILEAEVVSAFPLDSGQLEKLVSILEAKFQRKVKA
ATPD_NITMU      NEEGRNFILLLAENGRLEILPEVNELYEQLKTRHEGVLDAKVISAFAMSDAQLKDLVTDLEAKFKRKIEA
ATPD_HAEPS      DQYGQNFIRVMAENKRLSALPSVFASFNQIRAEYESVKDVFVTSATPLTKAQEDKIAKAMKQKLNSEVRI
ATPD_XANC5      GEDYLRFLGVLADAQRLSLLPEVAGLYEQLRAEAEHVVKATVTSAAAMSQTELDTIAAALKKRFGRDVDI
ATPD_VIBF1      NEFGQNFINVMAENGRLKVLPGVLEQFILLQHEFEKVIDADVTSAIELTEQQKADIGAKLEARLERKVKL
ATPD_SHEFN      NEQGQNLIKVMAENGRLGILSTVSLLFAEYRNEWAKEVEADVVSATELSSEQQQQISVSLEKRLARKVKL
ATPD_METFK      NEAGTNLIKLLVEYGRLSILPEIAAAFEALKAQDEGVLEAEITAAVQPSDAEFSAIVKRLEAKFGKKVEA
ATPD_ACTPJ      DQYGQNFIRVMAENKRLAVLPMVFDTFVSLRAEHEAVKDVTIFSANELSQAQEDKIAKAMEKRLGQKVRL
ATPD_ACTP7      DQYGQNFIRVMAENKRLAVLPMVFDTFVSLRAEHEAVKDVTIFSANELSQAQEDKIAKAMEKRLGQKVRL
ATPD_ACTP2      DQYGQNFIRVMAENKRLAVLPMVFDTFVSLRAEHEAVKDVTIFSANELSQAQEDKIAKAMEKRLGQKVRL
ATPD_SODGM      DAAGQNLIRVMAENGRLTVLPDVLEQFTLWRAAQEATVEVDVISASTLKEEQLAKISAAMEQRLSRKVKL
ATPD1_VIBSL     DEFGQNLIKVMAENGRLMAFPDVCKEFFILKKEYEKEIDVEVTSAVELSEEQRAEISSKLEQRLARKVQL
ATPD_AERS4      DEHGQNLIRVMAENGRLGVLPAVLAEFVAFKAELDKEVQADVISAIELTDQQKANIQASLEKRLARKVKL
ATPD_XANAC      GEDYLRFLGVLADAQRLSLLPEVAGLYEHLRAEAEHVVKATVTSAAAMSQTELDTIAAALKKRFGRDVDI
ATPD_NITEC      NEDGRRLISLLIENGRLLVLPQISELYEQLKAQHESVLEAEIVSAFPLESYQLEKLISVLEVKFQHKVKA
ATPD_SHEWM      NEQGQNLLKVMAENGRLETLPAVSQLFVEMKHEWAKEIEANVVSATELSSEQQQEISVSLEKRLTRKVKL
ATPD_VIBFM      NEFGQNLIHVMAENGRLKVLPGVLEQFILLQHEFEKVIDADVTSAIELTEQQKADIGAKLEARLERKVKL
ATPD_SACD2      AEKQQNFIHVLADNRRLALLPEISVLFDLYKANQEKSLDVTVETAFEIDAATEKKLVEALSKKLDREVTL
ATPD2_PHOPR     DEHCQNFVRVMAENGRLIVLPDVLNLFMEMKADFERTIEATVLSVEPLTEEQKVNLVKALEKRLSRTVEL
ATPD_VIBCM      DGHGQNLIKVMAENGRLLAIPALYEHFAVLKQEHEKKVDVEVISATELSEQQRSEIGSKLEQRLERKVQL
ATPD_VIBCH      DGHGQNLIKVMAENGRLLAIPALYEHFAVLKQEHEKKVDVEVISATELSEQQRSEIGSKLEQRLERKVQL
ATPD_VIBC3      DGHGQNLIKVMAENGRLLAIPALYEHFAVLKQEHEKKVDVEVISATELSEQQRSEIGSKLEQRLERKVQL
ATPD_RALEJ      NDEARRFVKLLVENNRLTVMPEVAEQFHALKNAREGSSDVEITSAFPLDGQPLNDLVAALERKFGRKLYA
ATPD_MARAV      PEALRNFLLILAENKRLALLPEISALFRLYRADLEKSVHLTIDTAFDLSADEQQKLIDALSKKLERKVEL
ATPD_CHRVO      NDDVKRFIAALIENARLTLLPEIAAQFELLKAQSENIVDALVESAFALSDEQKAELTNTLSKKYGKAVRL
ATPD_XANOR      GEDYLRFLGVLADAQRLSLLPEVAGLYEHLRAEAEHVVKATVTSAAAMSQTELDTIAAALKKRFGRDVDI
ATPD_XANOM      GEDYLRFLGVLADAQRLSLLPEVAGLYEHLRAEAEHVVKATVTSAAAMSQTELDTIAAALKKRFGRDVDI
ATPD_HAEDU      DQYGQNFIRVMAENKRLAILPEVFNRFNALRAEYEAIKKVIVVSATELSQAQEEKIAKAMEKRLGQKVRL
ATPD_VIBAL      DTHGQNLLKVMAENGRLAALPDVCTEFYTLKKEHEKEIDVEVISATELSDEQLANIGSXXXXXXXXXXXX
ATPD_SHESW      NKQGQNLIKVMAENGRLSVLPTVSKLFSDFRNEWAKEVEANVVSATELSLEQQQHISVSLEKRLARKVKL
ATPD_SHEPC      NKQGQNLIKVMAENGRLSVLPTVSKLFSDFRNEWAKEVEANVVSATELSLEQQQHISVSLEKRLARKVKL
ATPD_IDILO      DDNAKNFVKVLAENERLPVLPAVSELYQTLRAEHDKEVTVDVKSAVKLLKAQQTALIKALEKRLQRKIKL
ATPD_XANOP      C-----FLGVLADAQRLSLLPEVAGLYEHLRAEAEHVVKATVTSAAAMSQTELDTIAAALKKRFGRDVDI
ATPD_ACTSZ      DKSGQNLIRLMAENKRLTVLPAVFNEFRHYMEEYNAIAEVQVISAQPLNATQTDKIAAAMEKRLARKVKL
ATPD1_VIBHB     DAHGQNLIKVMAENGRLTALPDVCEQFFLLKKEHEKEIDVEVISASELSDEQLANIGSKLEVRLERKVKL
ATPD_ALISL      NEFGQNLIHIMAENGRLKVLPDVLDQYILLQHEFEKVIDAEIISAIELTEQQKADIGAKLEARLERKVKL
ATPD_PSEHT      NEQGQNLVKVMAENGRLIALPAVAQLFAKFKAEYDKEIDVDVISATPLVAAQQESLVAALEKRFARKVKL
ATPD_HAMD5      DEFSKNFIKIMAQNGRLSLLPEVLKQFMALRAMINSVIDIEVFSAIPLNEDQKKKIIFALEKRLQLKVTL
ATPD_TOLAT      NEQGQNLIRVMAENGRLSVLPAVVAEFSALKAELDKELEAQITSAAALSEAEKVKIQKSLEARYQRTVRL
ATPD_RALEH      NDEARRFVKLLVDNGRLTVMPEIAEQFHVLKNAREGSSDVEITSAFPLEGSQLNDLVAALERKFGRKLYA
ATPD_RALME      NDEARRFVKLLVENSRLTALPEIAEQFHALKNAREGSSDVEITSAFPLDASQTNELVAALERKFGRKLYA
ATPD_PSYIN      DENGQNFIKIMAENGRLRFLPRVAQLFAALEDEHKKQVDVNVVSAYGLSKKQLDELSKSLEKRLARKVNL
ATPD_PSEA6      DQHGQNFVKVLAENKRLQALPDIAELFSEFKAEFDKEIEADVTSATELNAKQQADISAALEKRLARKVKL
ATPD_CUPTR      SDEARRFVQLLVENGRLTVMPDIAEQFHALKNAREGSSDVEITSAFPLEDGQLNDLVAALERKFGRKLYA
ATPD_AZOSE      TPELQNFVRVLVDNERLQMLPEIRDLFVELKNEHEGVQEAEIASAFPLDDATLANLKADLETRFKTRLNT
ATPD_THICR      NSEVKNLLNVMAENKRLDALSEVAEVFEELKATEDKRVRATVISARKATVEQKKKLSAALNAKFDAEVEI
ATPD_SHESH      NEQGQNLLKVMAENGRLEVLPAVAQQFVELCNEWAKEIEATVVSAVELTSEQQQDISVSLEKRLARKVKL
ATPD_SHEAM      NEHGQNLIKVMAENGRLEVLPAVAQLFAEYRLEWAKEVEADVVSATELSDAQQQQIGVSLEKRLARKVKL
ATPD_AZOSB      TAEQQNFVRVLVDNERLQVLPEIRDLFVALKNEHEGVLEAEIXXXXXXXXXXXXXXXXXXXXRFQARLNV
ATPD_PSEU5      DEAFRNYVQTLGENDRLSVLPTVWELYEDIKAQAEKTLEAEVETAFELSNAQLQTLAAALSKRLDRTVNL
ATPD_CHRSD      DESLCNFIRTVGSRGRLAALPAIAEQFEVLRAEEEKRVDVTIVSAFDLDAAQQDKLATALKKRLNREISI
ATPD_RALPJ      SHEAKELVGLLVANKRLTLLPEIAAQFHVLRNASEGAADVEITSAFPLEGAPLTELVATLERKFGKKLQA
ATPD1_PHOPR     NEFGQNLLKVMAENGRLTMVPAVSDEFLFLKNEHEKTIEADVISAVVLEDSQLVAISQKLEQRLERKVKL
ATPD_KLEP3      DENGQNLIKVMAENNRLKVLPDVLEQFIHLRXXXXXXXXXXXXXXNQLSDEQLARIVSAMEKRLSRKVKL
ATPD_KLEP7      DENGQNLIKVMAENNRLKVLPDVLEQFIHLRXXXXXXXXXXXXXXNQLSDEQLARIVSAMEKRLSRKVKL
ATPD_SHELP      NEQGQNLIKVMAENGRLEVLPAVYELFHEFSNEWAKEVEASVVSATELSAEQQQQISASLEKRLTRKVKL
ATPD_RALSO      SHEAKELVGLLVANKRLSLLPEIAAQFHVLRNASEGAADVEITSAFPLEGAPLTDLVATLERKFGKKLQP
ATPD_AERHH      DEHGQNLIRVMAENGRLGVLPXXXXXXXXXXXXLDKEVQADVISAIELTDQQKANIQASLEQRLARKVKL
ATPD_CITK8      DENGQNLIRVMAENNRLNALPDVLEQFIHLRXXXXXXXXXXXXXXXXLSEEQLAKISAAMEKRLSRKVKL
ATPD_PASMU      DQYGQNLIRLMAENKRLEVLPAIYQAFQHYVEEHQKVAEVQVISAQPLNATQEQKIASAMEKRLARKVKL
ATPD_SHEON      NEQGQNLIKVMAENGRLKVLPAVSELFAQYRNEWAKEVEADVVXXXXXXXXXXXXXXXXXEKRLARKVKL
ATPD_DECAR      DAELSNFIQLLSNNDRLGLLPEIAGLYETYKRAEEGTKQADIVSAFPIDDNQVKALIPQLEAVFKTKLEA
ATPD_SHESA      NEQGQNLIKVMAENGRLKVLPAVSELFAQYRNEWAKEVEADVVXXXXXXXXXXXXXXXXXXKRLARKVKL
ATPD_MANSM      DQYGQNLIRLMAENKRLTVLPAVFDEFQRYVEEHNATAEVQVISAQPLNATQEQKIAAAMEKRLARKVKL
ATPD_SHEB9      NVQGQNLIKVMAENGRLKVLPAVSQLFTEYRNEWAKEVEADVVSATXXXXXXXXXXXXXXXKRLARKVKL
ATPD_SHEB8      NVQGQNLIKVMAENGRLKVLPAVSQLFTEYRNEWAKEVEADVVSATXXXXXXXXXXXXXXXKRLARKVKL
ATPD_SHEB5      NVQGQNLIKVMAENGRLKVLPAVSQLFTEYRNEWAKEVEADVVSATXXXXXXXXXXXXXXXKRLARKVKL
ATPD_SHEB2      NVQGQNLIKVMAENGRLKVLPAVSQLFTEYRNEWAKEVEADVVSATXXXXXXXXXXXXXXXKRLARKVKL
ATPD_COXBU      PESTKHFLQLLIDEKRLMILPDIALVYQQLLNKYQGIIEASVTYVFPLNDEHRQQIQKQLEKRFNAEVKL
ATPD_COXBR      PESTKHFLQLLIDEKRLMILPDIALVYQQLLNKYQGIIEASVTYVFPLNDEHRQQIQKQLEKRFNAEVKL
ATPD_COXB2      PESTKHFLQLLIDEKRLMILPDIALVYQQLLNKYQGIIEASVTYVFPLNDEHRQQIQKQLEKRFNAEVKL
ATPD_JANMA      GAEAKNFINMLVQNDRLTLLPEIATQFHALKNAQEGAADAEIVSAFELSSAQLTELVATLEKKFGRKLNP
ATPD_HERAR      GAEAKNFINMLVQNDRLTLLPEIATQFHALKNAQEGAADAEIVSAFELSAAQLTELVATLEKKFGRKLNP
ATPD_ACIBS      SQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTV
ATPD_HAEIE      DQYGQNLIRLMAENKRLSAIPAXXXXXXXXXXXXQAIAEVEVTSAQPLNATQIEKIAAAMEKRLARKVKL
ATPD_HAES1      DQYGQNLVRLMAENKRLSVLPAVFNEFKSYVEEYKSLSQVEVISAQQLNDVQQQKIITAMEKRLARKVIL
ATPD_HAEIN      DQYGQNLIRLMAENKRLSAIPAXXXXXXXXXXXXQAIAEVEVTSAQPLNATQIEKIAAAMEKRLARKVKL
ATPD_HAEIG      DQYGQNLIRLMAENKRLSAIPAXXXXXXXXXXXXQAIAEVEVTSAQPLNATQIEKIAAAMEKRLARKVKL
ATPD_HAEI8      DQYGQNLIRLMAENKRLSAIPAXXXXXXXXXXXXQAIAEVEVTSAQPLNATQIEKIAAAMEKRLARKVKL
ATPD_AZOVD      DEAFRNFIANLGEHDRLFVLPTVREQFEAYKAEAEKTIDVELETAYELSAEQLETLAAALSKRLDRSVNP
ATPD_ACIBY      SQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTV
ATPD_ACIBT      SQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTV
ATPD_ACIBC      SQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTV
ATPD_ACIB3      SQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTV
ATPD_HAES2      DQYGQNLVRLMAENKRLAVLPAVFNEFKSYVEEYKSLSQVEVVSAQQLNDVQQQKIITAMEKRLARKVIL
ATPD_BURCM      AAGAKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLESLVSGLERKFKRKLKP
ATPD_BURA4      AAGAKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLESLVSGLERKFKRKLKP
ATPD_LARHH      GHEVRNLLEALAENHRLALLPAIAEQFEQLKQVEEGVLTADIASAYPLTEAQSAELAATLKAKYGKEIVL
ATPD_COXBN      PESTKHFLQLLIDEKRLMILPDIALVYQQLLNKYQDIIEASVTYVFPLNDEHRQQIQKQLEKRFNAEVKL
ATPD_COXB1      PESTKHFLQLLIDEKRLMILPDIALVYQQLLNKYQDIIEASVTYVFPLNDEHRQQIQKQLEKRFNAEVKL
ATPD_DIAST      PDLAKNFLRTVIDNGRVQALPEIAAQFRTLVNRSHGTSDAVVYSAFPLDAGALTDVGATLEKRFGRKLNL
ATPD_BURCH      AAGAKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLDSLVSGLERKFKRKLKP
ATPD_BURCC      AAGAKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLDSLVSGLERKFKRKLKP
ATPD_BURCA      AAGAKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLDSLVSGLERKFKRKLKP
ATPD_ACISJ      PDLAKNFLRTVIDNGRVQALPEIAAQFRTLVNRSHGTSDAVVYSAFPLDAGALTDVGATLEKRFGRKLNL
ATPD2_VIBHB     NKNFENFLRIMEENKRLKALSEVNVQFQEMKADYERTMTVTVRVSEPLDEEQMARLKQALTEKYGKAITL
ATPD_COLP3      DSQGQNFLKVMAINERLLVLPQVLEQFIALKADFDQEVSVDVTSAVEVTAEQKTTLSAALEKRLARKVKL
ATPD_BLOPB      DTFSKNIIYIMAENNRLLLLPIVFKEFTYLCSIYVHTVEIEIISAWPLKYNQLKKITDIMAKRLSKTVNP
ATPD_ACIB5      SQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTV
ATPD_ACIAD      SQAVSNFLTLLADNDRLILLPEIAEEYEELKSQNNNVVDVVIESAFPLSAEQEQLLKTALEKRYNSSVTI
ATPD_SHEDO      NTQGQNLIKVMAENGRLEVLAAVSELFTGYRNEWAKEVEASVVSAIXXXXXXXXXXXXXXXKRLARKVKL
ATPD_BURVG      AAGAKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLEGAELDSLVSGLERKFKRKLKP
ATPD_ACIAC      SDAARNFLRVLIDNGRLEALPEVAAQFRALVNRQSGSSDAVVHSAFPIDXXXXXXXXXXXXKRFGRKLNL
ATPD_NEIG2      DKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKI
ATPD_BURXL      KDNAKNLVQMLVDNHRLPLLPEIAVQFEELKNAREGAADVLIVSAFPLEGAQLNDLVASLERKFKRKLKP
ATPD_BURS3      GAGAKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLESLVSGLERKFKRKLKP
ATPD_BURPP      KDNAKNLVQMLVDNHRLQLLPEIAVQFEELKNAREGAADVLIVSAFPLEGAQLNDLVASLERKFKRKLKP
ATPD2_VIBSL     DDHVINLIKVLAENGRLAVIRDLFNLFSDLKDEHERVIPVTVTSSELLTQDQVTSLTAALEKKLERQVEM
ATPD_BURTA      ASGAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_LEGPL      NDAXXXXXXXXXXXXXXMLLPEIKALYEVYRAEQEKILEVDVVSYSELTPAXXXXXXXXXXXXXXXKVSL
ATPD_LEGPC      NDAXXXXXXXXXXXXXXMLLPEIKALYEVYRAEQEKILEVDVVSYSELTPAXXXXXXXXXXXXXXXKVSL
ATPD_LEGPA      NDAXXXXXXXXXXXXXXMLLPEIKALYEVYRAEQEKILEVDVVSYSELTPAXXXXXXXXXXXXXXXKVSL
ATPD_PSEMY      DASFSNFLRSLGSNDRLSLLPVVREQFAVLKAEAERALDVEVESAFELNAEQLQTLAAALSKRLDRTVQP
ATPD_NEIMF      DKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKI
ATPD_NEIMA      DKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKI
ATPD_NEIM0      DKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKI
ATPD_NEIG1      DKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKI
ATPD_LEGPH      NDAXXXXXXXXXXXXXXMLLPEIEALYEVYRAEQEKILEVDVVSYSELTPAXXXXXXXXXXXXXXXKVSL
ATPD_DELAS      PDAARNFLRVIIENGRLQALPEVAAQFRSLVNRAGGSSDAVVQSAFPIDXXXXXXXGTSLEKRFGRKLNL
ATPD_NEIMB      DKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELVQMLNKRFDSELKI
ATPD_BURP6      XXQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_BURP0      XXQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_BURMA      XXQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_BURM9      XXQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_BURM7      XXQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_BURPS      XXQAKNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_BURP1      XXQAKNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_BURM1      XXXXKNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLDGADLDSLVASLERKFKRKLKP
ATPD_BORPD      PQAVRNFIELLVANDRLLLLPVIAKQFVALKNRHEGTAQAEITSAFELSDAQVKELIEALETKFGLKLKP
ATPD_XANCP      --DYQRFLGLLADAQRLALLPEIAGLYEQLRAEAEHVVKATVTSATDMSPAELATITAALKKRFGREVDV
ATPD_XANCB      --DYQRFLGLLADAQRLALLPEIAGLYEQLRAEAEHVVKATVTSATDMSPAELATITAALKKRFGREVDV
ATPD_XANC8      --DYQRFLGLLADAQRLALLPEIAGLYEQLRAEAEHVVKATVTSATDMSPAELATITAALKKRFGREVDV
ATPD_BURP8      KDNAKNLVQMLVDNHRLPLLPEIATQFEELKNAREGAADALIVSAFPLEGAQLDGLVASLERKFKRKLKP
ATPD_LEPCP      STGVQHFLRTVIDNGRLAVLPAIAVQFNALVNAASGVADAAIFSAYPIEPAQLAEVVAALEQRFGRKLSV
ATPD_BURMS      XXQAKNFVQMLVDNHRIALSPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKP
ATPD_BURCJ      XXXXXNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLDSLVSGLERKFKRKLKP
ATPD_XYLFM      --AYVRFLEVIAEAHRLDVLLQVAGLYEKLRAEAEHVIKAKITSAIELAPNELNNIVTALKKRFDCEIEV
ATPD_XYLFT      --AYIRFLEVIAEAHRLDVLLQVAGLYEKLRAEAQHVIKAKITSAIELAPNELNNIVTALKKRFDCEIEV
ATPD_XYLF2      --AYIRFLEVIAEAHRLDVLLQVAGLYEKLRAEAQHVIKAKITSAIELAPNELNNIVTALKKRFDCEIEV
ATPD_CELJU      DEKQQNFIRTLASNKRLALLPYIKELFARMKAQQEKTIDVEVTAAYELPVDLINKLAQALSAKLDRNVSV
ATPD_XYLFA      --AYVRFLEVIAEAHRLDVLLQVAGLYEKLRAEAEHVIKAKITSAIELAPNELNNIVTALKKRFDCEIEV
ATPD_POLNA      PEAARNFLRLVIENGRLSALPEIASQFRSLKNAAGGMTDAVVFSAFPMDEQALNDIAAVLEKRFGRKLGI
ATPD_RUTMC      ARELSGFIGILLNNNRINALPSIATLFESLINTTNDAKMFNVISAYQLSELEKKQIVRDLTNQYNKVVNI
ATPD_BORPE      PQAARNFIELLVKNDRLLLLPVIATQFVALKNRHEGTAQAEITSAFELSDAQVKELIAALELKFGLKLKP
ATPD_BORPA      PQAARNFIELLVKNDRLLLLPVIATQFVALKNRHEGTAQAEITSAFELSDAQVKELIAALELKFGLKLKP
ATPD_BORBR      PQAARNFIELLVKNDRLLLLPVIATQFVALKNRHEGTAQAEITSAFELSDAQVKELIAALELKFGLKLKP
ATPD_STRM5      GETYSRFLAILAESHRLPLLPEISGMFDALRADAEHVVKANVTSAAELSAGELDAIKTALRKRFNREVEV
ATPD_METCA      IPEGENFIRLLASNGRLGLVGTIADMFAEFRAEEEGYVDVDVITAYPLEESETTNLNALVEKWMSRKGRL
ATPD_STRMK      -ETYSRFLAILAESHRLPLLPEISGMFDALRAEAEHVVKATVTSAAELSAGELDAIKVALRKRFNREVDV
ATPD_VARPS      PAHAQNFLGALLENGRFSVLPEIAKQFRALANAKSGSSDAVVYSAFPIDXXXXXXXXXXLEKRFGRKLQV
ATPD_POLSJ      PDAAKNFLRTVIENGRISVLPEIAAQFRVLKNAQSGSSDATVYSAFPLEGPALADLAATLEKRFGRKLNF
ATPD_BUCAT      DENAKNLIKLLSENQRFNILNNIFERFVKLEACYKNIIIVQLKSAFSLKENHINKIRKVLERFFLKKTKI
ATPD_BUCA5      DENAKNLIKLLSENQRFNILNNIFERFVKLEACYKNIIIVQLKSAFSLKENHINKIRKVLERFFLKKTKI
ATPD_BUCAI      DENAKNLIKLLSENQRFNILNNIFERFVKLEACYKNIIIVQLKSAFSLKENLINKIRKVLERFFLKKTKI
ATPD_FRATM      DENFFNFLALIAENKKMLIMPEIADQFESIKKIHNNVRVADVTLAYATDKNILDSLKTSLEKKFGCTIDM
ATPD_FRATW      DENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVRVADVTLAYATDKNILDSLKTSLEKKFGCTIDM
ATPD_FRATT      DENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVRVADVTLAYATDKNILDSLKTSLEKKFGCTIDM
ATPD_FRATO      DENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVRVADVTLAYATDKNILDSLKTSLEKKFGCTIDM
ATPD_FRATN      DENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVRVADVTLAYATDKNILDSLKTSLEKKFGCTIDM
ATPD_FRATH      DENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVRVADVTLAYATDKNILDSLKTSLEKKFGCTIDM
ATPD_FRATF      DENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVRVADVTLAYATDKNILDSLKTSLEKKFGCTIDM
ATPD_FRAT1      DENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVRVADVTLAYATDKNILDSLKTSLEKKFGCTIDM
ATPD_POLSQ      DGKVASFLNLINQNHRLAAVPEIAHQFEAMKNKSEGAAEVSITSAFPLEGSALNDLLSSLKKRFGKELRP
ATPD_VEREI      PEMAGNFLRTVIANGRINVLTQVAQQFRALLNRRNGFSDAVVYSAFPMDSAALSEVGAALQKRFGRKLNL
ATPD_ROSDO      SATMANTLSLMAQKRRLFVVPQLLSTLREIIAEDKGEVTADVVSAKALTKTQADKLAKTLKASTGKTVTL
ATPD_METNO      TGLAANFIRLSAANRRLFVLPDMIRAFRALVRESKGIVQAEVRLAETPSDAVLEEIKASLRDVARAEVDV
ATPD_FRAP2      DEKFFNFVALVAENKKLSILPEISFQFENIRNVHNNIKVADVTLAYAIDKNTLANLKTKLEEKFSCSIDM
ATPD_PSYWF      TSTEKNFVHQLAEQERLSLIPQVYEQFRLHRAQALKQVNAYVTSAYPLSETQRVMIQKRLEESLKASVII
ATPD_METS4      TGLAANFIRLAAANRRLFVLPDMIRAYRVLVREAKGIVRAEVRLAEPPSDAVLEEIKASLRDVARAEVEL
ATPD_SYMTH      SPLVLHFLYVVVQKRREPHLPSMYRAFQDLANEAMGVVEVEVRSAVPLAEETARNLEAKLTTKLGKRVKL
ATPD_DICNV      SEQERNFLNVLNQQGRMAIVPEIATQFKQLYYSAQNVCKATVYTALALDEKQKKELQATIERNVHREVVL
ATPD_POLNS      DPKVASFLNLVNQNHRLVAVPEIAHQFEAMKNKSEGAAEVNITSAFPLEGSALNDLLSSLKKRFGKELRP
ATPD_BUCAP      DKDARNLIKLLAENQRFKIFNNILRQFLKLETSYQGNTIIELISAYSLQEHEIIDIRCILQKIFLSKIKF
ATPD_BORA1      PQAARNFIDXXXXXXXXXXXPIIATQFVDLKNRYEGTAQAEITSAFELSDAQVKELIAALEVKFGLKLKP
ATPD_PSYCK      VASANNFVKQLSEQERLALLPEVYEHYRRHKAVSLKQLDAYVTSAYPLTDDQRDMLQARLAASLNASVVI
ATPD_PSYA2      VASANNFVKQLSEQERLALLPEVYEHYRRHKAVSLKQLDAYVTSAYPLTDDQRDMLQARLAASLNASVVI
ATPD_OLICO      TGITANFLKVLTANRRLFAVNDVIRAFRALVAKFRGEATADVTVAEPLNDKNLDALKASLKSVTGKDVDL
ATPD_PARL1      SGLVKNFIGLVIRNRRLFGLSDMIGAYTTLLARKRGEMTADVVSAHPLQAAQVESLKAALKSATGRDVRI
ATPD_NITWN      GGTTANFLKVLAANRRLFAVADVIRAFRALVAKFKGEATAEVTVAEKLNDKNLDALKAALKSVTGKDITL
ATPD_ACIF5      VKAWKAFLALLIHNDRWPATAEIGTLFADAMRRAEGVVDVLVTSAIALDAGQKTAVQSALERRFGHKVAF
ATPD_ACIF2      VKAWKAFLALLIHNDRWPATAEIGTLFADAMRRAEGVVDVLVTSAIALDAGQKTAVQSALERRFGHKVAF
ATPD_OCHA4      KGLVGNFLRVVARNRRLFALPGIIAAFRKIAAEHRGEVSADVISAHELSAAQQNELKATLKGVAGKDVTI
ATPD_DESHY      SVTVRNFLNLLIDRRRQNYLMEIARVFAHLADEARNIVEAKVASAIPLSETQEQRLHQELARMTGKNVRM
ATPD_DESHD      SVTVRNFLNLLIDRRRQNYLLEIARVFARLADEARNIVEAKVASAIPLSETQEQRLHQELARMTGKNVRM
ATPD_METPP      VPGVQNLLRAMIENGRLSALPEVAAQFHALVNASSGVSDAIVYSAFPIEPAALADLVATLEKRFGRRLSA
ATPD_GEMAT      PHLFLRFLQQLVKNRRQMLIPAIATEYETLRDAASGIVHARVTVARETGDEEAKMIAERLSKATGKTVVP
ATPD_SILST      VDVLRNSLALMAAKRRLFVVPALIDALRARIAEARGEVTAEVVSAKALTKTQSEKLAKTLAERVGKKVTI
ATPD_AGRVS      --LVGNFLKLVAANRRLFAVPGMIAAFRMIAARHRGELAADVTSAHALTPAQETELKEALKSATGKTVTM
ATPD_RHOP5      GGIAANFLQLLNANRRLFAVHDVIRAFGALVAKFKGEATADVTVAEPLNDQNLDALKSALKSVTGKDVTL
ATPD_GEOLS      SELVANFLLLLVDKNRVVCLPEIVETYEKLADEQSGVIRPMITTAFALDDSQVNAIKGALEQKTGKKVVP
ATPD_BRUSI      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BRUO2      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BRUC2      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BRAJA      AGISANFLKVLTANRRLFVVADVIRAYRALVAKFKGEATADVTVAEALSDKNLDALKVALKSVTGKDVAL
ATPD_RHOPT      TGISANFLKVLAANRRLFVVADVIRAYRALVAKFKGEATADVTVAEKLSDKNLEALKAALKSVTGKDVAL
ATPD_RHOPA      TGISANFLKVLAANRRLFVVADVIRAYRALVAKFKGEATADVTVAEKLSDKNLEALKAALKSVTGKDVAL
ATPD_CARHZ      ----KSFLKLLVDKRREVYLPEIIALFAEKLREERGEMLVEVESARELKGDLSDLIKEKLSRLTGKKVTM
ATPD_BACCR      SESILNTLYILIDNKRIDILPEIADEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACCQ      SESILNTLYILIDNKRIDILPEIADEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACC7      SESILNTLYILIDNKRIDILPEIADEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACC4      SESILNTLYILIDNKRIDILPEIADEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACC1      SESILNTLYILIDNKRIDILPEIADEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_SILPO      NPVLANALSLMAQKRRLFVLPQLLTALRDALAEARGEVTAEVASAKALTKTQIEKLTKTLSEKVGKSVTI
ATPD_GEOSF      SNNVANFLQLLLDRNRLPFLPQIVESFNSFADDLSGVIRPTLTSGLPLEQSQIDEIKNSLTKATGKKVVL
ATPD_BRUSU      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BACC2      SESILNTLYILIDNKRIDILPEIADEYVVLANEERNVADATVYSIRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_GEOMG      SGTVSNFLQVLLDRGRISFLPQIAHSYAAFADELSGVIRPVLTSAFPLEDAQVESMKGALVKATGKKVQL
ATPD_BEII9      TGLAANFIKLVAFKRRLFGLPKMIDDFNHLRDVEYGIVRATVTSAAPLKDEQLETLKGVLAAQGGKSVEI
ATPD_GEOUR      SESVAKFLQLLLDRSRLAFLPQITESYGNFADDLSGVVRPTLTSGLPLEESQIEEIKTSLTKTTGKKVML
ATPD_THIFE      VKAWKAFLALLIHNDRWPATAEIGTLFADAMRRAEGVVDVLVTSAIALDAGQKTAVQSALERRFGHKVRF
ATPD_RHIE6      SGFFANFLKVVARNRRLFALPGMIRAFRLIAANHRGEISAEVISAHALSQAQETELKAALKSVTGKDVTI
ATPD_NITHX      GGTTAKFLKVLTANRRLFAVTEVIRAFRALVARFKGEVTAEVTVAETLNKKNLDALTTALKSVTGKDITL
ATPD_CHLP8      GEKTMIFIKLLAHKKRANLLPTVITEFSSLLDERNGVINADVKSAVKLSDEQAKELVNGLSIRTGKKIRA
ATPD_SYNP6      HPLVLNFLNLLVDRNRIAFLDGIADRYQALLRKLRNVVRADVSSAVPLTEAQVQVITEKVKQLTGAAVEI
ATPD_SYNE7      HPLVLNFLNLLVDRNRIAFLDGIADRYQALLRKLRNVVRADVSSAVPLTEAQVQVITEKVKQLTGAAVEI
ATPD_ZYMMO      DDLTAKFLNLLAAKGRLGAFPEIASAYRQYVADLRSEKVADVITAHPLSDEQKSTLTARLKEQLKADVQI
ATPD_RHIEC      SGFFANFLKVVARNRRLFALPGMIKAFRVIAANHRGEISAEVTSAHALTAEQENELKAALKGVTGKDVAI
ATPD_DINSH      APMLSNALALMASKRRLFVLPQLVASLRALIAEEKGEMTADVISAQPLSKANLDELTKVLSASADKTVKV
ATPD_DESRM      SDETLNFLGLVVDKRRENYIAGIAAEFSVLANEARGKVAAEVTTAIEIDEKQKQELVKVASRMAGKEVEP
ATPD_BRUAB      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BRUA2      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BRUA1      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BRASO      AGVAANVLRVLTTNRRLFAVADVIRAFNALVAKYKGEATADVTVAEPISDKNLDALKAALKTVTGKDVAL
ATPD_ANAD2      LEEPANLLFLLGDRNRLAYLAAVVDTFRSLADQHLGRLRARVTSAVPLDASAAQAIADRLSKATNAKVLL
ATPD_GLOVI      HPYMLNFLQLMVDRRRIALLRPVCTSYQRILRELQQTTLAEVISAVPLSEEQASALIERIRRRTAARVEL
ATPD_BREBN      GEEAFNFLNVLIENGREVDLVDIYRSFVQLANEARGFADAIVTSAKPLSTEEQNELAEKFGQTLNKKLRM
ATPD_ANADE      LEEPANLLFLLGDRNRLAYLPAVVDTFRALADQHLGRLRARVTSAVPLDAQAAQAIADRLSQATKATVLL
ATPD_RHOFD      PAMAQNFLRTVIENGRLSALPEIAAQFRVMKNAQSGSSDAVVYSAFAIDSXXXXXXXXXXXQRFARKLNV
ATPD_RHILO      TGLTGNFLRVVARNRRLFAVPGMIKAFRQIAAEHRGETAAEVTSAHELTAAQQTELKAALKSVAGKDVAI
ATPD_BRUME      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BRUMB      XXLVGNFLRVVAQNRRLFALPGIIAAFRQIAAEHRGEISADVVSAHELTSAQQNELKATLKGVAGKDVTI
ATPD_BRASB      AGVAANVLRVLTANRRLFAVADVIRAFNALVAKYKGEATADVTVAEPLSDKNLDALKASLKTVTGKDVAL
ATPD_RHOPS      AGISANFLKLLAANRRLFVVADVIGAYRALVARFKGEATADVTVAETLSDKNLEALKLALKSVTGKDVTL
ATPD_METEP      SGLAANFIKLTADNRRLFALPGMIRAYREKVRESKGIIRAEVRVAEKPSDAVIEDIKASLRDVAKSEIDL
ATPD_DESPS      MS---NFLNLLVEKKRAEILPEIAEEFQAMVDDAQNLSHGSVISAVELSEELQGKIQQTLEKLTGKKVEL
ATPD_BACWK      SESILNTLYILIDNKRIDILPEIANEYVVLANEERNVADATVYSIRLLSEEEKLNIAEAFAKKTGKDIRV
ATPD_BACCN      SESILNTLYILVDNKRIEILPAIANEYVTLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_RHOPB      AGTTAKFLKVLTANRRLFTVTDVIRAYGALVAKFKGEATADVTVAEPLSEKNLDALKTALKSVTGKDVAL
ATPD_PELTS      SDVTANFLALLVDRRRETFFGEIVAEFVKLANAGRNIITAQVTSAVELNDQEKGDLNRILVRLTGKKVKT
ATPD_NOVAD      GELTKKFVGVLAANRRLSALPDVIRAFGQIAAAQRGEVSAEVTSAHALDDAQVAALTEKLKARTGKSIKL
ATPD_LACPL      SEYIKNFIQMLYDYGRMSNLVGIVDAFEARFDESRKIVHAEVTSAVKLSDEQADAIAKAFAKRVGNQVVL
ATPD_LACJO      SSETKNFLDFLLEYRRFESLTAIIEAFNTLYDEYKNIASGTAVSAIKLNEDELSRISQAYAKKYGKELIL
ATPD_DESAH      SKVMKSFLILLFAKARISFIREVCEFYYSLADELKGVVHATLVSATELSSDAVEKIRAGLATRIGKDIVL
ATPD_SYNP1      HGYFLNFLMLLVDRRRINLLAAICQQYRALLRKLRNIVLAEVISAVELTEQQRHAVVEKVKTMTGADVEL
ATPD_METPB      SGLAANFIKLSAANRRLFALPDMIRAYREKVREAKGIVRAEVRVAEKPSDAVIEDIKASLRDVAKSEVDI
ATPD_CHLCH      SETVMFFLKLVGKKNRLGHLPHIVDEFKNLLDEDRGIINVDITSAVELSDEQANELVATIANMSGKQVRA
ATPD_BACHK      SESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACCZ      SESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACC3      SESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACC0      SESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACAN      SESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACAH      SESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACAC      SESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_BACAA      SESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDIRV
ATPD_ANTSP      SDFIVKFLMVLVDRRRISMLHLIIDKYFSLVYKTESTILTEVITAIDLTEEQEIALINKIKMTKGKNVKL
ATPD_RHIL3      SGFFANFLKVVARNRRLFALPGMIKAFRIIAANHRGEISAEVTSAHALSQAQETELKVALKGVTGKDVTI
ATPD_DEHE1      DPLMLNLVDMLVATRRLGIMRAVSGEYNRLLNEARGVEDAIVTTAKPSSEADIEIIRQQLSKITGKKINV
ATPD_BUCBP      NQYGINLIKILAENKRLMLLEKLYKEFINLCELYQGVVNITVISAHKLNEEYISKINIMLKKRFFKKINV
ATPD_TRIEI      DPLMRNFLMLLIDKGRITFLEQIGKQYLALLRELNQTVLAEVTSTVELNENQKNTIRERVKSMTSREVEI
ATPD_SPHWW      TTK---FLGVLAQNRRLGQLGAVIRSFGTLSARHRGETTAEVTSAHPLTATQVKALKAKLKTQLDRDVAV
ATPD_CYAP7      HPYLRNFLMLLVDKRRIAFLEQVCEQYLALLRQLTNTVLAEVVSATELNDEQRQSVIDKVKTISGAQVEL
ATPD_RHILW      SGFFANFLKVVARNRRLFALPGMIKAFRIIAANHRGEISAEVTSAHALSQAQETELKVALKSVTGKDVTI
ATPD_ANASK      LEEPANLLFLLGDRNRLAYLAAVVDTFRSLADQHLGRLRARVTSAVPLDASAAQAIADRLSQATKATVLL
ATPD_METC4      SGLAANFIKLTAANRRLFALPGMIRAYREKVRESKGIIRAEVRVAEKPSDAVIEDIKASLRDVAKSEIDL
ATPD_CLONN      DDELLAFLLILIEKDRILYLKEKIREMEKIHLEKQNKLVAHVKSVVSLNEEEKQSLIDKLSKKYNKTIIL
ATPD_CHLL2      GEKVMIFLRLLAHKKRAGQLPEIIGEYQKLLDEKNGVINVSINSAVMLSDEQAKDLVNKLANYTGKKVRA
ATPD_LEUMM      TDSVKNLVKLLQVNNRLNILSIVVDEFVSQYNEVNGIVDVQATTAVALDDGRLDKLASVFASKTGQQVNI
ATPD_LACGA      XXT-KNFLEFLLEYGRFNALTEIIKAFDALYDEDKNIASGTAVSAINLDEDELNRISQAYAKKYGKKLIL
ATPD_CLOD6      SSNIKNFLKVLVDKDRISYLEDIELAYKELLNKKNNVIDGVAISAIPMSETDIKELEVKLSNKYNKNVTI
ATPD_AGRRK      FGAYTNFLKVVAKNRRLFALPGMVKAFRIIAAQHRGEVSAEITSAHALTKAQENELKAALKGVTGKDVAI
ATPD_HELMI      SETARAFILLVIDRRRESYFADIFREFVRLANKVRNIEEARVTSAVELAPEQVERLRSQLAAATGKAIVL
ATPD_GEOSL      SGTVSNFLQVLLDRGRIGFTPQIAHSYAVFADELSGIVRPVLTSAFPLDDAQVEGMKSALAKATGKRVEL
ATPD_DESOH      SVMMRSFLALLFEKRRIQHVRGINEVYQNLVDELKGIVRADVVSAGELSDDVVEKIRASLSKMTGKQVIV
ATPO_NEUCR      NETVKNFLATLAENNRLGLLPSVVAKFSELMSAARGEVEMVVTSAQPLDNKTLNRLESAVAKSSGKKLKV
ATPD_PORPU      SENTLSFLMVLVDRKRISMLDVIAGKYLELAYAMESLTIANISTSIALNSDQENLLIDKIKAMTAKEVKL
ATPD_DEHSC      DPLMLNLVDMLVATRRLGIMRAISGEYNRLLNEARGVEDAIVTTAKPASEADTEIIRQQLSKITGKKINI
ATPD_DEHSB      DPLMLNLVDMLVATRRLGIMRAISGEYNRLLNEARGVEDAIVTTAKPASEADTEIIRQQLSKITGKKINI
ATPD_XANP2      SGLAGNFVRRVAQNRRLFALPRMVADYASLVAAMRGETTAQVTVPAPLSDAHFFALKDALAQQTGKDVIL
ATPD_RHOP2      TGISANFLKLLAANRRLFVVADVIRAYRALVAKFKGEATADVTVAETLGDKNLEXXXXXXXXVTGKDVTL
ATPD_CYAP8      SPYLLNFIMLLVDKRRIIFLEEICQQYLTLLRKLTNTVLAEVTSAKELSDRQCRAVTDKIKDLTGAQVEI
ATPD_AGRT5      AGLAVNFLKVVANNRRLFAVPGMIRAYRTIAAAHRGEITAEVTSAHALDEAQETELKAALKSVTGKDVAI
ATPD_LEUCK      SEAIQNLVKLLAYNNRLNLLTQIVTSFEDYYNDAHGIVNVVATTAVALDETRLDKLAAVFASKTGKHVNL
ATPD_VESOH      DAHEAMFISVLLDNNRIGILPSIATLFESLXXXXXXXXXXXXXSSYQLSKSEKEQIVSDLMNQYNKTVSI
ATPD_THEM4      DKVFVNFVSLVFENKRQKFIPQIAAYYRYASIDVENKILVNVTTAEKLSSEELRAISEFVKKCVNRVPVI
ATPD_ERYLH      SPLTTKFLGTLAANRRLSKLGDMIRAFRTIAAAQRGEVTADVVSAHPLKDDQLESLKTKLTAREGRTVKL
ATPD_THERP      XXXXXXXXXXXXXRGRWHQLRDVVVAFRELLREHRGVIDVELVTAVPLEPSEVERLRRELAQRLSRPVEL
ATPD_AZOC5      XXXXXNFVKLVAQNRRLFALPSMFDAFAALVAAKRGQTVAKVTVAEPLNDAHQAALKEALAQQTGKDVSL
ATPD_CLOB8      DEELLSFMMILIEKDRILQLREILDQMEKIDLERRNTIRGIVKTVVPLLDEELEQLKAIFEKKYEKNILF
ATPD_ANADF      LESEPNLLFLLGDRNRLGYLGAIVDTFRALADEHLGRVRAKVTSAVPLDGSAAQAIADRLSQATQATVLL
ATPD_CYAA5      HHYLRNFLMLLVDKRRIVFLQAICEQYLALLRKLTNTVLAEVTASTELSEGQRRDVIDKIKALTGAEVEL
ATPD_BACSK      SPAVMNTINLLMERGRYSEIVGLAGEYKQLNDDKKGIAEATVFSVKALSDSEKNQIAAVFAPKAGRELRV
ATPD_RUBXD      SPLTTNFLKVLCDNRREEILEDVLRRYEEMVEDHLGRIEVEVVTATELSGEMQERIRERIARVLGREVIL
ATPD_PHEZH      KPTTKKFXXXXXXXXXXXXXPEVISAFERLAAEARGAVSAEVTTALPLSSAQAKGLAQALRQALGKDPEI
ATPD_CLOPE      DDELLSFLMVLIEKDRILYLREKLKEMEKIHLERNNTLLAEVKSVVPLTEDEVTRLVAKLENKYSKKILL
ATPD_CLOP1      DDELLSFLMVLIEKDRILYLREKLKEMEKIHLERNNTLLAEVKSVVPLTEDEVTRLVAKLENKYSKKILL
ATPD_SYNY3      NGYLLNFLMLLVDKRRIVFLEAICEQYLALLRQFTNTVLAEVTSALKLTDAQKDQVKERVKQLTGAQVEL
ATPD_PORYE      NENTLSFLMILVDRKRIGMLDAIASKYLELAYQMESLTIANINTSIALSPDQETLLTEKIKMTKAKEVKL
ATPD_OCEIH      VI---NTLKLLVDRHRTSTIPSIVDHLVALVNDTKGIADATVYSIRELNTDEKEQLQTSFAKRLGRSVQI
ATPD_DESAA      SAVTASYLLLLFDKGRIGFLDVITSEYKEMADELKGIARASVSAATELSNETIEKIRSGLGRLTGKEVVL
ATPD_METRJ      GGLAGNFIRLAASNRRLFALPDMIDAFRALVQDSKGIVRAQVRVAERPSDAVIEEIKASLRDIAKAXXXX
ATPD_CHLPD      GDKVMIFLKLIAKKKRSGMLPQIIVEYQKLLDEANGIINVSITSATPMSDDQVKALVAKLSSYTGKTIRE
ATPD_BAUCH      DNYGRNFIRIMAYNRRXXXXXXXXXXXXXXCKKNSSTIEVEVITVSALTNNQIAQITQAMRQRLSQKVKL
ATPD_SYNS9      TPSLMNLLKVLADRQRLQAFEAVMNRFLELYREQQGITLAQVRSAKPLSEAQQAALSKKVQAMAGSKVDI
ATPD_SINMW      SGLVGNFLKVVARNRRLFVLPGIIRAFRLLAARHKGEITADVTSAHALTPAQETELKAALKGVTGKDVAV
ATPD_LYSSC      PE-VLHTVQLLVEKKRVNEVKLIANAYAELAAKAQGTADATVFSTRALSAEESANISTTFAKLVGKQLNI
ATPD_GEOSW      SSPLRNTXXXXXERHRIDIVPQLAEQFIHLVNEARGVAEATAYSARPLTEEEKRALSDVFAKKMGKTLHI
ATPD_THEEB      HGYFLNFLMLLVDRRRINFLSSICEHYRALVRKLRNVALAEVTSAVELNDDQRRAVVEKVKTMTGADVEL
ATPD_RHOBL      SPLMTNTLALMSEKRRLFALPQVLSALAGLIAEEKGEVTAEVTAATKLSAAQAKKLAETLKAKVGKTVKL
ATPD_PELPB      GEKMFLFLRLVAHKKRAGLLPEIIDEFQILLDEKRGVINVDITSATALSDEQTAELVTKLAAFTGKEIRP
ATPD_MACCJ      DKPLRNLLSILADKKQLALLPSIADYYTEHYNKFNNQQYMKVESVYALSSEELDEIGKAFIKRTGKKLLI
ATPD_LACBA      ----KNLIQMVYDYGRMENMVDIIDQFQVLYDELHHTVYAEVTTAVELSAEQKSQIEAVYAKRVGAEVVL
ATPD_CLOPD      SLEIVNFLKVLIDKDRISIIREIVDIYKQLLNENKNEIQAIAITAVPMSEESLKELTYKLCEXXXXXXXX
ATPD_ALKMQ      SPEVFNFLRILLDKSRQGDFQEIYEEYKILADAGKNKIEAVAITALPMDNNDLLKLQVNLSMSSGKNVKL
ATPD_MAGSA      SELTNKFLGLAAQNRRLHTLSGVIASYLGRLAARRGEKSATVASAVALSPAQQDALTTALKAAFGGNVAV
ATPD_BARBK      GQILRNFLCVVAANRRLSALSGILQAFQRRVALSRGEVSAQVISAHPLDADQKKELCVALESVVGGKVTL
ATPD_SYNFM      TPIVRSFINLLIVKKRVEHLESIAQYYHRLIDEYSNVARAQVKAAIDLDEKVIQEIAKTLEKMTGKKIVV
ATPD_RHOBA      HPTLIKLMKVMAKRGRLGYLVAVRDAAVDLFDEAAGRVVAEVRTAVPMTEQLRGEVTQQLSSRFGKTVRL
ATPD_JANSC      -----NTLRLMASKRRLFVLPALLSELRERIADHKGEVTAEVTSAKALTKTQLDKLTKSLKAQVGKTVTV
ATPD_CLOPS      DDELLSFLMVLIEKDRILYLREKLKEMEKIHLERNNTLLAEVKSVVPLTEDEVTRLVEKLENKYSKKILL
ATPD_SYNAS      SDMTTNFLKLLVDKKRIGMLAEIADYYRVLMDEVLKRVRVSVKTAFPLPADVTSDIKQGLEQMTGKQTEI
ATPD_LISMO      NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLRGVADADVYSVVPLSEQELTALSRVFATKMNKKLNI
ATPD_LISMF      NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLNGVADADVYSVVPLSEQELTALSRVFATKMNKKLNI
ATPD_LISMC      NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLNGVADADVYSVVPLSEQELTALSRVFATKMNKKLNI
ATPD_LISW6      NPTLRDFIYLLIDRNREDYLSVIADVYQKRVNDLRGVADADVYSVIPLSEQELTALSRVFAAKMNKKLNI
ATPD_LISMH      NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLNGVADADVYSVVPLSEQELTALSRVFAAKMNKKLNI
ATPD_LISIN      NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLRGVADADVYSVVPLSEQELTALSRVFAAKMNKKLNI
ATPD_DESAP      SGTTLNFLCLVLDRRREVYLKGIADHFIALANETRNIIEAEVTSALELSVVHKVNLMQVLSRMTGKELRI
ATPD_CORDI      TAVTEALALQVIGRRESNAIDDIDALSKEAAA-LQGHSVAHVVSAGRLNDEQNQALAQKLERIYGRAMSI
ATPD_THELT      DKPFWNFLKIVFEKRRQSVLPAILQYYKNMKIESEMKVPVFLTTAYELSEEELKVITDFVRKYTKRNPVF
ATPD_LACF3      KEGASNLLQMAFDYRRMSDMVAIVDEFERRYDEKHKRVHAEVVTAVQLDETRRNQLRDNLAARLGQEIVL
ATPD_DESAD      AGPVKNFCSLLADKGRLPVIPEIASDYAGMLDNVQGVVRGKLVTAIKLTVKRQKEIKTRLEEQLKSKLEL
ATPD_BACME      SPTVQHTVLLLLERHRIQIVSEMVKEYRFLANEVRGVADATVYSVKPLSADEKRAISQSFASKVGKHLNI
ATPD_BACHD      NDTIFNTLVVLVERKRIDLIIPVVQKFKSLSYDAQKIAEAFVYSAKPLSEAEKDQLSVLFAKKVGKKLLI
ATPD_ANAVT      SPYLRNFLLLLVDKRRIFFLEEILQQYLALLRQLNQTVLAEVTSAVALTEDQQQAVEKVLALTKARQVEL
ATPD_GLUOX      ----RRFVGVIADNRRLSILDGVLALDSALRGEV----VAEVRSAQPLTDTQRSQLQARLAEAGYSRVSM
ATPD_GEOKA      STPVQNTXXXXXERHRFGLVPELAEQFLALVDDARGIAKAVAYSARPLTDEELRALSDVFAQKVGKQLEI
ATPD_CHLPB      SGKTMLFFELLCRKKRAGLLADVIEEFSALRDERGGVVNVDVTSAVKLNDEQSRKLINGLSVYTGKKVRA
ATPD_BACA2      SESVLHTIFLLIDRRRSSIVPDLTDEFIKLANQARQTEDAVVYSVKPLSEAEMLSLSQVFAKKAGASLRI
ATPD_THETN      SKEIVNFVKVAISKHRENLIKEILNEFEALYKAYFNMIDVKVISAYPLKEEVLNLVREKLEKKYNKKVNL
ATPD_RHOSK      TA---NTLALMGSKRRLFVLPQMVADVQNRIATEKGEITAEVTAAAPLSPEQXXXXXXXXXXXXGKDVKL
ATPD_RHOS4      TA---NTLALMGSKRRLFVLPQMVADVQNRIATEKGEITAEVTAAAPLSPEQXXXXXXXXXXXXGKDVKL
ATPD_RHOS1      TA---NTLALMGSKRRLFVLPQMVADVQNRIATEKGEITAEVTAAAPLSPEQXXXXXXXXXXXXGKDVKL
ATPD_PROVI      GDKMMLFLRLIAHKKRAGILGGITQEFAALLDEKNGIVNAAVTSATELSDSQQKALSRSLEGYTGKKVRS
ATPD_PROM2      NSSLMNFLKLLADRQRIGILTSILERFLEIYRENSNIALATVTSAVELTDEQKGLITQKIINIAGTELEL
ATPD_PROA2      NEKTLLFIDLICRKKRADHLPQMVEEYKALRDERSGLINVDVNSAVKLEDEQARELINSLATYTGKKVRA
ATPD_PAUCH      TPAFTNLLKLLADRKRISALEAVLLRFLELYRDIHRIALAEVTSAIPLNEEQKELLRKKIQVVAGNNVEL
ATPD_ANOFW      STVLQHTLMLLLDRHRIDIVNDLADAFIALANEARGVAEAIVYSARPLTEDETNALADVFAKKVGVDLRI
ATPO_SCHPO      L--LKNFYNVLLDNHRLYLLTRIQKQFSTLMRAKRGEIEVKITSATPLDSKILSRLESRIKSKYGKKLLV
ATPD_RHIME      SGLVGNFLKVVARNRRLFVLPGIIKAFRLLAARHKGEITADVTSAHALTLAQEIELKAALKGVTGKDVAV
ATPD_PROMS      NSSLLNFLKLLADRQRIGILTSILDRFLEIYRENSNIALATVTSAVELTDEQKGLITKKIINIAGTELEL
ATPD_NOSP7      NPYLRNFLLILVDKRRIAFLESIFQQYLALLRQLNQTVLAEVISAVPLTEXXXXXXXXXXXXXSARQVEL
ATPD_LACSS      T-LMQHFLSLVFDYQRMAEMPYIIAAYEDLYDQHKGIAHAKVTSAVALDDDQLAKISQSFAKREGNEVLI
ATPO_PIG        SPLTSNLINLLAENGRLSSTPGVISAFSTMMSVHRGEVPCSVTTASPLDEATLTELKTVLKSFLGQILKL
ATPD_SYNPX      TPSMLNLLKVLADRQRLLAFDAVMLRYLELYREQQGITLAEVRSAQTLTEDQQAALSKKVQAMAGTNVDI
ATPD_PELUB      NELLTKFLSFLISKRRFFYVDKILKSFVETCSVKRGELKAELTSAKDLTENEINNIKEELTKNFSSKIKL
ATPD_MYXXD      EATLANTLRLLVDRNRLGYLADIARLFRDMADARAGRVRGHVTSXXXXXXXXXXXXXXXXXXXXXRNVLL
ATPD_MOOTA      NPLLKNFLHLVLAKGRERALPEMAAQFRRLVDQAENILPVEVTSAITLREDILAGLKERLAGITRRNIRL
ATPD_DESDG      XXTVSNFCNLLADKGRLADLPDINAFYSLLLDAEKGIIRGELVTAIKLAKAKRDAVKEQLEKQAGQKIEL
ATPD_BACLD      STAVLHTLYLLVDRSRTSIVPDLADEYVKMANRFRGTEDAIVYSVKPLSEEEISSFSQVFAKEAGASLRV
ATPO_PONAB      SPLTTNLINLLAENGRLSNTQGVVSAFSTMMSAHRGEVPCTVTSASPLEEATLSELKTVLKSFLGQVLKL
ATPD_SOLUE      SPIVRNFLFVLVDHRRIASLTEILHSFELIMDERLGFARAEISSARELTEPQRTALSAQLAQLTGKQIRM
ATPD_CLOPA      DLKLFSFLIILIEKKRIDQLTGIILQIEKVDLDNHNQVVAEVKTVVPLNNSERTALIDKLQIKYNKSIIL
ATPD_BACCA      TP-VQNTLLLLLERHSFGLVPELAEQFLALVDDARGIAKAVAYSARRLTDEELRALSDVFAQKVGKQLEI
ATPD_ALKOO      CMEVLNFLYIIIDKGREAYIKDIVNEYILLVDSVQNKVDAVAITAVPMEKQDLLMLQANLSKSSGKNIQL
ATPO_HUMAN      SPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLGQVLKL
ATPD_MAGSM      -DLTANFLRLLIDKHRMALLNDVATAIVRVVDERAGRIQVKVETPKALTPSLVAKLEKSLADVTGKEVSL
ATPD_ACICJ      SDLVRNFIGTAIANRRLADLPSLVAGFAVYVAEKRGVVAADIASAHPLTDTQRAQLTARLAEAGYGRVTI
ATPD_SYNSC      TPSVFNLLKVLADRQRLIAFDAVMLRYLELYREQQGITLAQVRSAQSLTEDQQAALSKKVQAMAGNKVDI
ATPD_STACT      NEYLKNMLFVMAENRHLSILPEVFKAFEGLYNQYYNQDFATVESVHELSQDELDKVGEALIQRTGSKLII
ATPD_SYNWW      SQLTLNFLNMIIDKRRETYIGLISEEYRDMADELRNITKAELTAAAPVSEADMKNLEQNLSAKTGKTVQL
ATPD_SULAA      -QEVKPFIFLAVKENKGNIIKELNKAFRFEVEKFFATVQGEVITAHPIDEDLLNQIKTVLESKIGKKIEF
ATPD_RICBR      SKIMQNFLLLLIKNSRTSILADIANTYSKLLYESKNIKIVQVISANKLKPTEQEWVKTNIEKELKQETKI
ATPD_RICB8      SKIMQNFLLLLIKNSRTSILADIANTYSKLLYESKNIKIVQVISANKLKPTEQEWVKTNIEKELKQETKI
ATPD_HYPNA      SPLFGKFLGTMATNGRANDILGAEFAFDQFYAKQRGVQRAIVRTAKEMTGAEKSRIESLLARVVGGDVEL
ATPO_RHIFE      TKETSNLMNLLAENGRLNNTPGVISAFSTIMSVHRGEVPCSVTTASPLDEATLSELKTVLQSFLSKNLKL
ATPO_RAT        SPLTANLMNLLAENGRLGNTQGVISAFSTIMSVHRGEVPCTVTTAFPLDEAVLSELKTVLNSFLGQILNL
ATPD_RHOCA      SAPLANGLKLMATKRRLFALPQLLKGLAAAIAEAKGEMTADVXXXXXXXXXXXXXXXXXXXXXXGKTVKL
ATPD_MYCGA      TQTIVDFLKVVIDNREXXXXXXXXXXXXRMIEEEEHTIFINVVSAHELNDDQKAQLVEKLHKKFASQVKI
ATPD_GEOTN      SAPVQHTLLLLLERHRFGIVPELAEQFIALANDARGIAEAVAYSARPLTDEELQALSDVFAKKVGKELRI
ATPD_BACST      SAPVKNTXXXXXERHRFGLVPELADQFIALANDARGIAEAIAYSARPLTDEELQALSDVFAKKVGKTLHI
ATPD_MICAN      NPYLTNFMMLLVDKRRIQFLEPVCQQYLTLARVLTNTVLAEVSSATELNDSQKQIVIDKVKTLTGANVVL
ATPD_EMIHU      GEKTLTFLMLLVDRGRIAYLDGIAYKFLELSYKEESIEIAKVTSSVQLSAQQQKTIAEKLKKITGKQIKL
ATPO_SORAR      SPITTNLINLLAENGRLNNTPGIISAFSTMMSVHRGEVPCTVTTASALPEATLSELKTVLQSFLSKNLKL
ATPD_SORC5      SDVTKNTXXXXXXXXXXXXXPEIARQLALLVDQDQNVARAVVTSAGPLSDGYLDRLRAELEKATGRKISV
ATPD_RHOS5      LSSTSNTLALMGSKRRLFVLPQMVADVQNRIATEKGEITAEVTAAAPLSPEQXXXXXXXXXXXXGKDVKL
ATPD_PELLD      GERMMRFLSLIARKKRAGILRGIASEFKVLLDEKNGVVNADVTSATELSGEQAKELVNGLAAYTGKHVRA
ATPD_CAUCR      TTK---FLGLVAANGRTGDLLGAISAFVELSAKHRGVVTAEVVSAAALSPAQLKGVQTALAQALGKTPEV
ATPD_CAUCN      TTK---FLGLVAANGRTGDLLGAISAFVELSAKHRGVVTAEVVSAAALSPAQLKGVQTALAQALGKTPEV
ATPD_SALRD      EDLTVRFLRLLIRKDRETMTEAILDQYQTLRDEQRGIVDAEVTVARPLADETRTTLVGVLEEKTGKEIRL
ATPD_RHISN      SGLVGNFLKVVARNRRLFALPGSIKAFRLIAARHRGEITADVTSAHALTAAQETELKATLKGVTGKDVAV
ATPD_CLOCE      SKNMLNMILLLVSKHRTAEIPGIFNQFIQMANETANVLDMKIIMAAPMDEVQLETLREKFKKKYNAVAVN
ATPD_CAUSK      TAK---FLGLVASNGRAGDLMGAITAFVEMSAQHRGVVTAEVVTASALTAAQLKGVSTAVASALGKTPEI
ATPD_SYNR3      SPAMLNLLKLLADRQRIGMLDAVXXXXXXXXXXXXGITLAYVTSATALSEQQQDKLTEKVKTVAGTTVDI
ATPD_SULSY      -EISKLLIKIVKD-KKANIXXXXXXXXXXXXXXXXGTVQGEIISAYKIDEALLNEIKSVIESKIGKKVEF
ATPD_PROM1      TPSFLNLLKLLADRQRIGLLNSVLERLLEIYREQRNIALATITSASALNEDQQSELLKKVQSIAGTDLEI
ATPD_PROM0      NSSLLNFLKLLADRQRIGILTSILDRFLEIYRENSNIALATVTSAVELTDEQKGLITKKIINIAGTELEL
ATPD_DESVV      CPTVRNFCLLLADRERLAFIQDIQAYYGILLDAEKGVIRGELVTAIELANAKRDKVKAQLEAQAGRKLEL
ATPD_DESVH      CPTVRNFCLLLADRERLAFIQDIQAYYGILLDAEKGVIRGELVTAIELANAKRDKVKAQLEAQAGRKLEL
ATPD_CORA7      TMVTEALALQAIGRPEQNPIDDLAGLADTA-AKLQGRTIARVTSAGELNDSQRAALAEKLGKIYGRAMSI
ATPD_CHLTE      DEKTMVFIXXXXXXXXXXXXXGVISEFNALIDERNGVINADVKSAIKLSDEQAKELVNSLSVRTGKKIRA
ATPD_ANASP      SPYLRNFLLLLVDKRRIFFLPEILQQYLALLRQLNQTVLAEVTSAVALTEDQQQAVTKVLALTKARQVEL
ATPD_SYNJA      HPLLLNALKLLSDRRRIMFLGAVCQRFLELQRKLKNIVLAEVTTAVPLTEAQQQSIRERVRQASGVELQT
ATPD_PROMT      TPSFLNLLKLLADRQRIGLLNSVLERLLEIYREQRNIALATITSASALNEDQQSELLKKVQSIAGTDLEI
ATPD_PROM4      TPSFLNFMKLLAERQRIGFLNSVERLLELYRAQRNIAL-ATVTSATPLNEDQQAALLKNVQSVAGNNLEL
ATPD_OENOB      STTTKNFLETLADNRHFSLLEEIVENLDQRVSASNNHSLVIAKTAIPITAEQSKRLSKIAQKKFGQHVEV
ATPO_KLULA      SQSVQNLLKVLAENNRLSLLEHVTSQFSKLTDAYHGLVQATVTTAQPLDSKLFKRVEKALAASKGKSLKL
ATPD_CYAPA      HPYTFKFLLLVIDRGRISCLEIIAQKYQSLILKLTKTELAEVVTAVPLSSEQLNNIIKELTN--ANEVKL
ATPD_BACPF      XXXXXXXXXXXVENKRIESLVDMIDSFKEMSYEAQDMAEAVVYSAKPLTSEEQAQIAVIFAKKVNKKLLV
ATPD_ACIBL      I---RNFVAVLIDHQRVPLLPRIARQFELELNHRMGFADAEVTSVHELSAQDRQMIEQQIAKVVGKSVRA
ATPO_MOUSE      SPLTANLMNLLAENGRLGNTQGIISAFSTIMSVHRGEVPCTVTTASPLDDAVLSELKTVLKSFLSPNLKL
ATPD_STAAB      -PYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_DESVM      SATVRNFCLLLADKGRLDCLSDIQAFYGVLLDAEKGVIRGELMTAVELAEAKRAQVKAALEQQAGRKLEL
ATPD_CHLRE      QQYTINWLNLLVEKDRLSLVPEICECFEDLYCQMTDTQVATLRSAVKLEQEQQFLIAKKLQELTGKNIKL
ATPD_BART1      GQIVSNFLRVIAANRRLSAVFGILHAFQRCVARARKQFTAQIISARPLSSQQKQELCETLEGVIGGKVLL
ATPD_SYNJB      HPLLLNALKLLTDRRRIMFLGTVCRRFLDLQRKLQNIVLAEVTTAIPLTEAQQQSIREVMDFTQASGVEL
ATPD_CORGL      TAVTEALALQAIGRPEHNPIDDIAALAGAV-AELQGRSVAHVVTAVELNEGQQQALAEKLGRIYGRAMSI
ATPD_CORGB      TAVTEALALQAIGRPEHNPIDDIAALAGAV-AELQGRSVAHVVTAVELNEGQQQALAEKLGRIYGRAMSI
ATPD_BACP2      STHVLHTMYLLIDRGRTNIFSEMTSEFVKLANRTKQIDDAIVYSVKPLSGAEIQSLSEVFAKKAGTSLRV
ATPO_BOVIN      SPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTVTTASALDEATLTELKTVLKSFLGQVLKL
ATPD_STAAW      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAAT      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAAS      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAAN      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAAM      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAAE      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAAC      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAA9      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAA8      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAA3      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAA2      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_STAA1      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKSKVIV
ATPD_PEDPA      TKDASNYIKMTFDYGRMDYLTAIIDEFNNLCDADEKIVRAKVVSAIPLSDQQLDKMAEQFAKRLXXXXXX
ATPD_CORU7      ----------------------------QEAASLNGYEVARVTSAGPLSEEQKASLSEKLHKIYGRKIAV
ATPD_LACRJ      SKYVANLIQMVFDYGRIDCMVAIIDEFERRYDRKMKRMHADVTTAIQLDKQQEDQLKANLAKRFGNEVTL
ATPD_LACRD      SKYVANLIQMVFDYGRIDCMVAIIDEFERRYDRKMKRMHADVTTAIQLDKQQEDQLKANLAKRFGNEVTL
ATPD_GEOBB      SPMISNLLMLLLERGRISVLPQISESYGAFADELSGVIRPTLSSGLPLEASQIEEIRSALAKSTGKKVEL
ATPD_EHRCJ      DSILVKFMIIVIESNRGNILLQIFSAFLDLVRKYNKEVNISVTSCALLTKQEEEGICNALLERYGKVVGI
ATPD_CHLT3      SQQVATFLFLLASKNRAEYLPEVIQEYRALLDEQNGVISVDIKTAVXXXXXXXXXXXXXXEAYTSKKVRV
ATPD_THEAB      GEAFLNFINIVFENKREKFIPQMQALYKYAAIDIENKILVNVKTAVKLSDQEIKVINDFVEKYVGKTPVI
ATPD_PROM9      NSSLLNFLKLLADRQRIGILTSILNRFLEIYRENSNIALATVTSAVELTDEQKGLITQKIVNIAGQKLEL
ATPD_PELPD      SELMGNFLLLLVDKNRVAFFSQIVKAYGQLADEHVGILRPVITTAFELDAVQLAAIREALEKKSAKTIIP
ATPD_BACSU      SQSVLNTIFLLIDRHRAAIVPELTDEFIKLANVARQTEDAIVYSVKPLTDAEMLPLSQVFAKKAGASLRI
ATPO_CALMO      -----NLINLLAENGRLSNTQGVVSAFSTMMSVHRGEIPCTVTTASPLEETTLSELKTVLKSFLGQILKL
ATPD_PARD8      CELYSRFINLVLAHKRETLLPFIAYIYIHLYRKEKKITRVRFDTAVAVDDAVKSHLQDKLRKETGCTIEF
ATPO_CALJA      -----NLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTTASPLEEATLSELKTVLKSFLGQILKL
ATPD_STAAR      NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELVKIVKLVTQQTKSKVIV
ATPD_PARDP      SAEXXXXXXXXXXXXXXXXXPQFVAKLRNLIADAKGEVTADVVSAQALTDEQKARLADTLAAKSGKTVKL
ATPD_GEOSM      SPMISNLLMLLLERGRISVLPEISQSYGAFADELSGVIRPTLSSGLPLEAGQIEEIRSALAKSTGKKVEL
ATPD_BDEBA      SEEVVNTLVLLAEKNRFGVLEQISFAYRDLLDLEEGVTRGVVRSAQPLAADAQKDIEQKITKVLNKKIVL
ATPD_ANATD      DSYILNLLYLLIDKRREIILTYIPFYYKEIYDKIVGNVDVQVIVAHEIGSDVLNKISKWLLKKYGKNPRF
ATPD_CLOTH      EQEVVNFLMLLVDKERFENIRGIVEEYFRLADERKNILNMTIISAFPLEDVQINRIKEKYKKLYNKDVKA
ATPD_OCHNE      SSVSLNFLMLLVNRGRVAFLDKIAQKFLELSYKQDAIEIAKVTSSVALSAQQQKELAGKLKLITGKKIKL
ATPD_CYAME      VQS---WLEVIWKKKRMNLLAEICASYLELRKKKEGIVTVFVTSATPLTDTQTQQLEVQLTRMCAKHLQC
ATPD_SYNS3      TPSLMNLLKVLADRQRLPXXXXXXXXXXXXXXESRNIALAHVRAAQPLTEEQQAALTTKVQSMAGTNVEI
ATPD_PROM5      NSSLLNFLKLLADRQRIGIVTSILNRFLEIHRENSNIALATVTSAVELTDDQKGLITKKIINIAGTELEL
ATPD_MESSB      SGLVGNFLRLVARNRRLFAVPQMXXXXXXXXXXXXGETAAEVTSAHALSAEQERELKAALKSXXXXXXXX
ATPD_EHRCR      DSILVKFIMVVIENNRGNILLQILNTFLDLVKKHNREVSISVTSCAVLTKQEEEGICDALFEKYGKVVSI
ATPD_CYAP4      HXXXXXXXXXXXXXXRIFLLEPICKQFQALLRKLTNTVLAEVTSVVELTEPQRQAVIEKVKTMTGQQVEL
ATPD_CLOK5      SEDILSFLLILIDKGRINQLYSKLKEMGKIYLENHNTVIATVKTVIPLEDDERETLTEKLRRKFNKEVLI
ATPD_CLOK1      SEDILSFLLILIDKGRINQLYSKLKEMGKIYLENHNTVIATVKTVIPLEDDERETLTEKLRRKFNKEVLI
ATPO_DROME      APATVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQSKQLEGALKSFLNESLKI
ATPD_SYNP2      DTYFLNFLFLLVDRRRIVFLEGICQEFVALQRKLNNIVLADVTSAQPLTTDQEAAIADQVKQMTGNAVEL
ATPD_METSB      TTS--QFLNLVASKRRLFAVADMIRDFNILHDHAVGLSRAAVTVAEPLKDEHXXXXXXXXXXXXGSQVEM
ATPD_PROMA      TPSFLNLLKLLADRKRIGYLDAVXXXXXXXXXXXXNIALATVTSATSLNEDQQAEILKTVQSVAGTDLEL
ATPD_FLAPJ      NEVTKSLFHLLFENKRFEILGAIASEYNKLFDEINGIQVAKVTTAIAMDANLEAKVKAKIATFSDKKVTI
ATPD_EXISA      TAIVVNTLLVMVENDRAAEVRALPRYVRELINDYRGIAEGIVTSAYPLSATDLKDVELVFGQKLGKTLQL
ATPD_BARQU      GQILSNFLRVITVNRRLCALSGILQAFQHRVALSRREVSAQIISARPLSSHQEEELRVALEGVVRGKVLL
ATPD_ANAMM      SRTLVGFVCVVVKDGKFGLLSDMFEEFFVLLMHARGQFALEITTASPVSAAEEKRILSIVKSEYGEPATV
ATPD_ANAMF      SRTLVGFVCVVVKDGKFGLLSDMFEEFFVLLMHARGQFALEITTASPVSAAEEKRILSIVKSEYGEPATV
ATPD_ENTHR      ---VKNFLEVVYSYNRMSELSFMIDEYEHRYNDYKGLLLGSVKTAVPLSDEQLQKLEMNVAKTMDQTVEL
ATPD_STRSV      D----NLIEIVILNHREDLFYEIVLESQHQLEKISNEFEVTLRSVQPLTASQKEKIRPIIEQKMGLKVSL
ATPD_RHDSA      DENTVKFMMVLCDRGRLDAIAETALILAYKQASIEMAY---VASSVKLSSAQTEALVDKLKAMTADQIKL
ATPD_PROMP      NSSLLNFLKLLADRQRIGIVTSILDRFLEIYRENSNIALATVTSAVELTDDQKGLITKKIINIAGTELEL
ATPD_KOCRD      SDEAALLIERAVSAPRGSLPGRLLEQFAQWVADRQQRWIARVETARPLGEEQLARLQDGLNRLYGRDLKL
ATPD_GRAFK      TKGA---IDILLENGRIGILHLVARQYIIKFNELNNVRQAVVTTAVPLDKELEAVILSKVKELTGSEASL
ATPD_BACP3      STPVQNTXXXXXERHRFGLVPELAGTVSRPRSTTRGIAKAVAYSGAASTDEELRALSDVFAQKVGKQLEI
ATPD_ORITB      -----NFLKLLQKNNRLTYLSHIIIAFDAQVRNYQGVTLGYLITTKKWSKSAIKEIKDIFERKLNRKLII
ATPD_LACC3      SPLVANLLKLTQQYGRFGALPAIISAFNQAYDEEAGIIXXXXXXXXXLSADQADALRSTIAARFGMKSTL
ATPD_STAES      NPYVVNTLKVLADNRHISIVENVFKSFQNLYNKYYKQDFAIIESTYELSEDEISRIVELIKKQTESNVIV
ATPD_STAEQ      NPYVVNTLKVLADNRHISIVENVFKSFQNLYNKYYKQDFAIIESTYELSEDEISRIVELIKKQTESNVIV
ATPD_ROSCS      TEEVRNLILALGKEGNLDRLPAVVAAFEQMRRGGARPLTGEVTSAVELSPQQRERITEQLKARYGPDLEV
ATPD_COREF      --------------------------------KLQGRSVAHVVSAVDLNDGQQQALADKLGRIYGRAMSI
ATPD_LACCB      SPLVANLLKLTQQYGRFGALPAIISAFNQAYDEEAGIIXXXXXXXXXLSADQADALRSTIAARFGMKSTL
ATPD_ENTFA      SEMMQNFLRVVYEYRRMYDLLLMIDEYERRYDEHQGLILGSVTTAIPLSKEQHQAMEEKAAQLLGYEQAL
ATPD_STRTD      SVYMNNFLEVISLNDRANILYDVLKLVLELFDQEDNTYDVTVTSASPLSEEQKTRLLTIVSQKF--EIKT
ATPD_STRT2      SVYMNNFLEVISLNDRANILYDVLKLVLELFDQEDNTYDVTVTSASPLSEEQKTRLLTIVSQKF--EIKT
ATPD_STRT1      SVYMNNFLEVISLNDRANILYDVLKLVLELFDQEDNTYDVTVTSASPLSEEQKTRLLTIVSQKF--EIKT
ATPD_NOCFA      ----------------------IGAAFDELSAARRDQIVAHVRAAIALTSQQRERLAASLQRIYGKPVTV
ATPD_LACLM      SEVMSNFLNTIRSNGRLADLGEILEETKNAADDMFKIADVEVVSSIALSEAQIEKFKAMAKSKFDNEVTV
ATPD_GRABC      TRIERNFVGTVANNRRLGSLRSIISAFAVLVAEKRGEAVAVVESAHELTEVQEHQLRASLIEAGYGNVRI
ATPD_GLUDA      GATIRHFVGVIARNRRLSQLPXXXXXXXXXXXXKRGEEVAEVVSAQPLTDLQRVQLQSRLAEAGYSRVNI
ATPD_THEYD      PEETKKFLNFLSIEGVLIGLGEIVRYINALYLEAKKKVKGIVTSAVELPENIKQKIVESLKAITGRDVEL
ATPD_CYTH3      DNFTMSLLSLLTKKHREAVVFEISSEFQRQYREKMGIKIVEVTTTQPITEDQRANFKAIMASKASK-VEL
ATPO_ASHGO      DAAVQNLMQVLAENNRLNLLQGVAGEFTKLTDAHNGLVQATVTTAQPLEGKLFRRVEKALAQSAGKTLKL
ATPD_RHOSR      ----------------------------------------KVRSSAPLSSEQSDRLTATLTRTYGKPVTV
ATPD_PHATR      NDETLKFLMILVERGRISLLTSVITIYLELVYETASIKTIEVSTAFEFTTSQKTILVQKLKELMNREIRL
ATPD_LACLS      SEVMSNFLNTIRSNGRLADLGEILEETKNAADDMFKIADVEVVSSIALSEAQIEKFKAMAKAKFDNEVTV
ATPD_FERNB      DEIFRKFINLLIVNKRLKYINQIISFFDYTILEDKGLIPVNVTSAMXXXXXXXXXXXXFVEKYTNRKPVF
ATPD_CORJK      -----------------SLVDEVAAL--------EGRTXXXXXXXXXLGEQQKSTLSDKLEKIYGRKIAV
ATPD_THESQ      DEFQERFLTLVFERKRQKLLRNIRDLFEYEKILSEQKVPANLSIAHSPEDEELSLLRKFVRKYALKDPVF
ATPD_THEP1      DEFQERFLTLVFERKRQKLLRNIRDLFEYEKILSEQKVPANLSIAHSPEDEELSLLRKFVRKYALKDPVF
ATPD_THEMA      DEFQERFLTLVFERKRQKLLRNIRDLFEYEKILSEQKVPANLSIAHSPEDEELSLLRKFVRKYALKDPVF
ATPD_ROSS1      ----RNLVMALGREGNLDRLPAVVTAFEQMRRGGARPLTGEVISAVELNPQQRERITAQLTARYGPDLEL
ATPD_RHOCS      SGLVRQFVGLVARNRRLFALSGMIDGFLAELARRRGEQTARVVAARPLSQEQXXXXXXXXXXXXGSKVSV
ATPD_ORITI      -----NFLKLLQKNNRLTYLSHIIIAFDAQVRNYQGVTLGYLITTIKWSKAAIKDIKAIFERKLNRKLII
ATPD_NATTJ      EQEIRDYLKVLIDNKRTDELAEIHDTFLDLVRTEENRTLCEVKTPIPLDEDELKKIQDLLAQMSEGEVEI
ATPD_ACIC5      APVVRNFLAVVLQHERMHAMEEILKEFREEMNRRLGITAVSITSARALNEAERKSLLEQVGTLAEGRVDA
ATPD_LEPIC      SDITLNFLGVLLNRGRIIHLPEIQKQFTVELDKKKGRVRAQVRSYPSLEPAQAAKLGSILSEKFKSEFIL
ATPD_CLOBM      DDKILSFLLVLIEKERXXXXXXXXXXXXXXXXXXNNMILANVKTVIPXXXXXXXXXXXXXGNKYNKKIIL
ATPD_WOLTR      SESLVKFIAVIFANKRSNLLISVLEKFLTLVRESENELEITIKSAETLSESNIKIITESLS-FLGKIVRV
ATPD_THAPS      NAETFKFLMVLVKRDRINLLPTIITTYLELVYKTASVKMIEVSTAFPFTTQKLNLIKKLKELTNAREIRL
ATPD_STRZT      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRZP      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRZJ      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRR6      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRPS      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRPN      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRPJ      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRPI      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRP7      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRP4      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_STRP2      SPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVSV
ATPD_LACAC      SDEVQGFLNLLLEYNRFADLIDIIDQFSLLYDNENKIASGTATTAVKLDDDQLERLSESFAKKYDNAVRL
ATPO_IPOBA      -DTTQNFLLILAENGRLKHIDRIVKRFKELTMAHRGEVKATVTTVIPLPADEEKELKATLQEMVGKSVQI
ATPD_LACH4      SEEVQGFLNLLLEYDRFAYLVDIIDQFAVLYDDKNKIASGTATTAVKLDDDQLKRLGDGFAKKYNNTVRL
ATPD_CLOBL      DDKILSFLLVLIEKDRXXXXXXXXXXXXXXXXXXNNMISANVKTVIPXXXXXXXXXXXXXGNKYNKKIIL
ATPD_SYNPW      KPSLMNLLKVLADRQRLTALDAVXXXXXXXXXXSRNISLAHVRCAQALSDDQTKALTAKVQSMVGTSVEI
ATPD_STAHJ      NYYLKNMLMILANNRHLVLINSIFKEFKSLYNEYHNEDSAIVESVYQLSDEELDRIKDILKQTNLSQVHI
ATPD_RICCK      -----NFLLLLIKNFRMTILSDIISVFNKLLCESKNIKIVQVISANKLKPKEQEWIKSHIEKELNQKTEI
ATPD_RHOOB      ----------------------------------------------PLSSEQSDRLTATLTRTYGKPVTV
ATPD_FLAJ1      NGVTKGLFHLLFENKRFEILDAIAVEYNKLFDESNGVEVAKVTTAIPMDXXXXXXXXXXXXTLSDKKITI
ATPD_CLAMS      --------------RRIGELVRHAAT---LVADQAGLTIATVSVASPLSPEQSERLAQALSRRYSRRIEL
ATPD_CLAM3      --------------RRIGELVRHAAT---LVADQAGLTIATVSVASPLSPEQSERLAQALSRRYSRRIEL
ATPO_ARATH      -EPTKNFLSLLAENGKLKNLDAIVKKFMQLTNAHRGDVKVLVTTVIPLPPAEEKELTETLQEIIGKKITV
ATPD_CORK4      -------------------------------AQLRGYEVAHVVTAGELSDTQRSTLADKLGRIYGHKMSI
ATPD_CLOBH      DDKILSFLLVLIEKDRXXXXXXXXXXXXXXXXXXNNMILANIKTVIPXXXXXXXXXXXXXGNKYNKKIIL
ATPD_CLOB1      DDKILSFLLVLIEKDRXXXXXXXXXXXXXXXXXXNNMILANIKTVIPXXXXXXXXXXXXXGNKYNKKIIL
ATPD_STRU0      SVYVNNFLDVVLQNQREYLLFDMLKTVLKEIAQETNTYDVTVTSAIPLTEEQKNRVISVVMSKFGIQTGR
ATPD_CLOBK      DDKILSFLLVLIEKDRXXXXXXXXXXXXXXXXXXNNMILANVKTVIPXXXXXXXXXXXXXGNKYNKKIIL
ATPD_CLOBJ      DNKILSFLLVLIEKDRXXXXXXXXXXXXXXXXXXNNMILANIKTVIPXXXXXXXXXXXXXGNKYNKKIIL
ATPD_PROMM      TPSFLNLLKLLADRQRIGVLDAVLELIELYREQRNIALATVTXXXXXXXXXXXXXXXXXXXXXNTDKLEI
ATPD_PROM3      TPSFLNLLKLLADRQRIGVLDAVLELIELYREQRNIALATVTXXXXXXXXXXXXXXXXXXXXXNTDKLEI
ATPD_LEPBP      SEIVANFITLVVRKNRFLYLKDILEDYRSGVDRLKNRSSLRIVSKDSLGKEAVDQITKSISSKFGREVRV
ATPD_LEPBA      SEIVANFITLVVRKNRFLYLKDILEDYRSGVDRLKNRSSLRIVSKDSLGKEAVDQITKSISSKFGREVRV
ATPD_ANAPZ      -----SFVCVVVEDGLFASLGGIFEKFFALLRRKLGKFNLEIISAAPLTEKEESKILRMLRAQYGDPEAI
ATPD_RICPU      STIVQNFLLLLVKNSRIAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEI
ATPD_FUSNN      SENL-NILLYILDKGRMNCIKYIVAEYLKIYYRKNRILDVKATFTKELTDEQKKKLIDKLSQKTGKEI--
ATPD_DESDA      DQTMRSFCFLLADKERLAFLREISAWYGKLLDEAKGIVRGELVTAVXXXXXXXXXXXXXXXXXTGTALEL
ATPD_CLOB6      DDKILSFLLVLIEKDRXXXXXXXXXXXXXXXXXXNNMILANVKTVIPXXXXXXXXXXXXXGNKYNKKIIL
ATPD_TOBAC      QPHVANFLNILVDMKRVELIKEIVKEFEKVYNTLTDTELAVVTSVVKLESQHLAQIAKGVQRLTGKNVRI
ATPD_BIFLO      NKVTMRLAEHATCNRRRRYLETIQWLINKFSRHM-GESMVTVTTATPLKKEQIKRLVEVYSAKVGRQVHI
ATPD_BIFLD      NKVTMRLAEHATCNRRRRYLETIQWLINKFSRHM-GESMVTVTTATPLKKEQIKRLVEVYSAKVGRQVHI
ATPD_RHORU      HEIVRNFLGVVAAKHRSFAVPGMIGAFLERLAARRGEVTARIVSATALTSAQKSALTTALNKATGNTVTI
ATPD_RHORT      HEIVRNFLGVVAAKHRSFAVPGMIGAFLERLAARRGEVTARIVSATALTSAQKSALTTALNKATGNTVTI
ATPD_PROMO      EESSLNIIFYLIEKDRLSSIRGIVAEYLKIYYAKNQILDVEAIFAIEPTKDQKAKLIEQLEKKTGKKV--
ATPD_CAMLR      SDAFKNFINLIVDNKREMLIPEITKELSEQKASKENTFLGQVYSKEKLSEEEIKNLEEKLSLKFNAKIRL
ATPD_ARTCA      SEEAKVLITQAVTQPRGIKATRLVERFAELAAKRQQRWIATVSVTRPLTSTQLSRLQAGLNALYGRELKV
ATPD_ACAM1      QKQXXXXXXXXXXXXXXXXXEGICKYYQALLRKLNNTVLAEVTSTVELTDEQRHAITDKVKHMSAAQVDL
ATPD_STRGG      PVTERIIVRLVTQPRGRSLEAGLDSL-SKLAAERRDRMVAVVTSAVPLSDRQKQRLGAALAKLYGRQMHL
ATPD_STREM      IY-LNNFLEVMLQNEREAYLYQVLLRVLSELASVSNQYDVTVTSAVPLSEEQKQRVRTVVSKRLAKTGRL
ATPD_RICRS      STIVQNFLLLLVKNSRTAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEI
ATPD_RICRO      STIVQNFLLLLVKNSRTAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEI
ATPD_PARUW      DETILNFLFVLIEKNRFKYIVDIRKEYHRLAKKRLGILEVRLLTAVSVSDIPQEKVRIKLQKTYQKEVEI
ATPD_LACLA      SEVMSNFLNTVRSNGRLGDLGEILDETKNAADDMFKIADVGVVSSIALTNAQIEKFTAMAKAKFDNEVTV
ATPD_BIFLI      NKVTMRLAEHATCNRRRRYLETIQWMINKFSRHM-GESMVTVTTATPLKKEQIKRLVEVYSAKVGRQVHI
ATPD_TROWT      TLAVLEYFACYMQKKR--AFRECVFFAEKIVADELGAQIADVTTERPLSREQRDELVDVLSRRFKRRIIL
ATPD_TROW8      TLAVLEYFACYMQKKR--AFRECVFFAEKIVADELGAQIADVTTERPLSREQRDELVDVLSRRFKRRIIL
ATPD_RICAE      STIVQNFLLLLVKNSRTAILSNIVNAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEI
ATPD_CHLAD      ---------------------ELNAVAEALQTYLETVIDASVTSAIELSSEQQERITSELRRRYG-DVHV
ATPD_SPIOL      -----NFINILIDSERINLVKEILNEFEDVFNKITGTEVAVVTSVVKLENDHLAQIAKGVQKITGKNVRI
ATPD_LEPBL      LDVTLNFLGVLLNKGRFINLPEIQKRFTVELDKKKGRVRAQIKSYPSLEPAQITKLGSILSEKFKSEFIL
ATPD_LEPBJ      LDVTLNFLGVLLNKGRFINLPEIQKRFTVELDKKKGRVRAQIKSYPSLEPAQITKLGSILSEKFKSEFIL
ATPD_AZOPC      NKTLKQAIKVIVKNGRAYYIERIARMYEKEYRQSKGLVLAQLTTVGLTTNNEAKKLLKFLSNKTNGQIEF
ATPD_THEFY      --------------------------FSQLVAERAKHYIAVVRAAVPLSEAQQSRLQAALTRIYGRDIHL
ATPD_STRA1      STYLVNFLEVIVQNEREALLYPILKSIDQELIKVNGQYPIQITTAVALSPEQKERLFDIAKTKLAPNGQL
ATPD_STAS1      NQYLQNMLTILASNRHLGHIHEIYIAFETLYNEEHNQDYAVIESVYQXXXXXXXXXXXXXKARTKSKIMI
ATPD_RICAH      ----QNFLLLLVKNSRTAILSNIVDTYNALLYESKNIKIVRVISANKLQPKEQEWIKSRIEKELNQKTEI
ATPD_EHRRW      DTTLSRFILVVVTNNRGNMLLQIFNTFLEYVRKHNKEVSISVTSCSKLTTQEKQGICNALLEKYGKVVSI
ATPD_EHRRG      DTTLSRFILVVVTNNRGNMLLQIFNTFLEYVRKHNKEVSISVTSCSKLTTQEKQGICNALLEKYGKVVSI
ATPD_CLOBB      XXXXXXXXXXXXXKDRILYLREKLNEMEKIDLERKNTLKGIIKTAIPLLSNEFDNLRDIFQKKYDKNILF
ATPD_CLOBA      XXXXXXXXXXXXXKDRILYLREKLNEMEKIDLERKNTLKGIIKTAIPLLSNEFDNLRDIFQKKYDKNILF
ATPD_STRA5      STYLVNFLEVIVQNEREALLYPILKSVDQELIKVNGQYPIQITTAVALSPEQKERLFDIAKTKLAPNGQL
ATPD_STRA3      STYLVNFLEVIVQNEREALLYPILKSVDQELIKVNGQYPIQITTAVALSPEQKERLFDIAKTKLAPNGQL
ATPD_RICPR      NKIVNNFLLLLIKNSRTHILSNIVEVYNKLLYESRNIKIVHVISTNELQPKEQEWIQSRIEKELQHKTEL
ATPD_KINRD      -------------------------------------LVAHVVSATPLTDAQRERLAATLSRQYGRAIRV
ATPD_CLOAB      DEKXXXXXXXXXEKKRIHDAEGILTQLNKISLEKHNKVVAEVRTVIPLTDNEKTTLASKLSAXXXXXXXX
ATPO_YEAST      VETHKNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASQGKSLKL
ATPD_STRS7      VY-LNNLLEVMLQNEREAYLYQVLLRVLSELASVSNQYDVTVTSAVPLSEEQKQRVRTVVSKRLAKTGRL
ATPD_STRE4      VY-LNNLLEVMLQNEREAYLYQVLLRVLSELASVSNQYDVTVTSAVPLSEEQKQRVRTVVSKRLAKTGRL
ATPD_RICM5      STIVQNFLLLLVKNSRTASLSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSLIEKELNQKTEI
ATPD_PROAC      SEETLVLARVVASD---STFEQVIDGYLHVAAEMADRRRAIVTTAKALTDAQRAEMVKQLERITGSPIEL
ATPD_DESMR      -----NFLSLLADKDRLPCVLEVSALYRTLLDEAEGVMRGQLVTAFALADARQDQIKVKLEKQSGKKLVL
ATPD_PERMH      -----NLLKIIGDEFRFEV--------EKFFATVKG----EIITAYPIDEETINSXXXXXXXXXXXXXXF
ATPD_ODOSI      NKETFKFLIVLVNRSRINLLEPIIASYLNLVYNAASVKMIEVSTAYAFTNLQKNTLIKKLKELTNREIRL
ATPD_BARHE      GQILSRFLRVITLNHRLRALSGILHAFQRRVALSRREFSAQIIAARPLNXXXXXXXXXXXXXXXGGKVFL
ATPD_ACHLI      DALFMNFLMLLVRHHQVRLYEDI---YEQWIAKSQKIAYVQLYSAKPLSKKRLNQLKEEIQDYLGLEIEF
ATPD1_BRAHW     SKETYAFVSILTEHDSIDVLPDIVALYKEIADDYSNIVRVRIITASTIDDKTVEDIIQTVKCFSSNEISY
ATPD_WOLPP      SENLVKFIMVTLANKRSRXXXXXXEKFLNLVRESENELEITIKSAEILKKPDIKIITESLNF-LGKIIKV
ATPD_THENN      XXXXXRFLMLLFERKRQKLLRNIHELFEYEKILSEQKVPADLRIAHVPKEEELTLLRKFIRKYALKDPVF
ATPD_SALAI      --------------------------------------------AAPLGEEEERRLGASLSAIYGREVSV
ATPO_CANGA      -----NLLKVLAENNKLGLFDKISSQFSILNDAHNGLIRGSVTTAQPLDSKNFKRLEKALQQSVGQQKTL
ATPFD_MYCVP     NPIAEALLTQTVELIRGASADDAVNDLAELAVARRGEAVAQVTAAADLSDAQRTRLTEVLSRIYGTPVSI
ATPD_HALOH      SEPVFNFLNLIVDKRREVYLDFIIRDFIKQANRKEGLVKIEVVSAIELSEKQ------------------
ATPD_LAWIP      AQPIKNFCXXXXXXXXXXXXTQIINSFKVLLDNAKNIVHGQLITAITLDEKKQSELLISLEKQTNRKLEL
ATPFD_MYCUA     ----------------------------------------QVSAAAELSDAQRTRVTEVLSRIYGHPVTV
ATPFD_MYCMM     ----------------------------------------QVSAAAELSDAQRTRVTEVLSRIYGHPVTV
ATPD_LACS1      SKLMTNLLDMLYDYGRITSLEGIIDEFDRLNDEFEKTVRASVITAIELDEERKQKLASSFANVVGKKXXX
ATPD_EXIS2      V---LNTILVMVENDRASEVLSLPEHFIALLNEHRNVATAIVTSAYKLSDEELTNVKETFGQKSGKTLEV
ATPD_CHLSY      SEAARNFLLTMAKEGLTGELNAVAAALPGYLETGSRAVDASVTSAIELSAEQKERITRELQQRYG-DVHV
ATPD_CHLAA      SEAARNFLLTMAKEGLTGELNAVAAALPGYLETGSRAVDASVTSAIELSAEQKERITRELQQRYG-DVHV
ATPD_CALS8      DRYIVNLICLLIDKRRETLLPYIPFYYKEMYDKIIGNXXXXXXXXXXXXXXXLRKISNWLLKRYDKNPRF
ATPD_ARTS2      SEEAKVLIGQAVSHPRGLKATNLVRRFAELAAKRQQRWIATVSVTRPLTESQTGRLQAGLNALYGRELKI
ATPD_RICTY      -----NFLLLLIKNSRTHILSNIVEAYNKLLYESRNIKIVQVISSNQLQPREQEWIQYRIEKELQQKTAL
ATPD_PETMO      FVQ---FLEVLADKRRQNLIPFMSHILYQXXXXXXXXXXXXXXXPNEVSNTIINQVKQAIQNKTGRKIKL
ATPD_HYDS0      PKEIEFFVDELIDLNLLRIVGEIKRLFDYESEKILSIYKGKLIFAKEPVKELVDEIIQRVEKVLNRKIEP
ATPD_VAULI      -----NFLNLLIDKKRIDTIQTIGKIFLEKAYEFVCIKFVEVWSTIELSQKQQENLIQKINILLGPKIQL
ATPD_GALSU      DKITLNFXXXXXXXXXXXYFYDIVDQFILIWNKATNTSVVEIASVISLTEKQQQYLINKLKETKANYIKL
ATPD_BIFA0      -----------------------------------GESMVTVTTATPLSDEQSDKLARIYTKKTGRPVHI
ATPFD_MYCS2     ----------------------------ELAVSRRGEVVAHVSAAAELSDAQRTRLTEVLSRIYGRPVSV
ATPFD_MYCPA     -------LRKVLDSASITVNPIVAALLTQTVELLRGRPAEEAVAAADLSDAQRSRLTEVLSRIYGHPVSV
ATPD_WOLWR      SENLVKFIMVIFANKRXXXXXXXXXXXXXXARENENEFEITIKSAETLKESDIKIITESLSF-LGKIIKV
ATPD_WOLPM      SENLVKFIMVIFANKRXXXXXXXXXXXXXXARENENEFEITIKSAETLKESDIKIITESLSF-LGKIIKV
ATPD_SULNB      DATMVNFIKILGENKRLDLIPAIA----------------------------------------------
ATPD_STRMU      SNYMKQFLEIILQNERQQLLYLIMKVLKELSLKTH-IFDIEVTTAVALSDDQKERLTALVEKKFATKRNL
ATPD_MARMM      NVLTANAFGVAARNGRAGDLXXXXXXXXXXXXXXXXXVTADVQTAAALTKKQTEALAASLKSAFGREIEV
ATPD_NITSB      -----HLIKLLAEKDRLEIIPALANELKIQRALKERKFDGVVYSEFKLSDNELKKIAEALSKKVNGEV--
ATPD_MYCS5      VD-VKNSIKVALVRNMIFVLRKIIVDFLKITNYELGIKFAKVITAYPLSDSELEKIQKKLNEKTKKIVEI
ATPD_GUITH      SKNTLKFLLVLCDRGRSANLSSIIDNTIEL-AYKKASIEIAYVTATAFSSNQQEALVEKLKSMTSTEIKL
ATPD_STRAW      ----------------------------KLAAERRDRLVAVVTTAVPLSDTQKQRLGAALATLYGRQMHL
ATPD_CYACA      NSTTLNFISILINKNRIMFVSNISEKYNQXXXXXXXXXXXXIACARQLSEKQAQALSEVLKHKFKLSVKL
ATPD_BIFAA      -----------------------------------GESMVTVTTATPLSKEQVKKLVAIYSAKTGHPVHI
ATPFD_MYCA1     -------LRKVLDSASITVNPIVAALLTQTVELLRGRPAEEAVAAADLSGAQRSRLTEVLSRIYGHPVSV
ATPD_STRLI      -----------------------------------------VTSAVPLSDTQKQRLGAALAKVYGRPMHL
ATPD_STRCO      -----------------------------------------VTSAVPLSDTQKQRLGAALAKVYGRPMHL
ATPD_SALTO      --------------------------------------------AAPLGAEEERRLVASLSAIYGREVTV
ATPD_AQUAE      PKEVLEVLEYLIDINAMALIPEIKRLYXXXXXXXXXXXXXXXILAKKPSKKLLEKITKTINDILNRQIEI
ATPFD_MYCLE     NPIAVALLSQTVELLRGQPAKEAILFLXXXXXXXXXXXXXQVSAAAEISDAQRTRLTEVLSRIYGHPVTV
ATPFD_MYCLB     NPIAVALLSQTVELLRGQPAKEAILFLXXXXXXXXXXXXXQVSAAAEISDAQRTRLTEVLSRIYGHPVTV
ATPD_ARCB4      DNSLNNFIKLLGEKRRLDLLPFIAKDLNIQLAKMNNNYIGVVYTNQELSSDYISSIEKQFSKKFDVKLSL
ATPFD_MYCSS     -----------------------------------GEVVAHVNAAAELSDAQRTRLAEVLGRIYGRPASL
ATPFD_MYCSK     -----------------------------------GEVVAHVNAAAELSDAQRTRLAEVLGRIYGRPASL
ATPFD_MYCSJ     -----------------------------------GEVVAHVNAAAELSDAQRTRLAEVLGRIYGRPASL
ATPFD_MYCA9     -------------------------------------------AAAPITDAQRTRLAQVLGQIYGRTIAV
ATPD_MYCAP      NKTFANFLKLLISKNNSPLLLQALSIYIRLVESELNILRAKLISAFEIDNQTKIKIIEKLENKYNKKIKL
ATPD_CAMJR      NSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGIVYSKEKLSQENLKDLEVKLNKKFDANIKL
ATPD_CAMJJ      NSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGIVYSKEKLSQENLKDLEVKLNKKFDANIKL
ATPD_CAMJE      NSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGIVYSKEKLSQENLKDLEVKLNKKFDANIKL
ATPD_CAMJ8      NSSFQNFLRLLIENSRLEYIPQIVKELERQKAFKENIFVGIVYSKEKLSQENLKDLEVKLNKKFDANIKL
ATPFD_MYCTU     -----------------------------------GEIVAQVGAAAELSDAQRTRLTEVLSRIYGHPVTV
ATPFD_MYCTA     -----------------------------------GEIVAQVGAAAELSDAQRTRLTEVLSRIYGHPVTV
ATPFD_MYCBT     -----------------------------------GEIVAQVGAAAELSDAQRTRLTEVLSRIYGHPVTV
ATPFD_MYCBP     -----------------------------------GEIVAQVGAAAELSDAQRTRLTEVLSRIYGHPVTV
ATPFD_MYCBO     -----------------------------------GEIVAQVGAAAELSDAQRTRLTEVLSRIYGHPVTV
ATPD_WOLSU      -----NFIKVLADKNRLELIPDVCKELEKSIAATRNEYVAVLTTQEAFDDKTLKAIEETLAKKLQAKLVL
ATPD_FRASN      -----------------------------------------------LDADQIARLKAAISRFFGRQIQL
ATPD_STRSY      FWQINDLIEDVIRDGHADLLLETLERVQLQISKFKNEFEARVVSVYPLTEAQKERLRHLVEQRFSLRVNI
ATPD_STRS2      FWQINDLIEDVIRDGHADLLLETLERVQLQISKFKNEFEARVVSVYPLTEAQKERLRHLVEQRFSLRVNI
ATPD_MYCMO      TVNINNFLKLIITNNLFIYIKSILKIFLDIASKKLNISYGKIYSSKKLDEKIISNLEKFYSDKLSKKVEM
ATPD_SACEN      EEVTQSLVRQLVTHPQGRVSDGLEELAE-LSAKRRERSVAHVRSATPLSEEQQQRLASTLQRIYSRPIAL
ATPD_CAMJD      --SFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGIVHSKEKLSQENLKDLEVKLNKKFNANIKL
ATPD_NOCSJ      ----------------------------------------------------------ALSTQYGRPVHL
ATPD_ILYTA      EKFSLDILCYLVEKNRLSYIRGVVAEYLKIYYTKNRIVDVEATFAIEPSEKQKAKLIEKLEKKTGKKV--
ATPD_BEUC1      APETELLVRRAATSMRERSVPNAIAHVGEXXXXXXXXXXXXXXXXXPLTQGQLTRLGEILERAYGRSVQI
ATPD_BACV8      SXXXXXXXXXXXXXXXXXXXQFMIMSYIDLYRKQKNISVGKITTVCPVAEEVVNRIRALVVEKTHGTVEF
ATPD_MYCPE      SKSISNIYXXXXXXXXXXXILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRY
ATPD_STRGC      N----NLIEVLIKNGREDFFPILLDILKKIEKETN-EFEVTIHSVEGLSEEQKARLIPVIEKKMNLKVSI
ATPD_STREI      -----NFLEVILQNEREAFLKAILEGVQKDFVIATNQHDIVVTTAVALTDEQKERILALVAEKFGVKAKL
ATPD_CAMC5      SENFKNFIKLLGANKRLSLIPAILNEIKSEQTLLDNIYHGSVYGNFELNGEQLSALEDKFSKRFDAKVKL
ATPD_CAMC1      AKFA-NFIKLLGANKRLELIPAILDEMKIEQSLLENTYRGEVVGNFDLSAEQLKALEENFSKKFNSKIKL
ATPD_SORBI      ---------------RATILPEIVVEFENIFNSLTGTEVATVTSVVQLESQDLAQIAQHVQKMTGKNVRL
ATPD_RICFE      -----NFLLLLVKNSRTAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEI
ATPD_LACDB      LQEVLNFL--LSYDRFDNLVDIIDYYIHLYNAANHIGTGVAKTALKP-DEDQLQRLADSYAKKYGLQALL
ATPD_LACDA      LQEVLNF---LLSYDRFDNLVDIIDYYIHLAANHIGTGVAKTVLK--LDEDQLQRLADSYAKKYGLQALL
ATPD_NEOSM      ----KNLCKLLLANHRGFLCTTVLLGYIEIVKKNRKEADARVESYSRLSATAKKEVADALLIKFPKKINI
ATPD_STRP1      YMN--NFLNLILQNEREAYLYQMLQAVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_RICCN      STIVQNFLLLLVKNSRTAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQTTEI
PGK_PSEF5       ---------VTSDARILASLPTIKLALEKGAAVMVCSHLGRPTEGEFSAENSLKPVADYLSRALGREVPL
ATPD_STRPZ      -----NFLNLILQNEREAYLYQMLQAVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_STRPM      -----NFLNLILQNEREAYLYQMLQTVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_STRPG      -----NFLNLILQNEREAYLYQMLQTVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_STRPD      -----NFLNLILQNEREAYLYQMLQTVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_STRPC      -----NFLNLILQNEREAYLYQMLQAVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_STRPB      -----NFLNLILQNEREAYLYQMLQAVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_STRP8      -----NFLNLILQNEREAYLYQMLQTVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_STRP6      -----NFLNLILQNEREAYLYQMLQTVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_STRP3      -----NFLNLILQNEREAYLYQMLQAVLNEIAIVSNQYDVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--
ATPD_MYCMS      LINA---LKILVENQLFINTRMIXXXXXXXXXXXXNIVLGEVYSTEKLTKTQLNAXXXXXXXXXXXXXXX
ATPD_SULDN      YKEVENLIKLLAEHNRIEIIPAIA---EVMRKDIAKT---------------------------------
ATPD_STRPF      -----NFLNLILQNEREAYLYQMLQAVLNEIAIVSNQYNVTVTSSLPLTEEQKSXXXXXXXXXXGRLI--


                         +         .         .         .         .         *         .:210
query           SRKTDESLLGGVIIRAGDLVIDGSAIGKLNQLAASLLH
ATPD_NITOC      SRKTDESLLGGVIIRAGDLVIDGSAIGKLNQLAASLLH
ATPD_ALHEH      HCRTDEALIGGALIQAGDLTIDGSVRGKLARLSSAMAH
ATPD_HALHL      QTRVDESLIGGAMIRAGDTTIDGSVKGKLARLSSALVH
ATPD_THISH      VCEVDESLIGGAVIRAGDLVIDGSVRGRLERMAANL--
ATPD_PSEAE      HASEDASLIGGVIIRAGDLVIDGSVRGKLAKLAEAL--
ATPD_PSEAB      HASEDASLIGGVIIRAGDLVIDGSVRGKLAKLAEAL--
ATPD_PSEA8      HASEDASLIGGVIIRAGDLVIDGSVRGKLAKLAEAL--
ATPD_PSEA7      HASEDASLIGGVIIRAGDLVIDGSVRGKLAKLAEAL--
ATPD_PSEPW      HASEDANLIGGVVIRAGDLVIDGSVRGKIAKLAEAL--
ATPD_PSEPK      HASEDASLIGGVVIRAGDLVIDGSVRGKIAKLAEAL--
ATPD_PSEPG      HASEDASLIGGVVIRAGDLVIDGSVRGKIAKLAEAL--
ATPD_PSEP1      HASEDASLIGGVVIRAGDLVIDGSVRGKIAKLAEAL--
ATPD_PSEPF      QVEEDSSLIGGVVIRAGDLVIDGSIRGKIAKLAEAL--
ATPD_PSEF5      HAAEDASLIGGVVIRAGDLVIDGSIRGKLANLAEAL--
ATPD_PSEU2      HAAEDASLIGGVVIRAGDLVIDGSVRGKIAKLAEAL--
ATPD_PSESM      HAAEDASLIGGVVIRAGDLVIDGSVRGKIAKLAEAL--
ATPD_PSEFS      QASEDASLIGGVVIRAGDLVIDGSIRGKIAKLAEAL--
ATPD_PSE14      HAAEDASLIGGVVIRAGDLVIDGSVRGKIAKLAEAL--
ATPD_PSEE4      HASEDASLIGGVVIRAGDLVIDGSVRGKIAKLAEAL--
ATPD_HAHCH      RSQLNKELIGGIVVRAGDLVIDASVRGRLAKLAEAV--
ATPD_PECCP      NCKIDKSVMAGVVIRAGDMVIDGSIRGRLERLA-----
ATPD_YERE8      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_TERTT      QTAIDPSLLGGAIIRAGDTVIDGSVRGRLAKLAETMSH
ATPD_PHOLL      NCKIDKSVIAGVVVRAGDLVIDGSIRGRLDRL------
ATPD_ALCBS      TTSVDQSLIGGVLVRAGDTVIDGSVRGRLNRLAEQL--
ATPD_PROMH      NCKIDKSVIAGMIIRAGDLVIDGSVRGRLERL------
ATPD_EDWI9      NCKIDKSVLAGVVIRAGDLVIDGSIRGRLDRL------
ATPD_YERPY      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_YERPS      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_YERPP      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_YERPN      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_YERPG      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_YERPE      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_YERPB      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_YERPA      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_YERP3      NCKIDKSVMAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD_VIBVY      NCSVDEALLGGVIIRAGDLVIDNSARGRLNRLSDAL--
ATPD_VIBVU      NCSVDEALLGGVIIRAGDLVIDNSARGRLNRLSDAL--
ATPD_VIBPA      NCSVDETLLGGVIIRAGDLVIDDSARGRLNRLSDAL--
ATPD_ENT38      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLQRLS-----
ATPD_ENTS8      NCKIDKSVMAGVIIRSGDTVIDGSVRGRLERLA-----
ATPD_ERWCT      NCKIDKSVMAGVVIRAGDMVIDGSIRSRLERLA-----
ATPD_SERP5      NCKIDKSVLAGVIIRAGDMVIDGSVRGRLERL------
ATPD_SALAR      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALTY      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALTI      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALSV      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALPK      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALPC      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALPB      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALPA      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALNS      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALHS      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALG2      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALEP      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALDC      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALCH      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SALA4      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SHESR      NCSTDAALIAGVIIKAGDLVIDGSVRGKLSRLSEKL--
ATPD_SHIDS      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SHISS      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SHIF8      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SHIBS      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SHIB3      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SHESM      NCSTDAALIAGVIIKAGDLVIDGSVRGKLSRLSEKL--
ATPD_MARMS      TSETDASLIGGVVIRTGDLIIDGSVRGKLAKLAEAI--
ATPD_ESCF3      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ERWT9      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOUT      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOSM      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOSE      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOLU      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOLI      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOLC      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOL5      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOHS      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECODH      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECOBW      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO8A      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO7I      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO5E      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO57      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO55      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO45      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO27      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO24      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_SHIFL      NCKIDKSVMAGVIIRSGDMVIDGSVRGRLERLA-----
ATPD_SHEPW      NCSIDASLIAGVIITAGDLVIDGSVRGKISRLSDTL--
ATPD_SHEHH      NCSIDTSLIAGVIITAGDLVIDGSVRGKVSRLSDTL--
ATPD_ECOL6      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_ECO81      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_THIDA      QVAVDPELIGGAVIMIGDQVIDGSVKGRLQRMAFAL--
ATPD_SHEPA      NCSIDTSLIAGVIITAGDLVIDGSVRGKISRLSDSL--
ATPD_NITEU      EVSVDSELIGGVRIKIGDQVVDSSVHGKLEAMATAL--
ATPD_NITMU      KVSVDADLIGGVIVEIGDEVLDASVRGKLEAMAVAL--
ATPD_HAEPS      TTSIDASLIAGVIIRYDDVVIDGSSRGQLNRLSQEL--
ATPD_XANC5      TTAVDASLIGGAVIDTGDVVIDGSLKGKLARLQSSLAH
ATPD_VIBF1      NCSVDETLLAGVIIRAGDLVIDNSARGRLGRLSETL--
ATPD_SHEFN      NCSIDASLIGGVIIKSGDLVIDGSVSGKLSRLSEKL--
ATPD_METFK      SVKVDPEIIGGIKIVVGDTVIDASVRGQLQELAYTL--
ATPD_ACTPJ      TNQIDNSLIAGVIIKYDDVVIDGSSRGQLNRLASAL--
ATPD_ACTP7      TNQIDNSLIAGVIIKYDDVVIDGSSRGQLNRLASAL--
ATPD_ACTP2      TNQIDNSLIAGVIIKYDDVVIDGSSRGQLNRLASAL--
ATPD_SODGM      NCKIDKSVVAGVVIRAGDMVIDGSVRGRLERLA-----
ATPD1_VIBSL     NCSIDETLLSGVIIRAGDLVIDNSARSRLDRLSDAL--
ATPD_AERS4      NCSMDASLMAGVLIKAGDLVIDGSVRGKLDRMADAL--
ATPD_XANAC      TTAVDASLIGGAVIDTGDVVIDGSLKGKLARLQSSLAH
ATPD_NITEC      QVSVDSGLIGGVKIEIGDQVIDSSVSGKLEAMAATL--
ATPD_SHEWM      NCSIDASLIAGLIITAGDLVIDGSVRGKVSRLSDSL--
ATPD_VIBFM      NCSVDETLLAGVIIRAGDLVIDNSARGRLGRLSETL--
ATPD_SACD2      STAVDKALLGGALIRAGDTVIDGSVRGRLAKLAEAM--
ATPD2_PHOPR     DCQIDESLVGGMLIKAGELVIDGTLKSSINRLASSL--
ATPD_VIBCM      NCSVDETLLGGVIIRAGDLVIDNSARGRLKRLSDAL--
ATPD_VIBCH      NCSVDETLLGGVIIRAGDLVIDNSARGRLKRLSDAL--
ATPD_VIBC3      NCSVDETLLGGVIIRAGDLVIDNSARGRLKRLSDAL--
ATPD_RALEJ      KVAVDPSLIGGVSVKVGDEVLDTSVRARLAAMQTAL--
ATPD_MARAV      ETTVDQSLIGGVIVRTGDLVIDASVRGKLARMARAL--
ATPD_CHRVO      DVRENADLIGGVRVSVGDDVIDASVRGKLQAMAASL--
ATPD_XANOR      TTAVDASLIGGAVIDTGDVVIDGSLKGKLARLQSSLAH
ATPD_XANOM      TTAVDASLIGGAVIDTGDVVIDGSLKGKLARLQSSLAH
ATPD_HAEDU      TTEIDSTLLTGIIIKYDDIVIDGSSRGQLNRLTQAL--
ATPD_VIBAL      NCSVDETLLGGVIIRAGDLVIDDSARGRLNRLSDAL--
ATPD_SHESW      NCSTDTALIAGAIIQVGDLVIDGSVRGKLSRLSDTL--
ATPD_SHEPC      NCSTDTALIAGAIIQVGDLVIDGSVRGKLSRLSDTL--
ATPD_IDILO      NCSVDKSIIGGLVIEAGDTVIDGTLRGKLDRLAYAL--
ATPD_XANOP      TTAVDASLIGGAVIDTGDVVIDGSLKGKLARLQSSLAH
ATPD_ACTSZ      NCSVDNTLIAGVIIRTDDFVIDGSSRGQLNRLANEL--
ATPD1_VIBHB     NCSVDETLLGGVIIRAGDLVIDNSARGRLNRLSDAL--
ATPD_ALISL      NCSVDEALLAGVIIRAGDLVIDNSVRGRLSRLSETL--
ATPD_PSEHT      NCSEDAAVVGGLIIKAGDTVIDGSIRGKLNRLATTL--
ATPD_HAMD5      NCKIDESILAGVIIRHGDRVIDGSVSNRLKRLKNFLL-
ATPD_TOLAT      NCQLDPSLMAGLVIKIGDDIIDASVRSKLNRLAEAL--
ATPD_RALEH      QVAVDPSLIGGVSVKVGDEVLDTSVRSRLAAMQATL--
ATPD_RALME      KVAVDPSLIGGVSVKVGDEVLDTSVRSRLAAMQAAL--
ATPD_PSYIN      HCSIDKTLIAGMVVTVGDLVIDSSAKGQLGRLSNTL--
ATPD_PSEA6      NCSVDPTLIAGVKIKAGDTVIDGSVKSKLNRLTDAL--
ATPD_CUPTR      QVAVDPSLIGGVSVKVGDEVLDTSVRARLAAMQTAL--
ATPD_AZOSE      KVSLDPELIGGVRIAIGDEVIDASVRGKLANMAAAL--
ATPD_THICR      TYEEDPSLISGIKIKVGDWAIDGSALSQLNKLGAAI--
ATPD_SHESH      NCSIDASLVAGVIITAGDLVIDGSVRGKISRLSDTL--
ATPD_SHEAM      NCSVDAGLIAGVIIKAGDLVIDGSVSGKLARLSDKL--
ATPD_AZOSB      TVSIDPELIGGVRIAVGDEVIDASVRGKLANMAAAL--
ATPD_PSEU5      QQVVNPALIGGVLIRAGDVVVDGSVRGKLSQLAESL--
ATPD_CHRSD      TTRVDRALMGGVILRAGDTVIDGSVRGRLTRLRDAL--
ATPD_RALPJ      HVSVDPSLIGGVRVQIGDEVLDTSVRARLTQMQSAL--
ATPD1_PHOPR     NCSVDETLIAGVVIRAGDLVIDNSVRGKLNRLSDTL--
ATPD_KLEP3      NCKIDKSVMAGIIIRAGDMVIDGSVRGRLDRLA-----
ATPD_KLEP7      NCKIDKSVMAGIIIRAGDMVIDGSVRGRLERLA-----
ATPD_SHELP      NCSVDASLVAGVIITAGDLVIDGSVSGKLNRLSEKL--
ATPD_RALSO      HVTVDPSLIGGVRVQVGDEVLDTSVRARLAQMQSAL--
ATPD_AERHH      NCSMDASLMAGVLIKAGDLVIDGTVRGKLDRMADAL--
ATPD_CITK8      NCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLA-----
ATPD_PASMU      NCSLDSSLIAGVIIRTDDFVIDGSSRGQLSRLANEL--
ATPD_SHEON      NCSTDAALIAGVIIKAGDLVIDGSVRGKLSRLSEKL--
ATPD_DECAR      AVSVDPTLIGGIKVIVGDQMLDASVRGKLDAMATAL--
ATPD_SHESA      NCSTDAALIAGVIIKAGDLVIDGSVRGKLSRLSEKL--
ATPD_MANSM      NCSVDNSLLAGVIIRTDDFVIDGSSRGQLNRLANEL--
ATPD_SHEB9      NCSTDAALIAGVIIKTGDLVIDGSVRGKLSRLSDKL--
ATPD_SHEB8      NCSTDAALIAGVIIKTGDLVIDGSVRGKLSRLSDKL--
ATPD_SHEB5      NCSTDAALIAGVIIKTGDLVIDGSVRGKLSRLSDKL--
ATPD_SHEB2      NCSTDAALIAGVIIKTGDLVIDGSVRGKLSRLSDKL--
ATPD_COXBU      KMIKDESLLGGVIIRAGNWVMDGSIKGKLTRLAENL--
ATPD_COXBR      KMIKDESLLGGVIIRAGNWVMDGSIKGKLTRLAENL--
ATPD_COXB2      KMIKDESLLGGVIIRAGNWVMDGSIKGKLTRLAENL--
ATPD_JANMA      TVTVDGALIGGVRVVVGDEVLDTSVRAKLQQMQVAL--
ATPD_HERAR      TVAVDSALIGGVRVVVGDEVLDTSVRAKLQQMQVAL--
ATPD_ACIBS      SVEVKPELIAGVVIRAGDQVIDDSALNKLEKMRTRLL-
ATPD_HAEIE      NCNVDNALIAGVIIRTEDFVIDGSSRGQLTRLANEL--
ATPD_HAES1      NCRIDSSLIAGAIIRTNDFVIDGSCRGQINRLANEL--
ATPD_HAEIN      NCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANEL--
ATPD_HAEIG      NCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANEL--
ATPD_HAEI8      NCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANEL--
ATPD_AZOVD      RQVVNPALIGGLVIRAGDLVVDGSVRGKLSQLAESL--
ATPD_ACIBY      SVEVKPELIAGVVIRAGDQVIDDSALNKLEKMRTRLL-
ATPD_ACIBT      SVEVKPELIAGVVIRAGDQVIDDSALNKLEKMRTRLL-
ATPD_ACIBC      SVEVKPELIAGVVIRAGDQVIDDSALNKLEKMRTRLL-
ATPD_ACIB3      SVEVKPELIAGVVIRAGDQVIDDSALNKLEKMRTRLL-
ATPD_HAES2      NCRIDSSLIAGAIIRTNDFVIDGSCRGQINRLANEL--
ATPD_BURCM      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_BURA4      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_LARHH      KASVDPSLIGGVRILVGDEVIDASVRGKLHTMAISL--
ATPD_COXBN      KMIKDESLLGGVIIRAGNWVMDGSIKGKLTRLAENL--
ATPD_COXB1      KMIKDESLLGGVIIRAGNWVMDGSIKGKLTRLAENL--
ATPD_DIAST      SVQLDETLIGGVRVVVGDEVLDTSVKARLEQMKAAL--
ATPD_BURCH      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_BURCC      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_BURCA      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_ACISJ      SVQLDETLIGGVRVVVGDEVLDTSVKARLEQMKAAL--
ATPD2_VIBHB     ETQLDPSLVGGVVITAGQTVYDGSVLTNLSRLATNL--
ATPD_COLP3      NCFVDASIVSGLVIKAGDMVIDGSIKGKLNRLATTL--
ATPD_BLOPB      VHKVDKDILAGVIIRIGDTVIDGSIRGRIFRL------
ATPD_ACIB5      SVEVKPELIAGVVIRAGDQVIDDSALNKLEKMRTRLL-
ATPD_ACIAD      SVEVKPALIAGVVIRAGDQVIDDSALNKLEKMRTRLL-
ATPD_SHEDO      NCSTDTTLIAGMIIRAGDLVIDGSVSGQLARLSDKL--
ATPD_BURVG      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_ACIAC      SVQLDESLIGGVRVAVGDEVLDTSVKARLEQMKAALV-
ATPD_NEIG2      SVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTM--
ATPD_BURXL      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQTAL--
ATPD_BURS3      TVAVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_BURPP      TVEIDPSLIGGVRVTVGDEVLDTSVRARLASMQTAL--
ATPD2_VIBSL     EQVIDDSLVGGIVIKAGETVIDGSLNTSINRLAHQL--
ATPD_BURTA      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_LEGPL      KISIDPSLLGGALIRAGDLVIDGSVRGKLNMLGTSL--
ATPD_LEGPC      KISIDPSLLGGALIRAGDLVIDGSVRGKLNMLGTSL--
ATPD_LEGPA      KISIDPSLLGGALIRAGDLVIDGSVRGKLNMLGTSL--
ATPD_PSEMY      KPVVNPALIGGVVIRAGDLVIDGSVRGKLNKLAEAL--
ATPD_NEIMF      SVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTM--
ATPD_NEIMA      SVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTM--
ATPD_NEIM0      SVEIEPELIGGIKVEVGDQVLDLSVRGKLSALYTTM--
ATPD_NEIG1      SVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTM--
ATPD_LEGPH      KISIDPSLLGGALIRAGDLVIDGSVRGKLNMLGTSL--
ATPD_DELAS      SVQQDQSLIGGIRVVVGDEVLDTSVKARLEQMKAALI-
ATPD_NEIMB      SVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTM--
ATPD_BURP6      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_BURP0      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_BURMA      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_BURM9      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_BURM7      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_BURPS      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_BURP1      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_BURM1      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_BORPD      SVTVDKSLIGGVRVAVGDQVLDTSVQAQLARLRDTL--
ATPD_XANCP      TTAVDASLIGGAVIDTGEMVIDGSLKGKLARLQNSLAH
ATPD_XANCB      TTAVDASLIGGAVIDTGEMVIDGSLKGKLARLQNSLAH
ATPD_XANC8      TTAVDASLIGGAVIDTGEMVIDGSLKGKLARLQNSLAH
ATPD_BURP8      TVQVDSSLIGGVRVTVGDEVLDTSVRARLASMQTAL--
ATPD_LEPCP      NVTLEPELIGGIRVVVGDEVLDTSVKARLERMKVAL--
ATPD_BURMS      AVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAAL--
ATPD_BURCJ      TVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQAAL--
ATPD_XYLFM      TTGVDHSLIGGAVIDTGNVVIDGSIKSKLTRLQASLTH
ATPD_XYLFT      TTGVDHSLIGGAVIDTGNVVIDGSIKSKLTRLQASLTH
ATPD_XYLF2      TTGVDHSLIGGAVIDTGNVVIDGSIKSKLTRLQASLTH
ATPD_CELJU      HSSINKSLLGGVVIHTGDTVIDGSVRGRLAKLAEAL--
ATPD_XYLFA      TTGVDHSLIGGAVIDTGNVVIDGSIKSKLTRLQASLTH
ATPD_POLNA      KVELDPSLIGGIRAVVGDEVLDTSVKARLEQMKMALI-
ATPD_RUTMC      DAVIDKDLVGGVIIKDGDKVIDMSIKARVNELELRL--
ATPD_BORPE      HVSVDQELIGGVRVAVGDQVLDTSVKAQLARLRDTL--
ATPD_BORPA      HVSVDQELIGGVRVAVGDQVLDTSVKAQLARLRDTL--
ATPD_BORBR      HVSVDQELIGGVRVAVGDQVLDTSVKAQLARLRDTL--
ATPD_STRM5      TTAVDASLIGGAVIDAGDVVIDGSLKGKLARLQTAL--
ATPD_METCA      HVTVDESLIXXXXXXXXXXXXDASVHGQLQRLAKRL--
ATPD_STRMK      TTAVDASLIGGAVIDAGDVVIDGSLKGKLARLQTAL--
ATPD_VARPS      TVQQEPELIGGIRVVVGDEVLDTSVKARLEQMKVAL--
ATPD_POLSJ      AVELEPALIGGVRVVVGDEVLDTSVKARLEQMKVALI-
ATPD_BUCAT      IYKVDPNILNGMIVKVNNTIFDLSAQNHLKQLSDSL--
ATPD_BUCA5      IYKVDPNILNGMIVKVNNTIFDLSAQNHLKQLSDSL--
ATPD_BUCAI      IYKVDPNILNGMIVKVNNTIFDLSAQNHLKQLSDSL--
ATPD_FRATM      HINIDPAIIGGAVVKVGDTVIDSSVSGHLEKLKSILL-
ATPD_FRATW      HINIDPAIIGGAVVKVGDTVIDSSVSGHLEKLKSILL-
ATPD_FRATT      HINIDPAIIGGAVVKVGDTVIDSSVSGHLEKLKSILL-
ATPD_FRATO      HINIDPAIIGGAVVKVGDTVIDSSVSGHLEKLKSILL-
ATPD_FRATN      HINIDPAIIGGAVVKVGDTVIDSSVSGHLEKLKSILL-
ATPD_FRATH      HINIDPAIIGGAVVKVGDTVIDSSVSGHLEKLKSILL-
ATPD_FRATF      HINIDPAIIGGAVVKVGDTVIDSSVSGHLEKLKSILL-
ATPD_FRAT1      HINIDPAIIGGAVVKVGDTVIDSSVSGHLEKLKSILL-
ATPD_POLSQ      TIQVDPTLIGGVRIQVGDEVMDSSVKAQLAQMQASL--
ATPD_VEREI      AVQQDPSLIGGIRVVVGDEVLDSSVKARLEQMKAAL--
ATPD_ROSDO      NASVDESLIGGLVVKVGSRMIDTSIRSKLNSL------
ATPD_METNO      DLRIDPSLIGGIVVKVGSRMVDASLRTKLNSIRLAM--
ATPD_FRAP2      NVIIDPVILGGAVIKVGDTVIDDSVSGRIETLKSILL-
ATPD_PSYWF      HEDVDPSLLAGATVKIGDKLVDDSVRGKLKQLKTQL--
ATPD_METS4      DLRVDPSLIGGIVVKLGSRMVDASLRTRLNSIRLAM--
ATPD_SYMTH      RTQVAPELIGGLAVRVGDTLMDGSVRTRLRRMHERLI-
ATPD_DICNV      DVREEPALIAGVRIEYDGMVIDQSARGRLERFARML--
ATPD_POLNS      TIQVDPTLIGGVRIQVGDEVMDSSVKVQLAQMQASL--
ATPD_BUCAP      IYKIDHQILDGIIIKKADTVFDFSVRSYLKQLS-----
ATPD_BORA1      QVTIDPSLIGGVRVAVGDQVLDTSVKAQLARLRDTL--
ATPD_PSYCK      HESVDASLLAGVTIKVGDKVIDDSMRGKLQQLKTQL--
ATPD_PSYA2      HESVDASLLAGVTIKVGDKVIDDSMRGKLQQLKTQL--
ATPD_OLICO      NVKVDPSIIGGLIVKLGSRMVDSSLRTKLNSI------
ATPD_PARL1      NTKVDASLLGGLIVTVGSRMVDSSLRTKLNSLKIAM--
ATPD_NITWN      NVKVDPSIIGGLVVKLGSRMVDTSLRTKLNSI------
ATPD_ACIF5      REAVDAALIGGLVIHTGDLTIDASVRGQVQQLARTL--
ATPD_ACIF2      REAVDAALIGGLVIHTGDLTIDASVRGQVQQLARTL--
ATPD_OCHA4      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_DESHY      VKEVRPELIGGVMIQIGDRVMDGTVAFKLQRIRQSLSH
ATPD_DESHD      VKEVRPELIGGVMIQIGDRVMDGTVAFKLQRIRQSLSH
ATPD_METPP      TVQLEPELIGGVRVVVGDEVLDTSVKARLEHMKVAL--
ATPD_GEMAT      HFAVDPSILGGVVVRVGDTVMDGS--------------
ATPD_SILST      NATVDASIIGGLVVKVGSKMIDSSIRSKLNSL------
ATPD_AGRVS      FVTVDPSLLGGLIVKIGSRQID----------------
ATPD_RHOP5      NVNVDPAIIGGLVVKLGSRMVDSSLRTKLNSI------
ATPD_GEOLS      QVKVDQSLIGGVVTQIGDIAYDSSVKTQLARI------
ATPD_BRUSI      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BRUO2      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BRUC2      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BRAJA      NVKVDPSIIGGLVVKLGSRMVDGSLRTKLNSI------
ATPD_RHOPT      NINVDPAIIGGLVVKLGSRMVDSSLRTKLNSI------
ATPD_RHOPA      NINVDPAIIGGLVVKLGSRMVDSSLRTKLNSI------
ATPD_CARHZ      KVRTNPDLIGGIVVRVGNKVYDGSIKNQLYRLKRSI--
ATPD_BACCR      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACCQ      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACC7      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACC4      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACC1      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_SILPO      NATVDESLIGGLVVKVGSKMIDSSIRSKLNSL------
ATPD_GEOSF      KVEVDPSLIGGVVTKIGDKVFDGS--------------
ATPD_BRUSU      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BACC2      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_GEOMG      SVQVEPSLIGGVITKIGDKVFDGSVRTQLNRI------
ATPD_BEII9      AAKVDPALIGGLIVQLGSRMVDGSLKTKLNAI------
ATPD_GEOUR      KVQVDPSLIGGVVTKIGDKVFDGSVKTQLAKI------
ATPD_THIFE      REAVDAALIGGLVIHTGDLTIDASVRGQVQQLARTL--
ATPD_RHIE6      SVTVDPSILGGLIVKVGSRQID----------------
ATPD_NITHX      NVKVDPSIIGGLVVKLGSRMVDSSLRTKLNSI------
ATPD_CHLP8      KMSLDEKLIGGVTVKIGDTILDGSIQHQLQLLKSSLI-
ATPD_SYNP6      ESQVDADLLGGVIIKVGSQVLDASLRGQLKRISISL--
ATPD_SYNE7      ESQVDADLLGGVIIKVGSQVLDASLRGQLKRISISL--
ATPD_ZYMMO      NATVDPSILGGMIVRLGSRQIDGSIRSKLHMLAQAM--
ATPD_RHIEC      AVTVDPSILGGLIVKVGSRQID----------------
ATPD_DINSH      NATVDNSLIGGLVVKMGSKMIDTSIRAKLNAL------
ATPD_DESRM      TFGVDPSLIGGVVVRIGSKVIDGSIKTRLATIKSRLM-
ATPD_BRUAB      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BRUA2      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BRUA1      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BRASO      NVKVDPAIIGGLVVKLGSRMIDSSLRTKLNSI------
ATPD_ANAD2      DRAVDPSLLGGVIAQVGSLVYDGSVRTQLEDLRKTL--
ATPD_GLOVI      RRRVDPELLGGMIIKIGDEVIDASLRGQLRKLTLQL--
ATPD_BREBN      TAVVDPAILGGVIIKIGDRLYDGSLKTKLETFA-----
ATPD_ANADE      DRAVDPALLGGVVAQVGSLVYDGSLRTQLEDLRKTL--
ATPD_RHOFD      SVQLQPELIGGIRVVVGDEVLDSSVKARLEQMKMAL--
ATPD_RHILO      SVTVDPSLLGGLVVKIGSRQID----------------
ATPD_BRUME      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BRUMB      NVTVDPSILGGLIVKMGSRQID----------------
ATPD_BRASB      NVKVDPAIIGGLVVKLGSRMIDSSLRTKLNSI------
ATPD_RHOPS      NINVDPAIIGGLVVKLGSRMVDSSIRTKLNSI------
ATPD_METEP      DLHIDPSLIGGIVVKMGSRMVDASLRTKLNSIRLAM--
ATPD_DESPS      TTSVDPSIIGGIVAKVGDLVLDGSIKTQLAGLKESI--
ATPD_BACWK      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACCN      KNIVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_RHOPB      NVNVDPAIIGGLVVKLGSRMVDSSLRTKLNSI------
ATPD_PELTS      SYAVDPSLIGGVVVRMGDKIIDGSLKTRLASLKERLL-
ATPD_NOVAD      KTSVDPEILGGLVVKIGSQMIDSSIRTRLNSLAQAM--
ATPD_LACPL      SRKVDEAIIGGVIVKSNNQTFDGSVALQLTNLRRALIN
ATPD_LACJO      TNKVDPSILGGIILKVGDRIIDGSIRTRLQQIREQLI-
ATPD_DESAH      DVEQDPSLLGGVVTKIGDLVLDGSVKTQLFNMRETL--
ATPD_SYNP1      AIAIDPELLGGVVIKVGSQIFDASLRGQLRRLSVSL--
ATPD_METPB      DLHIDPSLIGGIVVKMGSRMVDASLRTKLNSIRLAM--
ATPD_CHLCH      TLTVNEELIAGAAVKIADTIIDGTVRHQLSKLRSSLV-
ATPD_BACHK      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACCZ      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACC3      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACC0      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACAN      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACAH      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACAC      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_BACAA      KNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELM-
ATPD_ANTSP      ITTIDQTLIGGFIVRIGSKVIDASLSGKLKQIA-----
ATPD_RHIL3      AVTVDPSILGGLIVKVGSRQID----------------
ATPD_DEHE1      VTATDPGLIAGLKARIGDKLIDGSVSRRL---------
ATPD_BUCBP      TYVIDESIIGGLIIKFCDTVINASIHSRLEKL------
ATPD_TRIEI      ETKVDPSILGGVIIKIGSQIIDSSLQGQLRRIGISL--
ATPD_SPHWW      DLTVDPSILGGLIVKIGSRQIDGSIRSKLNSLAIAM--
ATPD_CYAP7      KASINPDLIGGVIIKIGSQILDASIRGQLRRISLSL--
ATPD_RHILW      AVTVDPSILGGLIVKVGSRQID----------------
ATPD_ANASK      DRAVDPALLGGVVAQVGSLVYDGSLRTQLEDLRKTL--
ATPD_METC4      DLHIDPSLIGGIVVKMGSRMVDASLRTKLNSIRLAM--
ATPD_CLONN      KEELDETLIGGVYVRIGDDVIDGTIKGKFEEIRKKVM-
ATPD_CHLL2      KMKLEEALLGGVTVKIEDTIIDGSVRHQLQMMKKFLL-
ATPD_LEUMM      ENVVDESILGGVILQSQSTLIDGSLQTKIAKMKAQLL-
ATPD_LACGA      TNEVDSSILGGIILKVGDRIIDGSIRTRLQQIREQLI-
ATPD_CLOD6      ENVVDKTILGGVLVRIGNEQIDGTVKTRLDKMKEKL--
ATPD_AGRRK      AVTVDPSILGGLIVKVGSRQID----------------
ATPD_HELMI      RMAVDPDLIGGLVVAFGDRIIDGSVAGKI---------
ATPD_GEOSL      SAQVDSALIGGVVTKIGDKVFDGSVRTQLNRI------
ATPD_DESOH      DIAQDPTLIGGIVTKVGDMVLDGSIKTQLSNMKESL--
ATPO_NEUCR      TNKVNADIIGGLVVEIGERTIDSSKIAKMNKLLSEAL-
ATPD_PORPU      VISVDPELIGGFTIQIGSKVIDTSIRGQLKQMASHL--
ATPD_DEHSC      LTATDPGLIAGLKARIGDKLIDGSISRRL---------
ATPD_DEHSB      LTATDPGLIAGLKARIGDKLIDGSISRRL---------
ATPD_XANP2      DVTVDPSILGGLIVKLGSRMVDASLKTKLNSI------
ATPD_RHOP2      NINVDPAIIGGLVVKLGSRMVDSSIRTKLNSI------
ATPD_CYAP8      KTSVDPDLIGGVTIKVGSQVFDASLRGQLRRVSLSL--
ATPD_AGRT5      SVTVDPSILGGLIVKVGSRQID----------------
ATPD_LEUCK      TNNVDESIIGGVILQSQSTLIDGSLQTKIAKMKAQLL-
ATPD_VESOH      DIVVDKDL------------------------------
ATPD_THEM4      EEKIDESLIAGAVIEFSGKMIDVSVSGRLNKIA-----
ATPD_ERYLH      SPTVDPDLLGGLVVTIGSKRIDGSIRTRLNTLANAM--
ATPD_THERP      RTTVDPELLGGVVLKIGDEVFDASVRTQLTNLRRQLV-
ATPD_AZOC5      DVTVDPSILGGLIVKLGSRMVDASLKTKLNSI------
ATPD_CLOB8      DTKIDKSLLGGVYVKVGNDIIDGT--------------
ATPD_ANADF      DREVDPALLGGVVAQVGSLVYDGSLRTQLEDLRRQL--
ATPD_CYAA5      KTDIDPDLIGGVIIKVGSQVFDASLRGQLRRISISL--
ATPD_BACSK      VNVVDSALIGGLKVRVGDRVFDGSIQGQLKRLEKQLV-
ATPD_RUBXD      RTSVDPEILGGAVFRFKDRLVDSSIRGRLEGLREAML-
ATPD_PHEZH      TTRVDPALLGGIKVKVGSRLFDASLRSKLDSLKFAL--
ATPD_CLOPE      KQEIDKSIIGGLYVRVGDDVIDGTVKSRLDDMKQIML-
ATPD_CLOP1      KQEIDKSIIGGLYVRVGDDVIDGTVKSRLDDMKQIML-
ATPD_SYNY3      ETKVDGDILGGIVIKVGSQVFDSSLRGQLRRVGLSL--
ATPD_PORYE      IISVEPELIGGFTIQIGSKVIDTSIRGQLRQMASHL--
ATPD_OCEIH      TNVVDPKILGGMKIRVGNTIYDGTVSNKLNRISRSIV-
ATPD_DESAA      TVSQDPALIGGIVTKIGDLVLDGSIRTQLLNLKETL--
ATPD_METRJ      XXXXXPSLIGGLVVKMGSRMVDASLKTKLNGIRLAM--
ATPD_CHLPD      KMALNGELLGGVTVKIGDTILDGSVRHQLQLLKKALV-
ATPD_BAUCH      NCIIDLSXXXXXXXXXXXXXXXSSMLGRLERLGTHL--
ATPD_SYNS9      DLSVDPALIGGFVVSLGSQVIDASLAGQVRRLGLAL--
ATPD_SINMW      NVTVDPSILGGLIVKVGSRQID----------------
ATPD_LYSSC      TNEIDPSLLGGIRVQIGNHIYDSSVANKLERLKRELI-
ATPD_GEOSW      ENIVDPSLIGGVKLRIGNRIYDGSISGKLERIQRQLI-
ATPD_THEEB      VTACDPELIGGVVIKVGSQIFDASLRGQLRRLSVTL--
ATPD_RHOBL      NTTVDESLIGGLIVKLGSTMIDTSVKSKLASL------
ATPD_PELPB      RMAINEQFIGGVAVKIGDTIYDGSISHQLQMLRKSLV-
ATPD_MACCJ      ENVVNSTLIGGIRATIGTTVYDGSVANELTQLEKS---
ATPD_LACBA      SSKVDPDVIGGVIVKAADTILDGSLRTKINRLRQQLL-
ATPD_CLOPD      XXQVDPTVLGGVLVKMGNEEIDGTVKTKLEKLKKQL--
ATPD_ALKMQ      KNEIDPTVIGGVLVKMGDKIIDGTVKARLNQMQDQLL-
ATPD_MAGSA      DVKVDPSLLGGLVVQVGSRMVDSSLKTKLQHLKLAM--
ATPD_BARBK      RLSVDPAILGGLIVRLGLYQIDTSLATQLSSLKLAL--
ATPD_SYNFM      EFQKDPSLIGGVLAQIGDFVLDGS--------------
ATPD_RHOBA      RESVDTELIGGMVIRVGDTVFDSSVASRLDKLGKS---
ATPD_JANSC      KETVDENIIGGLIVKIGSKMIDTSVRSKLNAL------
ATPD_CLOPS      KQEIDRSIIGGLYVRVGDDVIDGTVKSRLDDMKQIML-
ATPD_SYNAS      VVEEDRSLLGGIVIRVGDTLYDGSIKTQLSNI------
ATPD_LISMO      QNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDM------
ATPD_LISMF      QNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDM------
ATPD_LISMC      QNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDM------
ATPD_LISW6      QNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDM------
ATPD_LISMH      QNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDM------
ATPD_LISIN      QNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDM------
ATPD_DESAP      RYQVDPDIIGGLVVRLGDRIIDGSIKRQLERLKDSI--
ATPD_CORDI      HSEVDPSLLGGLVIRVGDEVIDGSTSGKLERLRANL--
ATPD_THELT      ETRIDESLIAGVVIECEGKTFDASVAGRIRNVTRHVL-
ATPD_LACF3      NEKVDPTILGGVVVKTANQTLDGSIKTKIEQI------
ATPD_DESAD      DFAMDKDILGGVVLQVGDKVLDASIRAQLQMM------
ATPD_BACME      SNIVDKTVIGGVKLRIGNRIYDGSISSKLETIHRGLL-
ATPD_BACHD      ENIVDPSIIGGLKIRIGDRIYDGSIKGQLDVLHRELV-
ATPD_ANAVT      ATKVDSDLIGGVIIKVGSQVID----------------
ATPD_GLUOX      TERTDAALLGGMTVRIGSTLFDTSIAGRLTRL------
ATPD_GEOKA      ENIIDPELIGGVKLRIGNRIYDGSVSGQLERIRRQLI-
ATPD_CHLPB      RLSLDEHLIGGVKVQIGDTILDNTVVHQLERLKHAL--
ATPD_BACA2      RNEVQTDLIGGIKVRIGNRIYDGSVSGKLERMERQL--
ATPD_THETN      IPVVDKEILGGLKLVIGNTVIDGSIKARLEALLKNM--
ATPD_RHOSK      KTTVDESLIGGLVVKLGSSMIDTSVKARLAAL------
ATPD_RHOS4      KTTVDESLIGGLVVKLGSSMIDTSVKARLAAL------
ATPD_RHOS1      KTTVDESLIGGLVVKLGSSMIDTSVKARLAAL------
ATPD_PROVI      AMKIDESLIGGLSVKIGDTIFDGSVRHQLQLLREKLV-
ATPD_PROM2      VTKIDPSLIGGFVASVGSKVIDASLASQIRKLGLSL--
ATPD_PROA2      RLALDEKLLGGVTVKIGDTIIDGSVRHQLDMLRVAL--
ATPD_PAUCH      KLLVDPSMIGGFIVSVGSQVIDASLAGQVRRLGLAL--
ATPD_ANOFW      TNIIDKDVIGGVKVRIGNRIFDGSVSGKLARLQRQL--
ATPO_SCHPO      SNKVTPSIIGGLIVEIGDNILDVSVGSRLNNL------
ATPD_RHIME      NVTVDPSILGGLIVKVGSRQID----------------
ATPD_PROMS      VTKIDPSLIGGFVASVGSKVIDASLASQIRKLGLTL--
ATPD_NOSP7      ETKVDSELIGGVIIKVGSQVIDASIRGQLRRLSLRL--
ATPD_LACSS      ESVVDPDIIGGIVLESNHKVIDGSVKHGLDQIKSLLL-
ATPO_PIG        EVKVDPSIMGGMIVRIGEKYVDMSAKTKIQKLSRAM--
ATPD_SYNPX      DLSVDPSLIGGFVVSLGSQVIDASLAGQVRRLGLAL--
ATPD_PELUB      NYKHDASLIGGLIVQVGSTMVDTSIKNKLQQI------
ATPD_MYXXD      ETRVDPSLLGGVSAQVGSILYDGSIRTQLEEMRREL--
ATPD_MOOTA      SSRVNPELIGGVVIRLGDRVLDAS--------------
ATPD_DESDG      NFSVDKDILGGVVLKVGDRVLDASLRAQLGIL------
ATPD_BACLD      RNEVNPDLIGGVKIRIGNRIYDGSVRGKLDRIERQL--
ATPO_PONAB      EAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLSRAM--
ATPD_SOLUE      RFAVDEALIGGAVARIGSTVYDGSVRGQLQTLERRL--
ATPD_CLOPA      REVIDKSIIGGVYVRVGDDVIDGTIKNKIEEM------
ATPD_BACCA      ENIIDPELIGGVNVRIGNRIYDGSVSGQLERIRRQLI-
ATPD_ALKOO      QNQVDPTIIGGVLVKIGDKVIDGTIKNRLATMQEQL--
ATPO_HUMAN      EAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAM--
ATPD_MAGSM      EISEKPELLGGLVIRMGSVMLDDSLRTQLHRL------
ATPD_ACICJ      RETVDPSLLGGLTVRIGSKLYDTSLKSRLQRL------
ATPD_SYNSC      DLSVDPSLIGGFVVSLGSQVIDASLSGQVRRLGLAL--
ATPD_STACT      TNVINKSLIGGIRAKVGTKVFDGSIQNDLAQI------
ATPD_SYNWW      SLKVDPGLIGGLKIRIGDQIVDAT--------------
ATPD_SULAA      TVKEDKSLIGGAVIKAGSYILDTSVRNYLKQLERSL--
ATPD_RICBR      NFEIDPTIMGGIVIKYDSILQDYSIKGSLDKIAKAL--
ATPD_RICB8      NFEIDPTIMGGIVIKYDSILQDYSIKGSLDKIAKAL--
ATPD_HYPNA      TSEVDPSLIGGIQLRLGSKLVDASVAKKLERM------
ATPO_RHIFE      EVKTDPSIMGGMIIRIGEKYVDMSAKTKIQKLS-----
ATPO_RAT        EVKTDPSIMGGMIVRIGEKYVDMSAKSKIQKLSKAM--
ATPD_RHOCA      NVAVDESLIGGMIVKLGSRMIDTTVKAKLASL------
ATPD_MYCGA      LYQTDPSLIAGIRIQSNDLLIDNSIDGKLKLLKHQL--
ATPD_GEOTN      ENIVDPELIGGVKLRIGNRIYDGSVSGQLERIQRQLI-
ATPD_BACST      ENIVEPELIGGVKLRIGNRIYDGSVSGQLERIQRQLI-
ATPD_MICAN      KTKVDGSLIGGVVIKVGSQVFDASIRG-----------
ATPD_EMIHU      ALKVDPQLIGGFTIEIGSKLIDTSIRGQLKQISTLL--
ATPO_SORAR      EVKTDPSIMGGMIVRIGEKYVDMSARTKIQKLSKAM--
ATPD_SORC5      THRQDPSLIAGVVTQIDDQVIDGSLRTRLSSFRDNLL-
ATPD_RHOS5      KTTVDESLIGGLVVKLGSSMIDTSVKARLAAL------
ATPD_PELLD      RMTLDPEMIGGVSVQIGDTILDGSIRHQLQVLRRTL--
ATPD_CAUCR      STRVDPSLL