[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA56702.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dy0B.bssp"
#ERROR : Can't open dsspfile "2dy0A.bssp"
#ERROR : Can't open dsspfile "1dbrC.bssp"
#ERROR : Can't open dsspfile "1dbrB.bssp"
#ERROR : Can't open dsspfile "1cjbA.bssp"
#ERROR : Can't open dsspfile "3dezB.bssp"
#ERROR : Can't open dsspfile "1d6nA.bssp"
#ERROR : Can't open dsspfile "2ehjA.bssp"
#ERROR : Can't open dsspfile "3dmpC.bssp"
#ERROR : Can't open dsspfile "1cjbC.bssp"
#ERROR : Can't open dsspfile "2e55A.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "1bd3D.bssp"
#ERROR : Can't open dsspfile "3dezA.bssp"
#ERROR : Can't open dsspfile "2aeeA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2aeeB.bssp"
#ERROR : Can't open dsspfile "1a3cA.bssp"
#ERROR : Can't open dsspfile "3dmpA.bssp"
#ERROR : Can't open dsspfile "1dbrA.bssp"
#ERROR : Can't open dsspfile "1dqnA.bssp"
#ERROR : Can't open dsspfile "1a95B.bssp"
#ERROR : Can't open dsspfile "3efhA.bssp"
#ERROR : Can't open dsspfile "1a97B.bssp"
#ERROR : Can't open dsspfile "1a4xB.bssp"
#ERROR : Can't open dsspfile "1a95A.bssp"
#ERROR : Can't open dsspfile "1a96D.bssp"
#ERROR : Can't open dsspfile "1a95D.bssp"
#ERROR : Can't open dsspfile "1a97D.bssp"
#ERROR : Can't open dsspfile "1a4xA.bssp"
#ERROR : Can't open dsspfile "1a97A.bssp"
#ERROR : Can't open dsspfile "1ao0A.bssp"
#ERROR : Can't open dsspfile "3dahC.bssp"
#ERROR : Can't open dsspfile "1a98A.bssp"
#ERROR : Can't open dsspfile "1ecbA.bssp"
#ERROR : Can't open dsspfile "1ecbD.bssp"
#ERROR : Can't open dsspfile "3dahB.bssp"

## Summary of PDB Search
:214
    3e-28  52%  2dy0B  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    3e-26  52%  2dy0A  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    4e-24  16%  1dbrC  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    1e-23  17%  1dbrB  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    1e-22  18%  1cjbA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    4e-22  17%  3dezB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    4e-22  15%  1d6nA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    2e-21  16%  2ehjA  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    8e-21  12%  3dmpC  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    1e-20  17%  1cjbC  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    1e-20  13%  2e55A  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    2e-20  14%  1bzyA  [c.61.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    5e-20  15%  1bd3D  [c.61.1] URACIL PHOSPHORIBOSYLTRANSFERASE
    8e-19  17%  3dezA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    1e-18  16%  2aeeA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-18   5%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    2e-18  14%  2aeeB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    1e-17  20%  1a3cA  [x.x.x] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    2e-17  14%  3dmpA  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    7e-17  16%  1dbrA  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    9e-17  12%  1dqnA  [c.61.1] GUANINE PHOSPHORIBOSYLTRANSFERASE
    6e-16  21%  1a95B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-15  18%  3efhA  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE 1
    2e-14  21%  1a97B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    4e-14  18%  1a4xB  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    5e-14  20%  1a95A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    6e-14  20%  1a96D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-13  19%  1a95D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    5e-13  20%  1a97D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-12  18%  1a4xA  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    8e-11  20%  1a97A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    9e-11  14%  1ao0A  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    3e-10  17%  3dahC  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE
    1e-08  17%  1a98A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-07  14%  1ecbA  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    5e-07  17%  1ecbD  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    1e-06  19%  3dahB  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE
:214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLARTFCDGHHKSQGVRFICLFNPNHIKCLPQILVYLGKASMERLKTKIRDIPDFPKPGVLFKDITPL
2dy0B           -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
2dy0A           -------------------------------------------LEYLKNSIKSIQDYPKPGILFRDVTSL
1dbrC           --------------------------------------------YIPDNTFYNADDFLVPPHCKPYIDKI
1dbrB           -----------------------------------------------DNTFYNADDFLVPPHCKPYIDKI
1cjbA           ----------------------------------------------NDDDGYDLDSFMIPAHYKKYLTKV
3dezB           --------------------------------------------------VYLKPEEPTKSPIYTDNRIT
1d6nA           --------------------------------------------------GYDLDLFCIPNHYAEDLERV
2ehjA           ----------------------------------------------VKHKLGLMREQDISTKRFRELASE
3dmpC           ----------------------------------------------IQHKLTHMRDKDTSTRTFRELLRE
1cjbC           -------------------------------------------VFVNDDDGYDLDSFMIPAHYKKYLTKV
2e55A           ----------------------------------------------IKHKVNTARIQDTSAEKLRKTLKE
1bzyA           ----------------------------------------------DDEPGYDLDLFCIPNHYAEDLERV
1bd3D           ----------------------------------------------LRAMMTIIRDKETPKEEFVFYADR
3dezA           --------------------------------------------------VYLKPEEPFTWIIYTDNRIT
2aeeA           -------------------------------------------AVYLKPEDPFTWASGIKSPIYTDNRVT
2boeX           --------------------------------------------MSAAQAAGKIPILVVSNAPGRDCGGG
2aeeB           -------------------------------------------LDIKAVYLKPEDPFGIKSPIYTDNRVT
1a3cA           ----------------------------------------------------------------------
3dmpA           ----------------------------------------------SRFPNLFILDQHKLTHMRDKDTST
1dbrA           -------------------------------------------MYIPDNTFYNADDFLVPPHCKPYIDKI
1dqnA           --------------------------------------------DVLSTFFKDRNDVLESEVKKFHLLAT
1a95B           ----------------------------------------------------------------------
3efhA           ------------------------------------------LSVAGADHIITMDLHASQIQGFFDIP--
1a97B           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
1a95A           ----------------------------------------------------------------------
1a96D           ----------------------------------------------------------------------
1a95D           ----------------------------------------------------------------------
1a97D           ---------------------------------------------------------------------I
1a4xA           ----------------------------------------------------------------------
1a97A           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
3dahC           ----------------------------------------------------------------------
1a98A           ----------------------------------------------------------------------
1ecbA           ---VASESVALDTLGFDFLRDVAPGEAIYITEEGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVY
1ecbD           ----------------------------------------------------------------------
3dahB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEY
2dy0B           LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
2dy0A           LEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
1dbrC           LLPGGLVKDRVEKLAYDIHRTEELHIICILKGSRGFFNLLIDYLATIQKYSGRESSVPPFFEHYVRLLTV
1dbrB           LLPGGLVKDRVEKLAYDIHRTEELHIICILKGSRGFFNLLIDYLATIQKYSGRESSVPPFFEHYVRLLTV
1cjbA           LVPNGVIKNRIEKLAYDIKKVEEFHILCLLKGSRGFFTALLKHLSRSAVETSKPLFGEHYVRVKSYCNDQ
3dezB           LSYPETRTLIENGFVETIKEAEVEVIAGTATAGIPHGAIIADKMNLPLAYIRSQIE--------------
1d6nA           FIPHGLIMDRTERLARDVMKEHHIVALCVLAGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLGSYCND
2ehjA           VGSLLTYEATADLETKVTIEGWNGPVEIDQIKGKKITVVPILRAGLGMMDVLENVPSARISVVGMYRNEE
3dmpC           ITLLMGYEITRN---LPITTKRVETPLVEIDAPVIAGLAIVPVLRAGVGMSDGLLELIPSARVGHIGVYR
1cjbC           LVPNGVIKNRIEKLIKKVYNNEEFHILCLLKGSRGFFTALLRIHNYSAVETSKPLFGEHYVRVKSYCNDQ
2e55A           LGFMLVYEALKDILLEEKEVRTWIGNKRFNYLNEEEIVFVPILLSFLEGALQVVPNAKVGFLGIKRNEET
1bzyA           FIPHGLIMDRTERLARDVMKEHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCND
1bd3D           LIRLLIEEALLDVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYEKL
3dezA           LSYPETRTLIENGFVETIKEAEVEVIAGTATAGIPHGAIIADKMNLPLAYIRSKPKNQ------------
2aeeA           LSYPKTRDLIENGFVETIKAHEVEVIAGTATAGIPHGAIIADKMTLPFAYIRSKPKGNQ-----------
2boeX           APSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSVQQEVLETMAYAGKALKAGSSQARIYFDAWHSP
2aeeB           LSYPKTRDLIENGFVETIKAHEVEVIAGTATAGIPHGAIIADKMTLPFAYIRSKPNQ-------------
1a3cA           --DEQAIRRALTRIAHEMIERNKCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDITLYRNDEPLVK
3dmpA           RTFRELLREITLLMGYPITTKRVETPLVEIDAPVIAGIVPVLRAGVGMSDLLELIPSARVGHIGVYRADD
1dbrA           LLPGGLVKDRVEKLAYDIHRTEELHIICILKGSRGFFNLLIDYLATIQKYSGRESSVPPFFEHYVRLNST
1dqnA           FEECKALAADTARRMYYKDVAEPVTLVALLTGAYLYASLLTVHLTFPYTLHFV------KVSSYKGTRQE
1a95B           --TWDMLQIHARKLASRLMPSQWKGIIAVSRGGLVPGALLARELGIRHVDTVC----------ISSYDHD
3efhA           VDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKM-------------
1a97B           --TWDMLQIHARKLASRLMPSQWKGIIAVSRGGLVPGALLARELGIRHVDTVA----------ISSYDHD
1a4xB           ----RALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDIT-------LYD
1a95A           --TWDMLQIHARKLASRLMPSQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISS-------------Y
1a96D           --TWDMLQIHARKLASRLMPSQWKGIIAVSRGGLVPGALLARELGIRHVDTVC---------------IS
1a95D           --TWDMLQIHARKLASRLMPSQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYRELKV--------
1a97D           VTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVAISS--------------
1a4xA           QAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVT-------VGEIDITLYR
1a97A           --TWDMLQIHARKLASRLMPSQWKGIIAVSRGGLVPGALLARELGIRHVDTVAI--------------SS
1ao0A           -----------MLAQESAVEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQALREQ
3dahC           ----------------------------------------------------------------------
1a98A           --TWDMLQIHARKLASRLMPSQWKGIIAVSRGGLVPGALLARELGIRHVDTVAIGD--------------
1ecbA           SARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPKSVRR
1ecbD           ---------------------------PIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMSVRRKL
3dahB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHS
2dy0B           GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQRLEKQTSYS
2dy0A           GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQRLEKQGI--
1dbrC           LS-----DDLSIFRDKHVLIVEDIVDTGFTLTEFGERLKAVGPKSMRIATLVEKRTDRSNSLKGDFVGFS
1dbrB           LS-----DDLSIFRDKHVLIVEDIVDTGFTLTEFGERLKAVGPKSMRIATLVEKRTDRSNSLKGDF----
1cjbA           STGTLEIVSEDLSKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFS
3dezB           ---------GRVTKGQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAIFTYELPKATANFASVKLVT
1d6nA           DIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFE
2ehjA           TLEPVPYFQKSNIDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAAPEGIAALEKAHPDVEL
3dmpC           ADDRPVEYLVPDLEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLMFLALVAAPEGVQVFQDAHPDV
1cjbC           STGTLEIVSEDLSKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFS
2e55A           LESHIYYSRLPELKGKIVVILDPMLATGGTLEVALREILKHSPLKVKSVHAIAAPEGLKRIEEKFKEVE-
1bzyA           QSTGIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFE
1bd3D           ---------PADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIERVFKEYPKV
3dezA           -------IEGRVTKGQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAIFTYELPKATANFEKAKLVT
2aeeA           -------IEGRVLKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIFTYELPKASQNFKEAGI--
2boeX           AQMASWLQQADISNSAHATNTSNYRWTADEVAYAKAVLSAIGNPS--LRAVID-----------------
2aeeB           -------IEGRVLKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIFTYELPKASQNFKEAGIKL
1a3cA           GA-----DIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKN
3dmpA           HRPVEYLVRLPDLEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLMFLALVAAPEGVQVFQDAHPDV
1dbrA           GQLTVLSDDLSIFRDKHVLIVEDIVDTGFTLTEFGERLKAVGPKSMRIATLVEKRTDRSNSLKGDFVGFS
1dqnA           SVVFDEEDLKQLKEKREVVLIDEYVDSGHTIFSIQEQIKHAKICSCFVKDVDAIKKHSALADT-------
1a95B           NQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTW--
3efhA           -------VLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEA
1a97B           NQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTW--
1a4xB           EPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKN
1a95A           NQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTW--
1a96D           SYRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTW--
1a95D           -------LKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTW--
1a97D           ---YLKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTW--
1a4xA           EPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKN
1a97A           YDRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTW--
1ao0A           GVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHVKISSPPIAHPCFYGIDTSTHEE
3dahC           -------NIIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAADRIAASALDE
1a98A           --------------GEGFIVIDDLVDTAVAIREMYPKAHFVTIFAKPAG--RPLVDDYVVDIPQDT----
1ecbA           KLNANRAEFRD----KNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATE
1ecbD           N------ANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATE
3dahB           --------------------MDDMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAADRIAASALDE


                         .         .         .         +         .         .         .:280
query           LVHY
2dy0B           LVPF
2dy0A           ----
1dbrC           IEDV
1dbrB           ----
1cjbA           IPDH
3dezB           LSNY
1d6nA           IPDK
2ehjA           Y---
3dmpC           KL--
1cjbC           IPDH
2e55A           ----
1bzyA           IPDK
1bd3D           RM--
3dezA           LSNY
2aeeA           ----
2boeX           ----
2aeeB           IT--
1a3cA           IPTS
3dmpA           KL--
1dbrA           IEDV
1dqnA           ----
1a95B           ----
3efhA           VV--
1a97B           ----
1a4xB           IPTS
1a95A           ----
1a96D           ----
1a95D           ----
1a97D           ----
1a4xA           IPTS
1a97A           ----
1ao0A           LI--
3dahC           LV--
1a98A           ----
1ecbA           LI--
1ecbD           LIAH
3dahB           LV--