[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA56789.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a9xA.bssp"
#ERROR : Can't open dsspfile "1bxrA.bssp"
#ERROR : Can't open dsspfile "1ce8A.bssp"
#ERROR : Can't open dsspfile "3bg5B.bssp"
#ERROR : Can't open dsspfile "1e4eB.bssp"
#ERROR : Can't open dsspfile "3bg5A.bssp"
#ERROR : Can't open dsspfile "3e5nA.bssp"
#ERROR : Can't open dsspfile "1c30A.bssp"
#ERROR : Can't open dsspfile "1ehiA.bssp"
#ERROR : Can't open dsspfile "3bg5D.bssp"
#ERROR : Can't open dsspfile "1b6sB.bssp"
#ERROR : Can't open dsspfile "1auvA.bssp"
#ERROR : Can't open dsspfile "1ehiB.bssp"
#ERROR : Can't open dsspfile "2c00B.bssp"
#ERROR : Can't open dsspfile "1auvB.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "1e4eA.bssp"
#ERROR : Can't open dsspfile "3df7A.bssp"
#ERROR : Can't open dsspfile "2dzdB.bssp"
#ERROR : Can't open dsspfile "1dv2A.bssp"
#ERROR : Can't open dsspfile "3bg5C.bssp"
#ERROR : Can't open dsspfile "2c00A.bssp"
#ERROR : Can't open dsspfile "1bncA.bssp"
#ERROR : Can't open dsspfile "1dv1A.bssp"
#ERROR : Can't open dsspfile "1auxA.bssp"
#ERROR : Can't open dsspfile "2dzdA.bssp"
#ERROR : Can't open dsspfile "1dv2B.bssp"
#ERROR : Can't open dsspfile "3d8tA.bssp"
#ERROR : Can't open dsspfile "1bncB.bssp"
#ERROR : Can't open dsspfile "1b6sC.bssp"
#ERROR : Can't open dsspfile "2dwcA.bssp"
#ERROR : Can't open dsspfile "1dosA.bssp"
#ERROR : Can't open dsspfile "1dv1B.bssp"
#ERROR : Can't open dsspfile "1b6sA.bssp"
#ERROR : Can't open dsspfile "2cqyA.bssp"
#ERROR : Can't open dsspfile "1cqjB.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"

## Summary of PDB Search
:307
    7e-19  16%  1a9xA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    4e-16  16%  1bxrA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    7e-16  16%  1ce8A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    2e-15  14%  3bg5B  [x.x.x] PYRUVATE CARBOXYLASE
    6e-15  11%  1e4eB  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    3e-14  13%  3bg5A  [x.x.x] PYRUVATE CARBOXYLASE
    4e-13  17%  3e5nA  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    6e-13  15%  1c30A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    1e-12  10%  1ehiA  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    5e-12  12%  3bg5D  [x.x.x] PYRUVATE CARBOXYLASE
    9e-12  11%  1b6sB  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-11  14%  1auvA  [c.30.1 - d.142.1] SYNAPSIN IA
    2e-11  12%  1ehiB  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    5e-11  17%  2c00B  [x.x.x] BIOTIN CARBOXYLASE
    5e-11  12%  1auvB  [c.30.1 - d.142.1] SYNAPSIN IA
    5e-11  13%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    7e-11  14%  1e4eA  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    3e-10  19%  3df7A  [x.x.x] PUTATIVE ATP-GRASP SUPERFAMILY PROTEIN
    8e-10  15%  2dzdB  [x.x.x] PYRUVATE CARBOXYLASE
    6e-09  14%  1dv2A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    6e-09  16%  3bg5C  [x.x.x] PYRUVATE CARBOXYLASE
    7e-09  16%  2c00A  [x.x.x] BIOTIN CARBOXYLASE
    7e-09  15%  1bncA  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    8e-09  14%  1dv1A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    4e-08  15%  1auxA  [c.30.1 - d.142.1] SYNAPSIN IA
    1e-07  13%  2dzdA  [x.x.x] PYRUVATE CARBOXYLASE
    1e-07  14%  1dv2B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    3e-07  12%  3d8tA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    3e-07  15%  1bncB  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    4e-07  10%  1b6sC  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    1e-06  14%  2dwcA  [x.x.x] 433AA LONG HYPOTHETICAL
    1e-06   7%  1dosA  [c.1.10] ALDOLASE CLASS II
    7e-06  13%  1dv1B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    9e-06  10%  1b6sA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    7e-05  17%  2cqyA  [x.x.x] PROPIONYL-COA CARBOXYLASE ALPHA CHAIN,
    4e-04  14%  1cqjB  [d.142.1 - c.23.4] SUCCINYL-COA SYNTHETASE BETA CHAIN
    5e-04  13%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
:307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAAIVRGIAAGSF
1a9xA           -----------------------------------------------------------AVLPTMGGQTA
1bxrA           -----------------------------------------------------------AVLPTMGGQTA
1ce8A           -----------------------------------------------------------AVLPTMGGQTA
3bg5B           ----------------------------------------------------------------VAIYSN
1e4eB           --------------------------CEKPCAEWENENCYSAVLSPDKKMHGLLVKKNHEYEIVAFSALH
3bg5A           ------------------------------------------------------RIIDVAKQANVDAIGY
3e5nA           ----------------------------------------------------------------------
1c30A           -----------------------PATIMTDPEMADATYIEPIHWEVVRKIIEKERPD--AVLPTMGGQTA
1ehiA           -------------------------------------------------------------FDIFFPVVH
3bg5D           ----------------------------------------------------------------------
1b6sB           ---------------------------------------------------------AAVPFQQSVITAE
1auvA           ----------------------------------------------------------------------
1ehiB           -------------------------------------------------------------FDIFFPVVH
2c00B           ----------------------------------------------------------------------
1auvB           ARVLLVIDEPHTDWAKYFKGKKIHGEIIKVEQAEFSDLNLVAHANGGFSVDEVLRNGVKFVLIRQHAFSA
2czgA           --KILLLGS--GELGKEIAIEAQRLGVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIP
1e4eA           --------------------------------------------------------VDVAFSALHG----
3df7A           --KLFLFEF--ATCGERIEDSTAVEGLAFKSAFDGFKNYEITGFVRPEFSCLF-TLPVDSDSEAFLIIAP
2dzdB           ----------------------------------------------------------------------
1dv2A           ---------------------------------------------------------SAAEITGAVAIHP
3bg5C           ---------------------------------------------------------------------Y
2c00A           ----------------------------------------------------------------------
1bncA           ----------------------------------------------------------------------
1dv1A           ----------------------------------------------------------------------
1auxA           ---------------------------------------------------------PDFVLIRQHAFSM
2dzdA           ----------------------------------------------------------------------
1dv2B           ----------------------------------------------------------------------
3d8tA           ----------------------------------------------------------------------
1bncB           ----------------------------------------------------------------------
1b6sC           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
1dosA           ----------------------------------------------------------------------
1dv1B           ----------------------------------------------------------------------
1b6sA           ----------------------------------------------------------------------
2cqyA           ----------------------------------------------------------------------
1cqjB           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREK
1a9xA           LNCALELERQGVLEEFGVTMIATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEAL---AVAADVG
1bxrA           LNCALELERQGVLEEFGVTMIATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEAL---AVAADVG
1ce8A           LNCALELERQGVLEEFGVTMIATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEAL---AVAADVG
3bg5B           ED----KSSLHRYKADESYLVSDLGPAESYLNIERIIDVAKQANVDAIHPGYLSENEQFA---RRCAEEG
1e4eB           GKSGEDGSIQGLFELSGIPVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR-----PVAATFT
3bg5A           GFLSENEQFARRCAEEGIKFIPHLEHLDMFGDKVKARTTAIKADLPVIPGTPIKSYELAK---EFAEEAG
3e5nA           ------------------FVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDRHTAHADVDTLIAQLG
1c30A           LNCALELERQGVLEEFGVTMIATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEAL---AVAADVG
1ehiA           GNLGEDGTLQGLFKLLDKPVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNSWDKIVAELG
3bg5D           ------KSSLHRYKADESYLVSDLGPAESYLNIERIIDVAKQANVDAIHPGFLSENEQFA---RRCAEEG
1b6sB           IERWPETA--LTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWP---AVFDRLG
1auvA           ------------LQYAGIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEEFPLIN-QTFYPNHKELSSTT
1ehiB           GNLGEDGTLQGLFKLLDKPYVAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNSWDKIVAELG
2c00B           -------DFAEQIERSGFTFVGPAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLPEDEETALAIAREVG
1auvB           RNGDYRSLVIGLQYA-GIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEEFPLINQTFYPNHKE-LSSTT
2czgA           EIEAINLDALFEFEKDGYFVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEA---CEKIG
1e4eA           -KSGEDGSIQGLFELSGIPVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDRP-----VAATFT
3df7A           EDDFLLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEV-QVPQTS--------------LRPLD
2dzdB           -----------------IFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGGPVDGLEDVV---AFAEAHG
1dv2A           GYGFLSENANFAVERSGFIFIGPAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG
3bg5C           GFLSENEQFARRCAEEGIKFIPHLEHLDMFGDKVKARTTAIKADLPVIPGTDGPI-KSYELAKEFAEEAG
2c00A           ---------------------PTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLPEDEETALAIAREVG
1bncA           ----------------------KAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG
1dv1A           ----------------GFIFIGPAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG
1auxA           ARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFLINQTFYPNHKEMLSSTT
2dzdA           ---------------------PNENHLDMFGDKVKARHAAVNAGIPVIPGSDGDGLEDVV---AFAEAHG
1dv2B           GFLSENANFAEQVERSGFIFIGPAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG
3d8tA           ------------AEKLGFTPLLFVQATEKVPVPEYRDQVRELAQGVDFLATTGVGVRDLLEAGKALGLDL
1bncB           ----------QVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGDDMDKNRAI---AKRIG
1b6sC           --------------------------FPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWP---AVFDRLG
2dwcA           --------------------------WIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEA---CEKIG
1dosA           ----------------------FVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVK
1dv1B           GFLSENANFAEQVERSGFIFIPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIG
1b6sA           -------------------------VFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWP---AVFDRLG
2cqyA           -------------------------SSGSSGDKIESKLLAKKAEVNTIPGFVVKDAEEAV---RIAREIG
1cqjB           -------------------------------HEYQAKQLFARYGLPAPVGYACTTPREA--EEAASKIGA
2czgB           --------------------------WIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEA---CEKIG


                         +         .         .         .         .         *         .:210
query           RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQ
1a9xA           FPCIIRPSFTMGGSGGGIAYNREEFEEILSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDA
1bxrA           FPCIIRPSFTMGGSGGGIAYNREEFEEDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDA
1ce8A           FPCIIRPSFTMGGSGGGIAYNREEFEEILSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDA
3bg5B           IKFIGPHLEHLDMFGDKVKARTTAIKA-----DLPVIPIDNPKHQVIGDEHGNIVHLFERDCSVQRRHQK
1e4eB           YPVFVKPARSGSSFGVKKVNSADELDYARQYDSKILIEQAVSG--CEVGCAVLGNSAALVVGEVDQIRLQ
3bg5A           FPLMIKATSRIVREESELEDAFHRAKSKSFGNSEVYIERYI--DNPKHIEVQVIGDEHGNIVHLFERDCS
3e5nA           LPLFVKPANQGSSVGVSQVRTAAALALALAYDHKVLVEAAVA------GREIECAVLGNAVPHASVC--G
1c30A           FPCIIRPSFTMGGSGGGIAYNREEFEEILSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDA
1ehiA           NIVFVKAANQGSSVGISRVTNAEEYTESFQYDYKVLIEEAVNGARELEVGVIGNDQGSGDGWYDYNNKFV
3bg5D           IKFIGPHLEHLDMFGDKVKARTT--AIKADLPVIPIDNPKHIEVQVIGDEHGNIVHLFERDC-SVQRRHQ
1b6sB           ELAIVKRRTGGYDGRGQWRLRANETEQPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQ
1auvA           YPVVVKGHAHSGGKVKVDNQHDFQDIASVLTKTYATTEPF-----IDAKYDVRIQKIGQNYKAYRTL---
1ehiB           NIVFVKAANQGSSVGISRVTNAEEYTESFQYDYKVLIEEAV-----NGARELEVGVIGNDQPLVSEI--G
2c00B           YPVIIKAAGGGMRVVYDESELIKSAKLTRAGNPMVYLEKFL-----TNPRHVEVQVLSDGQGNAIHRRHQ
1auvB           YPVVVKGHAHSGGKVKVDNQHDFQDIASVLTKTYATTEPFIDA-----KYDVRIQKIGQNYKAYR-----
2czgA           YPCHTKAIMSYFVKGPED---------IPKAWEKIIVEEHIDFDVEVTELAVRHFDENGEIVTTFPKPVG
1e4eA           YPVFVKPARSGSSFGVKKVNSADELDYARQYDSKILIEQAVCEVGCAVLGNSAALVVGEVDQYGIFRIHQ
3df7A           CKFIIKPRTACIGFSDEVPDG-------------HIAQEFIE------GINLSVSLAVGEDVKCLS-VNE
2dzdB           YPIIIKAALGGGGRGMRIVRSKSEVERAKSEAKEVYVEKL-----IENPKHIEVQILGDYEVHLYERDCS
1dv2A           YPVIIKASGGGGGRGMRVVRGDAELQSISMSNDMVYMEKYL-----ENPRHVEIQVLADGAIYLAERDCS
3bg5C           FPLMIKATSGGGGKGMRIVREESELEDASFGNSEVYIERYI-----DNPKHIEVQVIGDEHGNIVHLRDC
2c00A           YPVIIKAAGGRGMRVVYDESELIKSAKLGFGNPMVYLEKFLTNPR---HVEVQVLSDGQGNAIHLGDRDC
1bncA           YPVIIKRGMRVVRGDAELA---QSISMTRAEAKMVYMEKYLENPR---HVEIQVLADGQGNAIYLAERDC
1dv1A           YPVIIKASMRVVRGDAELA--QSISMTRAEANDMVYMEKYL-----ENPRHVEIQVLADGQGNAIYLAER
1auxA           YPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTTTEPFIDA-----KYDVRIQKIGQNYKAYMRTLEQ
2dzdA           YPIIIKAALGGGGRGMRIVRSKSEVKEAAFGSDEVYVEKLI-----ENPKHIEVQILGDYEGNIVHLYCS
1dv2B           YPVIIKASGGGGGRGMRVVRGDAELAQSAFSNDMVYMEKYL-----ENPRHVEIQVLADGQGNAIYLAER
3d8tA           EGPLAKAFRLARGAKAARALKEAGLPPHAVGDGTSLLPLLPQG-----RGVAALQLYKPLPLLENALAER
1bncB           YPVIIKRVVRGDAELAQSISMTR-----------AYMEKYLENPRHVEIQVLAGNAIYLAERDCSMQRRH
1b6sC           ELAIVKRRTGGQWRLRANETEQLPAECYGE----CIVEQGINF-----SGEVSLVGARGFDGSTVFYPLT
2dwcA           YPCHTKAIMSYFVKGPEDIPKAWEEEKIIVE---EHIDFDVEVT----ELAVRHFDENGEIVTTFPKPVG
1dosA           APVIVQFSNGAGKGVKSDVPQGAAILGAHYGVPVILHTDHC-----AKKLLPWIDGLLDAGEKHFAATGK
1dv1B           YPVIIKMRVVRGDAELAQSISMTRAYMEKYLENPRHVEIQV------LADGQGNAIYLAERDCSMQRRHQ
1b6sA           ELAIVKRRTGGGQWRLRANE---TEQLPAECYGECIVEQGI---NFSGEVSLVGARGFDGSTVFYPLTHQ
2cqyA           YPVMIKASAGGGGKGMRIAWDDEETRDGFRLDDRLLIEKFIDNP--------------------------
1cqjB           GPWVVKCQVHAGGRKEDIRAFAENWLGKTDANGQPLVEAATDIAKELYLGAVVASTEGGVEIEKVAEETP
2czgB           YPCHTKAISYFVKGPEDIPKAWKIIVE-----------EHIDFDVEVTELAVRHFDENGEIVTTFPKPVG


                         .         .         .         +         .         .         .:280
query           GWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTEVN
1a9xA           MGIHTGDSITVAPAQTLYQIMRNASMAVLREIGVETGGSFAVNPKNGRLIVIEMNPRVSR----------
1bxrA           MGIHTGDSITVAPAQTLYQIMRNASMAVLREIGVETGGSFAVNPKNGRLIVIEMNPRVSR----------
1ce8A           MGIHTGDSITVAPAQTLYQIMRNASMAVLREIGVETGGSFAVNPKNGRLIVIEMNPRVSR----------
3bg5B           VVEVAPSVGL---SPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQV----------
1e4eB           EPEKGSENAVITVPADLSAEERGRIQETVKKICRGLARVDMFLQDRGRIVLNEVNTLPGFTSYSAAAGIS
3bg5A           VQRRHQKVVSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQV----------
3e5nA           EVVVEIVIPAD-IDAQTQQRIQQIAVQAYQALCAGMARVDVFLCADGRIVINEVNTLPGFTKLWQASGLD
1c30A           MGIHTGDSITVAPAQTLYQIMRNASMAVLREIGVETGGSFAVNPKNGRLIVIEMNPRVSR----------
1ehiA           DNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLLRGEARMDFLLDENNVPYLGEPNTLPGFTRLWDYSDIN
3bg5D           KVVEVA--PSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQV----------
1b6sB           DGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHN----------
1auvA           -------------EQIASDRYKLWVDTCSEIFGLDICAVEALHGKDGRDHIIEVVGSSPLIGDHQDED--
1ehiB           AHTVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDENNVPYLGEPNTLPGFTRLWDYSDIN
2c00B           KVIEEA--PAPGIDEKARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQ-----------
1auvB           ------------LEQIASDRYKLWVDTCSEIFGLDICAVEALHGKDGRDHIIEVVGSSPLIGDHQDEDVE
2czgA           HYQIDGDYHASWQPAEISEKAEREVYRIAKRITLGGLGIFGVEMFGDKVWANEVSPRPHVTLASHPPGFS
1e4eA           EPEKGSENAVITVPADLSAEERGRIQETVKKIYRGLARVDMFLQDNGRIVLNEVNTLPGFTRMMAAAGIS
3df7A           QIINNFRYAGAVVPARVKREVVEEAVRAVECVENGYVGVDIVYS--DQPYVIEINARLPVVAFSRAYGAS
2dzdB           VQRRHQKVVEVAPSVSLSDELRQRICEAQLMRSVGYVNAGTVEVSGDEFYFIEVNPRIQ-----------
1dv2A           MQRRHQKVVEEAPAPGITPELRRYIGERCAKADIGYRGAGTFEFENGEFYFIKMNTRIQ-----------
3bg5C           SVQRRHQKVVEVAPSVLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQ-----------
2c00A           SLQRRHQKVIEEAPAPARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQV----------
1bncA           SMQRRHQKVVEEAPAPLRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQV----------
1dv1A           HQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQ-----------
1auxA           IAM--------------SDRYKLWVDTCSEIFGLDICAVEALHGKDGRDHIIEVVGSS------------
2dzdA           VQRRHQKVVSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLVSGDEFYFIEVNPRIQV------EHTI
1dv2B           DCSMQRRHQAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQ-----------
3d8tA           GYRVLPLMPYRHLPDPEGILRLEEAVLRGEVDALAFIQVEFLFEGAKDPKALREALNT------------
1bncB           QKVVEEAPAPG-ITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQV----------
1b6sC           HNLLRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHN----------
2dwcA           HYQIDGDYHASWQPAEIEREVYRIAKRITDVLGGLGIFVEMFVKG-DKVWANEVSPRPHVTLASHPPGFS
1dosA           PLFSSHMIDLSEESLQYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTEL----
1dv1B           KVVEEAP--APGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQV----------
1b6sA           DGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHN----------
2cqyA           ----------------------------------------------------------------------
1cqjB           HLIHKVA--LDPLTGPMPYQGRELAFKLGLEGKLVQQFTKIFMFLERDLALIEINPLVI-----------
2czgB           HYQIDGDYHASWQPAEIEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLAS--


                         .         *         .         .         .         .         +:350
query           IAGALAKNLLERLHSxxxxxxxxxxxx
1a9xA           ---------------------------
1bxrA           ---------------------------
1ce8A           ---------------------------
3bg5B           ---------------------------
1e4eB           LPELIDRLIVLAL--------------
3bg5A           ---------------------------
3e5nA           YRGLITRLIELALER------------
1c30A           ---------------------------
1ehiA           NAKLVDMLIDYGFE-------------
3bg5D           ---------------------------
1b6sB           ---------------------------
1auvA           ---------------------------
1ehiB           NAKLVDMLIDYGFED------------
2c00B           ---------------------------
1auvB           LVVN-----------------------
2czgA           EFALHLRAVL-----------------
1e4eA           LPELIDRLIVLAL--------------
3df7A           VADLLAGGEVKHV--------------
2dzdB           ---------------------------
1dv2A           ---------------------------
3bg5C           ---------------------------
2c00A           ---------------------------
1bncA           ---------------------------
1dv1A           ---------------------------
1auxA           ---------------------------
2dzdA           TEMITGIDIVQ----------------
1dv2B           ---------------------------
3d8tA           ---------------------------
1bncB           ---------------------------
1b6sC           ---------------------------
2dwcA           EFALHLR--------------------
1dosA           ---------------------------
1dv1B           ---------------------------
1b6sA           ---------------------------
2cqyA           ---------------------------
1cqjB           ---------------------------
2czgB           ---------------------------